data_8Q1V # _entry.id 8Q1V # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.388 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 8Q1V pdb_00008q1v 10.2210/pdb8q1v/pdb WWPDB D_1292132189 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2024-03-13 2 'Structure model' 1 1 2024-03-20 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_audit_revision_group.ordinal 1 _pdbx_audit_revision_group.revision_ordinal 2 _pdbx_audit_revision_group.data_content_type 'Structure model' _pdbx_audit_revision_group.group 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_volume' 2 2 'Structure model' '_citation.page_first' 3 2 'Structure model' '_citation.page_last' 4 2 'Structure model' '_citation.pdbx_database_id_PubMed' 5 2 'Structure model' '_citation.title' 6 2 'Structure model' '_citation_author.identifier_ORCID' 7 2 'Structure model' '_citation_author.name' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 8Q1V _pdbx_database_status.recvd_initial_deposition_date 2023-08-01 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_contact_author.id 2 _pdbx_contact_author.email g.r.hemsworth@leeds.ac.uk _pdbx_contact_author.name_first Glyn _pdbx_contact_author.name_last Hemsworth _pdbx_contact_author.name_mi Robert _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-8226-1380 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Rajagopal, B.S.' 1 ? 'Hemsworth, G.R.' 2 0000-0002-8226-1380 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Iucrj _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2052-2525 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 11 _citation.language ? _citation.page_first 260 _citation.page_last 274 _citation.title 'Structural dissection of two redox proteins from the shipworm symbiont Teredinibacter turnerae.' _citation.year 2024 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1107/S2052252524001386 _citation.pdbx_database_id_PubMed 38446458 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Rajagopal, B.S.' 1 ? primary 'Yates, N.' 2 ? primary 'Smith, J.' 3 ? primary 'Paradisi, A.' 4 ? primary 'Tetard-Jones, C.' 5 ? primary 'Willats, W.G.T.' 6 ? primary 'Marcus, S.' 7 ? primary 'Knox, J.P.' 8 ? primary 'Firdaus-Raih, M.' 9 ? primary 'Henrissat, B.' 10 ? primary 'Davies, G.J.' 11 ? primary 'Walton, P.H.' 12 ? primary 'Parkin, A.' 13 ? primary 'Hemsworth, G.R.' 14 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Putative lipoprotein' 9901.024 1 ? ? ? ? 2 non-polymer syn 'HEME C' 618.503 1 ? ? ? ? 3 non-polymer syn 'CHLORIDE ION' 35.453 3 ? ? ? ? 4 water nat water 18.015 60 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;EPVVDTPHPGEALYEAQCASCHGKDGKGGLAGGELLGCDVCGDFSLLALRIEQTMPLGNPEQCDTQCSSQIAGYMLENFA GLPPTLEHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;EPVVDTPHPGEALYEAQCASCHGKDGKGGLAGGELLGCDVCGDFSLLALRIEQTMPLGNPEQCDTQCSSQIAGYMLENFA GLPPTLEHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'HEME C' HEC 3 'CHLORIDE ION' CL 4 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLU n 1 2 PRO n 1 3 VAL n 1 4 VAL n 1 5 ASP n 1 6 THR n 1 7 PRO n 1 8 HIS n 1 9 PRO n 1 10 GLY n 1 11 GLU n 1 12 ALA n 1 13 LEU n 1 14 TYR n 1 15 GLU n 1 16 ALA n 1 17 GLN n 1 18 CYS n 1 19 ALA n 1 20 SER n 1 21 CYS n 1 22 HIS n 1 23 GLY n 1 24 LYS n 1 25 ASP n 1 26 GLY n 1 27 LYS n 1 28 GLY n 1 29 GLY n 1 30 LEU n 1 31 ALA n 1 32 GLY n 1 33 GLY n 1 34 GLU n 1 35 LEU n 1 36 LEU n 1 37 GLY n 1 38 CYS n 1 39 ASP n 1 40 VAL n 1 41 CYS n 1 42 GLY n 1 43 ASP n 1 44 PHE n 1 45 SER n 1 46 LEU n 1 47 LEU n 1 48 ALA n 1 49 LEU n 1 50 ARG n 1 51 ILE n 1 52 GLU n 1 53 GLN n 1 54 THR n 1 55 MET n 1 56 PRO n 1 57 LEU n 1 58 GLY n 1 59 ASN n 1 60 PRO n 1 61 GLU n 1 62 GLN n 1 63 CYS n 1 64 ASP n 1 65 THR n 1 66 GLN n 1 67 CYS n 1 68 SER n 1 69 SER n 1 70 GLN n 1 71 ILE n 1 72 ALA n 1 73 GLY n 1 74 TYR n 1 75 MET n 1 76 LEU n 1 77 GLU n 1 78 ASN n 1 79 PHE n 1 80 ALA n 1 81 GLY n 1 82 LEU n 1 83 PRO n 1 84 PRO n 1 85 THR n 1 86 LEU n 1 87 GLU n 1 88 HIS n 1 89 HIS n 1 90 HIS n 1 91 HIS n 1 92 HIS n 1 93 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 93 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene TERTU_2913 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Teredinibacter turnerae' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 2426 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CL non-polymer . 'CHLORIDE ION' ? 'Cl -1' 35.453 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HEC non-polymer . 'HEME C' ? 'C34 H34 Fe N4 O4' 618.503 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLU 1 1 ? ? ? A . n A 1 2 PRO 2 2 ? ? ? A . n A 1 3 VAL 3 3 ? ? ? A . n A 1 4 VAL 4 4 ? ? ? A . n A 1 5 ASP 5 5 ? ? ? A . n A 1 6 THR 6 6 ? ? ? A . n A 1 7 PRO 7 7 7 PRO PRO A . n A 1 8 HIS 8 8 8 HIS HIS A . n A 1 9 PRO 9 9 9 PRO PRO A . n A 1 10 GLY 10 10 10 GLY GLY A . n A 1 11 GLU 11 11 11 GLU GLU A . n A 1 12 ALA 12 12 12 ALA ALA A . n A 1 13 LEU 13 13 13 LEU LEU A . n A 1 14 TYR 14 14 14 TYR TYR A . n A 1 15 GLU 15 15 15 GLU GLU A . n A 1 16 ALA 16 16 16 ALA ALA A . n A 1 17 GLN 17 17 17 GLN GLN A . n A 1 18 CYS 18 18 18 CYS CYS A . n A 1 19 ALA 19 19 19 ALA ALA A . n A 1 20 SER 20 20 20 SER SER A . n A 1 21 CYS 21 21 21 CYS CYS A . n A 1 22 HIS 22 22 22 HIS HIS A . n A 1 23 GLY 23 23 23 GLY GLY A . n A 1 24 LYS 24 24 24 LYS LYS A . n A 1 25 ASP 25 25 25 ASP ASP A . n A 1 26 GLY 26 26 26 GLY GLY A . n A 1 27 LYS 27 27 27 LYS LYS A . n A 1 28 GLY 28 28 28 GLY GLY A . n A 1 29 GLY 29 29 29 GLY GLY A . n A 1 30 LEU 30 30 30 LEU LEU A . n A 1 31 ALA 31 31 31 ALA ALA A . n A 1 32 GLY 32 32 32 GLY GLY A . n A 1 33 GLY 33 33 33 GLY GLY A . n A 1 34 GLU 34 34 34 GLU GLU A . n A 1 35 LEU 35 35 35 LEU LEU A . n A 1 36 LEU 36 36 36 LEU LEU A . n A 1 37 GLY 37 37 37 GLY GLY A . n A 1 38 CYS 38 38 38 CYS CYS A . n A 1 39 ASP 39 39 39 ASP ASP A . n A 1 40 VAL 40 40 40 VAL VAL A . n A 1 41 CYS 41 41 41 CYS CYS A . n A 1 42 GLY 42 42 42 GLY GLY A . n A 1 43 ASP 43 43 43 ASP ASP A . n A 1 44 PHE 44 44 44 PHE PHE A . n A 1 45 SER 45 45 45 SER SER A . n A 1 46 LEU 46 46 46 LEU LEU A . n A 1 47 LEU 47 47 47 LEU LEU A . n A 1 48 ALA 48 48 48 ALA ALA A . n A 1 49 LEU 49 49 49 LEU LEU A . n A 1 50 ARG 50 50 50 ARG ARG A . n A 1 51 ILE 51 51 51 ILE ILE A . n A 1 52 GLU 52 52 52 GLU GLU A . n A 1 53 GLN 53 53 53 GLN GLN A . n A 1 54 THR 54 54 54 THR THR A . n A 1 55 MET 55 55 55 MET MET A . n A 1 56 PRO 56 56 56 PRO PRO A . n A 1 57 LEU 57 57 57 LEU LEU A . n A 1 58 GLY 58 58 58 GLY GLY A . n A 1 59 ASN 59 59 59 ASN ASN A . n A 1 60 PRO 60 60 60 PRO PRO A . n A 1 61 GLU 61 61 61 GLU GLU A . n A 1 62 GLN 62 62 62 GLN GLN A . n A 1 63 CYS 63 63 63 CYS CYS A . n A 1 64 ASP 64 64 64 ASP ASP A . n A 1 65 THR 65 65 65 THR THR A . n A 1 66 GLN 66 66 66 GLN GLN A . n A 1 67 CYS 67 67 67 CYS CYS A . n A 1 68 SER 68 68 68 SER SER A . n A 1 69 SER 69 69 69 SER SER A . n A 1 70 GLN 70 70 70 GLN GLN A . n A 1 71 ILE 71 71 71 ILE ILE A . n A 1 72 ALA 72 72 72 ALA ALA A . n A 1 73 GLY 73 73 73 GLY GLY A . n A 1 74 TYR 74 74 74 TYR TYR A . n A 1 75 MET 75 75 75 MET MET A . n A 1 76 LEU 76 76 76 LEU LEU A . n A 1 77 GLU 77 77 77 GLU GLU A . n A 1 78 ASN 78 78 78 ASN ASN A . n A 1 79 PHE 79 79 79 PHE PHE A . n A 1 80 ALA 80 80 80 ALA ALA A . n A 1 81 GLY 81 81 81 GLY GLY A . n A 1 82 LEU 82 82 82 LEU LEU A . n A 1 83 PRO 83 83 83 PRO PRO A . n A 1 84 PRO 84 84 84 PRO PRO A . n A 1 85 THR 85 85 85 THR THR A . n A 1 86 LEU 86 86 ? ? ? A . n A 1 87 GLU 87 87 ? ? ? A . n A 1 88 HIS 88 88 ? ? ? A . n A 1 89 HIS 89 89 ? ? ? A . n A 1 90 HIS 90 90 ? ? ? A . n A 1 91 HIS 91 91 ? ? ? A . n A 1 92 HIS 92 92 ? ? ? A . n A 1 93 HIS 93 93 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HEC 1 101 101 HEC HEC A . C 3 CL 1 102 102 CL CL A . D 3 CL 1 103 103 CL CL A . E 3 CL 1 104 104 CL CL A . F 4 HOH 1 201 201 HOH HOH A . F 4 HOH 2 202 203 HOH HOH A . F 4 HOH 3 203 202 HOH HOH A . F 4 HOH 4 204 204 HOH HOH A . F 4 HOH 5 205 205 HOH HOH A . F 4 HOH 6 206 206 HOH HOH A . F 4 HOH 7 207 207 HOH HOH A . F 4 HOH 8 208 208 HOH HOH A . F 4 HOH 9 209 209 HOH HOH A . F 4 HOH 10 210 210 HOH HOH A . F 4 HOH 11 211 211 HOH HOH A . F 4 HOH 12 212 212 HOH HOH A . F 4 HOH 13 213 215 HOH HOH A . F 4 HOH 14 214 213 HOH HOH A . F 4 HOH 15 215 214 HOH HOH A . F 4 HOH 16 216 216 HOH HOH A . F 4 HOH 17 217 217 HOH HOH A . F 4 HOH 18 218 219 HOH HOH A . F 4 HOH 19 219 218 HOH HOH A . F 4 HOH 20 220 220 HOH HOH A . F 4 HOH 21 221 221 HOH HOH A . F 4 HOH 22 222 222 HOH HOH A . F 4 HOH 23 223 223 HOH HOH A . F 4 HOH 24 224 224 HOH HOH A . F 4 HOH 25 225 225 HOH HOH A . F 4 HOH 26 226 228 HOH HOH A . F 4 HOH 27 227 226 HOH HOH A . F 4 HOH 28 228 227 HOH HOH A . F 4 HOH 29 229 229 HOH HOH A . F 4 HOH 30 230 230 HOH HOH A . F 4 HOH 31 231 231 HOH HOH A . F 4 HOH 32 232 232 HOH HOH A . F 4 HOH 33 233 233 HOH HOH A . F 4 HOH 34 234 234 HOH HOH A . F 4 HOH 35 235 238 HOH HOH A . F 4 HOH 36 236 235 HOH HOH A . F 4 HOH 37 237 237 HOH HOH A . F 4 HOH 38 238 240 HOH HOH A . F 4 HOH 39 239 236 HOH HOH A . F 4 HOH 40 240 241 HOH HOH A . F 4 HOH 41 241 239 HOH HOH A . F 4 HOH 42 242 242 HOH HOH A . F 4 HOH 43 243 243 HOH HOH A . F 4 HOH 44 244 244 HOH HOH A . F 4 HOH 45 245 245 HOH HOH A . F 4 HOH 46 246 246 HOH HOH A . F 4 HOH 47 247 248 HOH HOH A . F 4 HOH 48 248 247 HOH HOH A . F 4 HOH 49 249 249 HOH HOH A . F 4 HOH 50 250 251 HOH HOH A . F 4 HOH 51 251 250 HOH HOH A . F 4 HOH 52 252 253 HOH HOH A . F 4 HOH 53 253 252 HOH HOH A . F 4 HOH 54 254 254 HOH HOH A . F 4 HOH 55 255 255 HOH HOH A . F 4 HOH 56 256 256 HOH HOH A . F 4 HOH 57 257 257 HOH HOH A . F 4 HOH 58 258 258 HOH HOH A . F 4 HOH 59 259 259 HOH HOH A . F 4 HOH 60 260 260 HOH HOH A . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A LYS 24 ? CG ? A LYS 24 CG 2 1 Y 1 A LYS 24 ? CD ? A LYS 24 CD 3 1 Y 1 A LYS 24 ? CE ? A LYS 24 CE 4 1 Y 1 A LYS 24 ? NZ ? A LYS 24 NZ 5 1 Y 1 A THR 85 ? OG1 ? A THR 85 OG1 6 1 Y 1 A THR 85 ? CG2 ? A THR 85 CG2 # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0419 1 ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0419 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? SHELX ? ? ? . 4 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 5 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 8Q1V _cell.details ? _cell.formula_units_Z ? _cell.length_a 92.669 _cell.length_a_esd ? _cell.length_b 92.669 _cell.length_b_esd ? _cell.length_c 92.669 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 24 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 8Q1V _symmetry.cell_setting ? _symmetry.Int_Tables_number 213 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 41 3 2' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 8Q1V _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 3.35 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 63.27 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '20-25 % (w/v) PEG 6000, 1 M LiCl2 and 0.1 M Citrate pH 4.0' _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 291 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS3 2M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2017-11-29 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.966 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'ESRF BEAMLINE MASSIF-1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.966 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline MASSIF-1 _diffrn_source.pdbx_synchrotron_site ESRF # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 8Q1V _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.40 _reflns.d_resolution_low 65.53 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 27430 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 100.0 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 36.9 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 22.5 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.129 _reflns.pdbx_Rpim_I_all 0.029 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 1.000 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs 0.125 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_CC_star _reflns_shell.pdbx_R_split _reflns_shell.percent_possible_all _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_percent_possible_ellipsoidal _reflns_shell.pdbx_percent_possible_spherical _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous _reflns_shell.pdbx_percent_possible_spherical_anomalous _reflns_shell.pdbx_redundancy_anomalous _reflns_shell.pdbx_CC_half_anomalous _reflns_shell.pdbx_absDiff_over_sigma_anomalous _reflns_shell.pdbx_percent_possible_anomalous 7.67 65.53 ? ? ? ? ? ? 232 ? ? ? ? ? ? ? ? ? ? ? 30.6 ? ? ? 0.037 0.008 ? 1 1 1.000 ? ? ? ? 0.036 ? ? ? ? ? ? ? ? ? 1.40 1.42 ? ? ? ? ? ? 1326 ? ? ? ? ? ? ? ? ? ? ? 37.5 ? ? ? 3.976 0.894 ? 2 1 0.629 ? ? ? ? 3.874 ? ? ? ? ? ? ? ? ? # _refine.aniso_B[1][1] 0.000 _refine.aniso_B[1][2] 0.000 _refine.aniso_B[1][3] 0.000 _refine.aniso_B[2][2] 0.000 _refine.aniso_B[2][3] 0.000 _refine.aniso_B[3][3] 0.000 _refine.B_iso_max ? _refine.B_iso_mean 19.500 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc 0.968 _refine.correlation_coeff_Fo_to_Fc_free 0.947 _refine.details 'Hydrogens have been added in their riding positions' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 8Q1V _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.400 _refine.ls_d_res_low 65.53 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 27351 _refine.ls_number_reflns_R_free 1355 _refine.ls_number_reflns_R_work 25996 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.923 _refine.ls_percent_reflns_R_free 4.954 _refine.ls_R_factor_all 0.166 _refine.ls_R_factor_obs ? _refine.ls_R_factor_R_free 0.1930 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1645 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'MASK BULK SOLVENT' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct SAD _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.044 _refine.pdbx_overall_ESU_R_Free 0.045 _refine.pdbx_solvent_vdw_probe_radii 1.200 _refine.pdbx_solvent_ion_probe_radii 0.800 _refine.pdbx_solvent_shrinkage_radii 0.800 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 1.504 _refine.overall_SU_ML 0.026 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 1.400 _refine_hist.d_res_low 65.53 _refine_hist.number_atoms_solvent 60 _refine_hist.number_atoms_total 667 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 561 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 46 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.017 0.012 647 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 0.001 0.015 554 ? r_bond_other_d ? ? 'X-RAY DIFFRACTION' ? 2.543 1.774 894 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 0.806 1.629 1293 ? r_angle_other_deg ? ? 'X-RAY DIFFRACTION' ? 5.855 5.000 85 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 13.337 5.000 1 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 15.241 10.000 91 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 15.718 10.000 25 ? r_dihedral_angle_6_deg ? ? 'X-RAY DIFFRACTION' ? 0.081 0.200 86 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.034 0.200 1 ? r_chiral_restr_other ? ? 'X-RAY DIFFRACTION' ? 0.030 0.020 777 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 0.016 0.020 131 ? r_gen_planes_other ? ? 'X-RAY DIFFRACTION' ? 0.350 0.200 151 ? r_nbd_refined ? ? 'X-RAY DIFFRACTION' ? 0.196 0.200 509 ? r_symmetry_nbd_other ? ? 'X-RAY DIFFRACTION' ? 0.177 0.200 306 ? r_nbtor_refined ? ? 'X-RAY DIFFRACTION' ? 0.079 0.200 306 ? r_symmetry_nbtor_other ? ? 'X-RAY DIFFRACTION' ? 0.164 0.200 35 ? r_xyhbond_nbd_refined ? ? 'X-RAY DIFFRACTION' ? 0.192 0.200 7 ? r_symmetry_nbd_refined ? ? 'X-RAY DIFFRACTION' ? 0.196 0.200 30 ? r_nbd_other ? ? 'X-RAY DIFFRACTION' ? 0.079 0.200 12 ? r_symmetry_xyhbond_nbd_refined ? ? 'X-RAY DIFFRACTION' ? 4.469 1.814 323 ? r_mcbond_it ? ? 'X-RAY DIFFRACTION' ? 4.390 1.811 323 ? r_mcbond_other ? ? 'X-RAY DIFFRACTION' ? 6.880 3.251 404 ? r_mcangle_it ? ? 'X-RAY DIFFRACTION' ? 6.895 3.258 405 ? r_mcangle_other ? ? 'X-RAY DIFFRACTION' ? 5.457 1.920 324 ? r_scbond_it ? ? 'X-RAY DIFFRACTION' ? 5.442 1.919 322 ? r_scbond_other ? ? 'X-RAY DIFFRACTION' ? 8.016 3.463 486 ? r_scangle_it ? ? 'X-RAY DIFFRACTION' ? 8.008 3.462 486 ? r_scangle_other ? ? 'X-RAY DIFFRACTION' ? 12.770 18.240 786 ? r_lrange_it ? ? 'X-RAY DIFFRACTION' ? 11.932 17.980 777 ? r_lrange_other ? ? 'X-RAY DIFFRACTION' ? 3.032 3.000 1201 ? r_rigid_bond_restr ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free _refine_ls_shell.R_factor_R_free 'X-RAY DIFFRACTION' 1.400 1.437 . . 94 1893 99.8493 . . . . 0.251 . . . . . . . . . . . 0.264 'X-RAY DIFFRACTION' 1.437 1.476 . . 106 1810 99.8957 . . . . 0.227 . . . . . . . . . . . 0.270 'X-RAY DIFFRACTION' 1.476 1.519 . . 92 1789 99.8938 . . . . 0.197 . . . . . . . . . . . 0.211 'X-RAY DIFFRACTION' 1.519 1.566 . . 79 1749 99.8907 . . . . 0.185 . . . . . . . . . . . 0.187 'X-RAY DIFFRACTION' 1.566 1.617 . . 98 1668 99.7740 . . . . 0.165 . . . . . . . . . . . 0.185 'X-RAY DIFFRACTION' 1.617 1.674 . . 92 1607 99.8824 . . . . 0.169 . . . . . . . . . . . 0.214 'X-RAY DIFFRACTION' 1.674 1.737 . . 64 1601 99.8800 . . . . 0.152 . . . . . . . . . . . 0.142 'X-RAY DIFFRACTION' 1.737 1.808 . . 83 1518 99.8130 . . . . 0.138 . . . . . . . . . . . 0.185 'X-RAY DIFFRACTION' 1.808 1.888 . . 92 1453 100.0000 . . . . 0.127 . . . . . . . . . . . 0.138 'X-RAY DIFFRACTION' 1.888 1.980 . . 75 1400 100.0000 . . . . 0.128 . . . . . . . . . . . 0.172 'X-RAY DIFFRACTION' 1.980 2.087 . . 67 1344 100.0000 . . . . 0.132 . . . . . . . . . . . 0.121 'X-RAY DIFFRACTION' 2.087 2.213 . . 61 1284 99.9257 . . . . 0.142 . . . . . . . . . . . 0.159 'X-RAY DIFFRACTION' 2.213 2.366 . . 58 1200 100.0000 . . . . 0.143 . . . . . . . . . . . 0.182 'X-RAY DIFFRACTION' 2.366 2.555 . . 64 1120 100.0000 . . . . 0.142 . . . . . . . . . . . 0.189 'X-RAY DIFFRACTION' 2.555 2.799 . . 53 1055 100.0000 . . . . 0.151 . . . . . . . . . . . 0.201 'X-RAY DIFFRACTION' 2.799 3.128 . . 38 960 100.0000 . . . . 0.157 . . . . . . . . . . . 0.173 'X-RAY DIFFRACTION' 3.128 3.611 . . 41 856 100.0000 . . . . 0.165 . . . . . . . . . . . 0.178 'X-RAY DIFFRACTION' 3.611 4.419 . . 43 735 100.0000 . . . . 0.163 . . . . . . . . . . . 0.200 'X-RAY DIFFRACTION' 4.419 6.236 . . 30 592 100.0000 . . . . 0.217 . . . . . . . . . . . 0.256 'X-RAY DIFFRACTION' 6.236 65.53 . . 25 362 100.0000 . . . . 0.243 . . . . . . . . . . . 0.275 # _struct.entry_id 8Q1V _struct.title 'TtX183A - A c-type cytochrome domain from the Teredinibacter turnerae protein TERTU_2913' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 8Q1V _struct_keywords.text 'Cytochrome, redox, X183, CAZy, ELECTRON TRANSPORT' _struct_keywords.pdbx_keywords 'ELECTRON TRANSPORT' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 3 ? E N N 3 ? F N N 4 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code C5BNC6_TERTT _struct_ref.pdbx_db_accession C5BNC6 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;EPVVDTPHPGEALYEAQCASCHGKDGKGGLAGGELLGCDVCGDFSLLALRIEQTMPLGNPEQCDTQCSSQIAGYMLENFA GLPPT ; _struct_ref.pdbx_align_begin 62 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 8Q1V _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 85 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession C5BNC6 _struct_ref_seq.db_align_beg 62 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 146 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 85 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 8Q1V LEU A 86 ? UNP C5BNC6 ? ? 'expression tag' 86 1 1 8Q1V GLU A 87 ? UNP C5BNC6 ? ? 'expression tag' 87 2 1 8Q1V HIS A 88 ? UNP C5BNC6 ? ? 'expression tag' 88 3 1 8Q1V HIS A 89 ? UNP C5BNC6 ? ? 'expression tag' 89 4 1 8Q1V HIS A 90 ? UNP C5BNC6 ? ? 'expression tag' 90 5 1 8Q1V HIS A 91 ? UNP C5BNC6 ? ? 'expression tag' 91 6 1 8Q1V HIS A 92 ? UNP C5BNC6 ? ? 'expression tag' 92 7 1 8Q1V HIS A 93 ? UNP C5BNC6 ? ? 'expression tag' 93 8 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 1220 ? 1 MORE -42 ? 1 'SSA (A^2)' 4750 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 HIS A 8 ? CYS A 18 ? HIS A 8 CYS A 18 1 ? 11 HELX_P HELX_P2 AA2 CYS A 18 ? GLY A 23 ? CYS A 18 GLY A 23 1 ? 6 HELX_P HELX_P3 AA3 GLY A 29 ? GLY A 33 ? GLY A 29 GLY A 33 5 ? 5 HELX_P HELX_P4 AA4 ASP A 43 ? MET A 55 ? ASP A 43 MET A 55 1 ? 13 HELX_P HELX_P5 AA5 ASN A 59 ? CYS A 63 ? ASN A 59 CYS A 63 5 ? 5 HELX_P HELX_P6 AA6 ASP A 64 ? PHE A 79 ? ASP A 64 PHE A 79 1 ? 16 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 38 SG ? ? ? 1_555 A CYS 41 SG ? ? A CYS 38 A CYS 41 1_555 ? ? ? ? ? ? ? 2.057 ? ? disulf2 disulf ? ? A CYS 63 SG ? ? ? 1_555 A CYS 67 SG ? ? A CYS 63 A CYS 67 1_555 ? ? ? ? ? ? ? 2.026 ? ? covale1 covale none ? A CYS 18 SG ? ? ? 1_555 B HEC . CAB ? ? A CYS 18 A HEC 101 1_555 ? ? ? ? ? ? ? 1.955 ? ? metalc1 metalc ? ? A HIS 22 NE2 ? ? ? 1_555 B HEC . FE ? ? A HIS 22 A HEC 101 1_555 ? ? ? ? ? ? ? 2.025 ? ? metalc2 metalc ? ? A MET 55 SD ? ? ? 1_555 B HEC . FE ? ? A MET 55 A HEC 101 1_555 ? ? ? ? ? ? ? 2.325 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference disulf ? ? covale ? ? metalc ? ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 NE2 ? A HIS 22 ? A HIS 22 ? 1_555 FE ? B HEC . ? A HEC 101 ? 1_555 NA ? B HEC . ? A HEC 101 ? 1_555 91.0 ? 2 NE2 ? A HIS 22 ? A HIS 22 ? 1_555 FE ? B HEC . ? A HEC 101 ? 1_555 NB ? B HEC . ? A HEC 101 ? 1_555 86.9 ? 3 NA ? B HEC . ? A HEC 101 ? 1_555 FE ? B HEC . ? A HEC 101 ? 1_555 NB ? B HEC . ? A HEC 101 ? 1_555 90.3 ? 4 NE2 ? A HIS 22 ? A HIS 22 ? 1_555 FE ? B HEC . ? A HEC 101 ? 1_555 NC ? B HEC . ? A HEC 101 ? 1_555 87.2 ? 5 NA ? B HEC . ? A HEC 101 ? 1_555 FE ? B HEC . ? A HEC 101 ? 1_555 NC ? B HEC . ? A HEC 101 ? 1_555 178.0 ? 6 NB ? B HEC . ? A HEC 101 ? 1_555 FE ? B HEC . ? A HEC 101 ? 1_555 NC ? B HEC . ? A HEC 101 ? 1_555 88.9 ? 7 NE2 ? A HIS 22 ? A HIS 22 ? 1_555 FE ? B HEC . ? A HEC 101 ? 1_555 ND ? B HEC . ? A HEC 101 ? 1_555 92.9 ? 8 NA ? B HEC . ? A HEC 101 ? 1_555 FE ? B HEC . ? A HEC 101 ? 1_555 ND ? B HEC . ? A HEC 101 ? 1_555 88.7 ? 9 NB ? B HEC . ? A HEC 101 ? 1_555 FE ? B HEC . ? A HEC 101 ? 1_555 ND ? B HEC . ? A HEC 101 ? 1_555 179.0 ? 10 NC ? B HEC . ? A HEC 101 ? 1_555 FE ? B HEC . ? A HEC 101 ? 1_555 ND ? B HEC . ? A HEC 101 ? 1_555 92.1 ? 11 NE2 ? A HIS 22 ? A HIS 22 ? 1_555 FE ? B HEC . ? A HEC 101 ? 1_555 SD ? A MET 55 ? A MET 55 ? 1_555 173.6 ? 12 NA ? B HEC . ? A HEC 101 ? 1_555 FE ? B HEC . ? A HEC 101 ? 1_555 SD ? A MET 55 ? A MET 55 ? 1_555 92.7 ? 13 NB ? B HEC . ? A HEC 101 ? 1_555 FE ? B HEC . ? A HEC 101 ? 1_555 SD ? A MET 55 ? A MET 55 ? 1_555 87.8 ? 14 NC ? B HEC . ? A HEC 101 ? 1_555 FE ? B HEC . ? A HEC 101 ? 1_555 SD ? A MET 55 ? A MET 55 ? 1_555 89.1 ? 15 ND ? B HEC . ? A HEC 101 ? 1_555 FE ? B HEC . ? A HEC 101 ? 1_555 SD ? A MET 55 ? A MET 55 ? 1_555 92.5 ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id MET _struct_mon_prot_cis.label_seq_id 55 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id MET _struct_mon_prot_cis.auth_seq_id 55 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 56 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 56 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle -2.52 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 HE2 A HIS 22 ? ? FE A HEC 101 ? ? 1.18 2 1 SG A CYS 21 ? ? CAC A HEC 101 ? ? 2.11 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 CYS A 18 ? ? -130.89 -36.37 2 1 ASN A 59 ? ? -149.00 59.48 # _pdbx_entry_details.entry_id 8Q1V _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.has_protein_modification ? # _pdbx_distant_solvent_atoms.id 1 _pdbx_distant_solvent_atoms.PDB_model_num 1 _pdbx_distant_solvent_atoms.auth_atom_id O _pdbx_distant_solvent_atoms.label_alt_id ? _pdbx_distant_solvent_atoms.auth_asym_id A _pdbx_distant_solvent_atoms.auth_comp_id HOH _pdbx_distant_solvent_atoms.auth_seq_id 260 _pdbx_distant_solvent_atoms.PDB_ins_code ? _pdbx_distant_solvent_atoms.neighbor_macromolecule_distance 6.03 _pdbx_distant_solvent_atoms.neighbor_ligand_distance . # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLU 1 ? A GLU 1 2 1 Y 1 A PRO 2 ? A PRO 2 3 1 Y 1 A VAL 3 ? A VAL 3 4 1 Y 1 A VAL 4 ? A VAL 4 5 1 Y 1 A ASP 5 ? A ASP 5 6 1 Y 1 A THR 6 ? A THR 6 7 1 Y 1 A LEU 86 ? A LEU 86 8 1 Y 1 A GLU 87 ? A GLU 87 9 1 Y 1 A HIS 88 ? A HIS 88 10 1 Y 1 A HIS 89 ? A HIS 89 11 1 Y 1 A HIS 90 ? A HIS 90 12 1 Y 1 A HIS 91 ? A HIS 91 13 1 Y 1 A HIS 92 ? A HIS 92 14 1 Y 1 A HIS 93 ? A HIS 93 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CL CL CL N N 74 CYS N N N N 75 CYS CA C N R 76 CYS C C N N 77 CYS O O N N 78 CYS CB C N N 79 CYS SG S N N 80 CYS OXT O N N 81 CYS H H N N 82 CYS H2 H N N 83 CYS HA H N N 84 CYS HB2 H N N 85 CYS HB3 H N N 86 CYS HG H N N 87 CYS HXT H N N 88 GLN N N N N 89 GLN CA C N S 90 GLN C C N N 91 GLN O O N N 92 GLN CB C N N 93 GLN CG C N N 94 GLN CD C N N 95 GLN OE1 O N N 96 GLN NE2 N N N 97 GLN OXT O N N 98 GLN H H N N 99 GLN H2 H N N 100 GLN HA H N N 101 GLN HB2 H N N 102 GLN HB3 H N N 103 GLN HG2 H N N 104 GLN HG3 H N N 105 GLN HE21 H N N 106 GLN HE22 H N N 107 GLN HXT H N N 108 GLU N N N N 109 GLU CA C N S 110 GLU C C N N 111 GLU O O N N 112 GLU CB C N N 113 GLU CG C N N 114 GLU CD C N N 115 GLU OE1 O N N 116 GLU OE2 O N N 117 GLU OXT O N N 118 GLU H H N N 119 GLU H2 H N N 120 GLU HA H N N 121 GLU HB2 H N N 122 GLU HB3 H N N 123 GLU HG2 H N N 124 GLU HG3 H N N 125 GLU HE2 H N N 126 GLU HXT H N N 127 GLY N N N N 128 GLY CA C N N 129 GLY C C N N 130 GLY O O N N 131 GLY OXT O N N 132 GLY H H N N 133 GLY H2 H N N 134 GLY HA2 H N N 135 GLY HA3 H N N 136 GLY HXT H N N 137 HEC FE FE N N 138 HEC CHA C N N 139 HEC CHB C N N 140 HEC CHC C N N 141 HEC CHD C N N 142 HEC NA N Y N 143 HEC C1A C Y N 144 HEC C2A C Y N 145 HEC C3A C Y N 146 HEC C4A C Y N 147 HEC CMA C N N 148 HEC CAA C N N 149 HEC CBA C N N 150 HEC CGA C N N 151 HEC O1A O N N 152 HEC O2A O N N 153 HEC NB N Y N 154 HEC C1B C Y N 155 HEC C2B C Y N 156 HEC C3B C Y N 157 HEC C4B C Y N 158 HEC CMB C N N 159 HEC CAB C N N 160 HEC CBB C N N 161 HEC NC N Y N 162 HEC C1C C Y N 163 HEC C2C C Y N 164 HEC C3C C Y N 165 HEC C4C C Y N 166 HEC CMC C N N 167 HEC CAC C N N 168 HEC CBC C N N 169 HEC ND N Y N 170 HEC C1D C Y N 171 HEC C2D C Y N 172 HEC C3D C Y N 173 HEC C4D C Y N 174 HEC CMD C N N 175 HEC CAD C N N 176 HEC CBD C N N 177 HEC CGD C N N 178 HEC O1D O N N 179 HEC O2D O N N 180 HEC HHA H N N 181 HEC HHB H N N 182 HEC HHC H N N 183 HEC HHD H N N 184 HEC HMA1 H N N 185 HEC HMA2 H N N 186 HEC HMA3 H N N 187 HEC HAA1 H N N 188 HEC HAA2 H N N 189 HEC HBA1 H N N 190 HEC HBA2 H N N 191 HEC H2A H N N 192 HEC HMB1 H N N 193 HEC HMB2 H N N 194 HEC HMB3 H N N 195 HEC HAB H N N 196 HEC HBB1 H N N 197 HEC HBB2 H N N 198 HEC HBB3 H N N 199 HEC HMC1 H N N 200 HEC HMC2 H N N 201 HEC HMC3 H N N 202 HEC HAC H N N 203 HEC HBC1 H N N 204 HEC HBC2 H N N 205 HEC HBC3 H N N 206 HEC HMD1 H N N 207 HEC HMD2 H N N 208 HEC HMD3 H N N 209 HEC HAD1 H N N 210 HEC HAD2 H N N 211 HEC HBD1 H N N 212 HEC HBD2 H N N 213 HEC H2D H N N 214 HIS N N N N 215 HIS CA C N S 216 HIS C C N N 217 HIS O O N N 218 HIS CB C N N 219 HIS CG C Y N 220 HIS ND1 N Y N 221 HIS CD2 C Y N 222 HIS CE1 C Y N 223 HIS NE2 N Y N 224 HIS OXT O N N 225 HIS H H N N 226 HIS H2 H N N 227 HIS HA H N N 228 HIS HB2 H N N 229 HIS HB3 H N N 230 HIS HD1 H N N 231 HIS HD2 H N N 232 HIS HE1 H N N 233 HIS HE2 H N N 234 HIS HXT H N N 235 HOH O O N N 236 HOH H1 H N N 237 HOH H2 H N N 238 ILE N N N N 239 ILE CA C N S 240 ILE C C N N 241 ILE O O N N 242 ILE CB C N S 243 ILE CG1 C N N 244 ILE CG2 C N N 245 ILE CD1 C N N 246 ILE OXT O N N 247 ILE H H N N 248 ILE H2 H N N 249 ILE HA H N N 250 ILE HB H N N 251 ILE HG12 H N N 252 ILE HG13 H N N 253 ILE HG21 H N N 254 ILE HG22 H N N 255 ILE HG23 H N N 256 ILE HD11 H N N 257 ILE HD12 H N N 258 ILE HD13 H N N 259 ILE HXT H N N 260 LEU N N N N 261 LEU CA C N S 262 LEU C C N N 263 LEU O O N N 264 LEU CB C N N 265 LEU CG C N N 266 LEU CD1 C N N 267 LEU CD2 C N N 268 LEU OXT O N N 269 LEU H H N N 270 LEU H2 H N N 271 LEU HA H N N 272 LEU HB2 H N N 273 LEU HB3 H N N 274 LEU HG H N N 275 LEU HD11 H N N 276 LEU HD12 H N N 277 LEU HD13 H N N 278 LEU HD21 H N N 279 LEU HD22 H N N 280 LEU HD23 H N N 281 LEU HXT H N N 282 LYS N N N N 283 LYS CA C N S 284 LYS C C N N 285 LYS O O N N 286 LYS CB C N N 287 LYS CG C N N 288 LYS CD C N N 289 LYS CE C N N 290 LYS NZ N N N 291 LYS OXT O N N 292 LYS H H N N 293 LYS H2 H N N 294 LYS HA H N N 295 LYS HB2 H N N 296 LYS HB3 H N N 297 LYS HG2 H N N 298 LYS HG3 H N N 299 LYS HD2 H N N 300 LYS HD3 H N N 301 LYS HE2 H N N 302 LYS HE3 H N N 303 LYS HZ1 H N N 304 LYS HZ2 H N N 305 LYS HZ3 H N N 306 LYS HXT H N N 307 MET N N N N 308 MET CA C N S 309 MET C C N N 310 MET O O N N 311 MET CB C N N 312 MET CG C N N 313 MET SD S N N 314 MET CE C N N 315 MET OXT O N N 316 MET H H N N 317 MET H2 H N N 318 MET HA H N N 319 MET HB2 H N N 320 MET HB3 H N N 321 MET HG2 H N N 322 MET HG3 H N N 323 MET HE1 H N N 324 MET HE2 H N N 325 MET HE3 H N N 326 MET HXT H N N 327 PHE N N N N 328 PHE CA C N S 329 PHE C C N N 330 PHE O O N N 331 PHE CB C N N 332 PHE CG C Y N 333 PHE CD1 C Y N 334 PHE CD2 C Y N 335 PHE CE1 C Y N 336 PHE CE2 C Y N 337 PHE CZ C Y N 338 PHE OXT O N N 339 PHE H H N N 340 PHE H2 H N N 341 PHE HA H N N 342 PHE HB2 H N N 343 PHE HB3 H N N 344 PHE HD1 H N N 345 PHE HD2 H N N 346 PHE HE1 H N N 347 PHE HE2 H N N 348 PHE HZ H N N 349 PHE HXT H N N 350 PRO N N N N 351 PRO CA C N S 352 PRO C C N N 353 PRO O O N N 354 PRO CB C N N 355 PRO CG C N N 356 PRO CD C N N 357 PRO OXT O N N 358 PRO H H N N 359 PRO HA H N N 360 PRO HB2 H N N 361 PRO HB3 H N N 362 PRO HG2 H N N 363 PRO HG3 H N N 364 PRO HD2 H N N 365 PRO HD3 H N N 366 PRO HXT H N N 367 SER N N N N 368 SER CA C N S 369 SER C C N N 370 SER O O N N 371 SER CB C N N 372 SER OG O N N 373 SER OXT O N N 374 SER H H N N 375 SER H2 H N N 376 SER HA H N N 377 SER HB2 H N N 378 SER HB3 H N N 379 SER HG H N N 380 SER HXT H N N 381 THR N N N N 382 THR CA C N S 383 THR C C N N 384 THR O O N N 385 THR CB C N R 386 THR OG1 O N N 387 THR CG2 C N N 388 THR OXT O N N 389 THR H H N N 390 THR H2 H N N 391 THR HA H N N 392 THR HB H N N 393 THR HG1 H N N 394 THR HG21 H N N 395 THR HG22 H N N 396 THR HG23 H N N 397 THR HXT H N N 398 TYR N N N N 399 TYR CA C N S 400 TYR C C N N 401 TYR O O N N 402 TYR CB C N N 403 TYR CG C Y N 404 TYR CD1 C Y N 405 TYR CD2 C Y N 406 TYR CE1 C Y N 407 TYR CE2 C Y N 408 TYR CZ C Y N 409 TYR OH O N N 410 TYR OXT O N N 411 TYR H H N N 412 TYR H2 H N N 413 TYR HA H N N 414 TYR HB2 H N N 415 TYR HB3 H N N 416 TYR HD1 H N N 417 TYR HD2 H N N 418 TYR HE1 H N N 419 TYR HE2 H N N 420 TYR HH H N N 421 TYR HXT H N N 422 VAL N N N N 423 VAL CA C N S 424 VAL C C N N 425 VAL O O N N 426 VAL CB C N N 427 VAL CG1 C N N 428 VAL CG2 C N N 429 VAL OXT O N N 430 VAL H H N N 431 VAL H2 H N N 432 VAL HA H N N 433 VAL HB H N N 434 VAL HG11 H N N 435 VAL HG12 H N N 436 VAL HG13 H N N 437 VAL HG21 H N N 438 VAL HG22 H N N 439 VAL HG23 H N N 440 VAL HXT H N N 441 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HEC FE NA sing N N 129 HEC FE NB sing N N 130 HEC FE NC sing N N 131 HEC FE ND sing N N 132 HEC CHA C1A doub N N 133 HEC CHA C4D sing N N 134 HEC CHA HHA sing N N 135 HEC CHB C4A doub N N 136 HEC CHB C1B sing N N 137 HEC CHB HHB sing N N 138 HEC CHC C4B doub N N 139 HEC CHC C1C sing N N 140 HEC CHC HHC sing N N 141 HEC CHD C4C doub N N 142 HEC CHD C1D sing N N 143 HEC CHD HHD sing N N 144 HEC NA C1A sing Y N 145 HEC NA C4A sing Y N 146 HEC C1A C2A sing Y N 147 HEC C2A C3A doub Y N 148 HEC C2A CAA sing N N 149 HEC C3A C4A sing Y N 150 HEC C3A CMA sing N N 151 HEC CMA HMA1 sing N N 152 HEC CMA HMA2 sing N N 153 HEC CMA HMA3 sing N N 154 HEC CAA CBA sing N N 155 HEC CAA HAA1 sing N N 156 HEC CAA HAA2 sing N N 157 HEC CBA CGA sing N N 158 HEC CBA HBA1 sing N N 159 HEC CBA HBA2 sing N N 160 HEC CGA O1A doub N N 161 HEC CGA O2A sing N N 162 HEC O2A H2A sing N N 163 HEC NB C1B sing Y N 164 HEC NB C4B sing Y N 165 HEC C1B C2B doub Y N 166 HEC C2B C3B sing Y N 167 HEC C2B CMB sing N N 168 HEC C3B C4B sing Y N 169 HEC C3B CAB doub N E 170 HEC CMB HMB1 sing N N 171 HEC CMB HMB2 sing N N 172 HEC CMB HMB3 sing N N 173 HEC CAB CBB sing N N 174 HEC CAB HAB sing N N 175 HEC CBB HBB1 sing N N 176 HEC CBB HBB2 sing N N 177 HEC CBB HBB3 sing N N 178 HEC NC C1C sing Y N 179 HEC NC C4C sing Y N 180 HEC C1C C2C doub Y N 181 HEC C2C C3C sing Y N 182 HEC C2C CMC sing N N 183 HEC C3C C4C sing Y N 184 HEC C3C CAC doub N E 185 HEC CMC HMC1 sing N N 186 HEC CMC HMC2 sing N N 187 HEC CMC HMC3 sing N N 188 HEC CAC CBC sing N N 189 HEC CAC HAC sing N N 190 HEC CBC HBC1 sing N N 191 HEC CBC HBC2 sing N N 192 HEC CBC HBC3 sing N N 193 HEC ND C1D sing Y N 194 HEC ND C4D sing Y N 195 HEC C1D C2D doub Y N 196 HEC C2D C3D sing Y N 197 HEC C2D CMD sing N N 198 HEC C3D C4D doub Y N 199 HEC C3D CAD sing N N 200 HEC CMD HMD1 sing N N 201 HEC CMD HMD2 sing N N 202 HEC CMD HMD3 sing N N 203 HEC CAD CBD sing N N 204 HEC CAD HAD1 sing N N 205 HEC CAD HAD2 sing N N 206 HEC CBD CGD sing N N 207 HEC CBD HBD1 sing N N 208 HEC CBD HBD2 sing N N 209 HEC CGD O1D doub N N 210 HEC CGD O2D sing N N 211 HEC O2D H2D sing N N 212 HIS N CA sing N N 213 HIS N H sing N N 214 HIS N H2 sing N N 215 HIS CA C sing N N 216 HIS CA CB sing N N 217 HIS CA HA sing N N 218 HIS C O doub N N 219 HIS C OXT sing N N 220 HIS CB CG sing N N 221 HIS CB HB2 sing N N 222 HIS CB HB3 sing N N 223 HIS CG ND1 sing Y N 224 HIS CG CD2 doub Y N 225 HIS ND1 CE1 doub Y N 226 HIS ND1 HD1 sing N N 227 HIS CD2 NE2 sing Y N 228 HIS CD2 HD2 sing N N 229 HIS CE1 NE2 sing Y N 230 HIS CE1 HE1 sing N N 231 HIS NE2 HE2 sing N N 232 HIS OXT HXT sing N N 233 HOH O H1 sing N N 234 HOH O H2 sing N N 235 ILE N CA sing N N 236 ILE N H sing N N 237 ILE N H2 sing N N 238 ILE CA C sing N N 239 ILE CA CB sing N N 240 ILE CA HA sing N N 241 ILE C O doub N N 242 ILE C OXT sing N N 243 ILE CB CG1 sing N N 244 ILE CB CG2 sing N N 245 ILE CB HB sing N N 246 ILE CG1 CD1 sing N N 247 ILE CG1 HG12 sing N N 248 ILE CG1 HG13 sing N N 249 ILE CG2 HG21 sing N N 250 ILE CG2 HG22 sing N N 251 ILE CG2 HG23 sing N N 252 ILE CD1 HD11 sing N N 253 ILE CD1 HD12 sing N N 254 ILE CD1 HD13 sing N N 255 ILE OXT HXT sing N N 256 LEU N CA sing N N 257 LEU N H sing N N 258 LEU N H2 sing N N 259 LEU CA C sing N N 260 LEU CA CB sing N N 261 LEU CA HA sing N N 262 LEU C O doub N N 263 LEU C OXT sing N N 264 LEU CB CG sing N N 265 LEU CB HB2 sing N N 266 LEU CB HB3 sing N N 267 LEU CG CD1 sing N N 268 LEU CG CD2 sing N N 269 LEU CG HG sing N N 270 LEU CD1 HD11 sing N N 271 LEU CD1 HD12 sing N N 272 LEU CD1 HD13 sing N N 273 LEU CD2 HD21 sing N N 274 LEU CD2 HD22 sing N N 275 LEU CD2 HD23 sing N N 276 LEU OXT HXT sing N N 277 LYS N CA sing N N 278 LYS N H sing N N 279 LYS N H2 sing N N 280 LYS CA C sing N N 281 LYS CA CB sing N N 282 LYS CA HA sing N N 283 LYS C O doub N N 284 LYS C OXT sing N N 285 LYS CB CG sing N N 286 LYS CB HB2 sing N N 287 LYS CB HB3 sing N N 288 LYS CG CD sing N N 289 LYS CG HG2 sing N N 290 LYS CG HG3 sing N N 291 LYS CD CE sing N N 292 LYS CD HD2 sing N N 293 LYS CD HD3 sing N N 294 LYS CE NZ sing N N 295 LYS CE HE2 sing N N 296 LYS CE HE3 sing N N 297 LYS NZ HZ1 sing N N 298 LYS NZ HZ2 sing N N 299 LYS NZ HZ3 sing N N 300 LYS OXT HXT sing N N 301 MET N CA sing N N 302 MET N H sing N N 303 MET N H2 sing N N 304 MET CA C sing N N 305 MET CA CB sing N N 306 MET CA HA sing N N 307 MET C O doub N N 308 MET C OXT sing N N 309 MET CB CG sing N N 310 MET CB HB2 sing N N 311 MET CB HB3 sing N N 312 MET CG SD sing N N 313 MET CG HG2 sing N N 314 MET CG HG3 sing N N 315 MET SD CE sing N N 316 MET CE HE1 sing N N 317 MET CE HE2 sing N N 318 MET CE HE3 sing N N 319 MET OXT HXT sing N N 320 PHE N CA sing N N 321 PHE N H sing N N 322 PHE N H2 sing N N 323 PHE CA C sing N N 324 PHE CA CB sing N N 325 PHE CA HA sing N N 326 PHE C O doub N N 327 PHE C OXT sing N N 328 PHE CB CG sing N N 329 PHE CB HB2 sing N N 330 PHE CB HB3 sing N N 331 PHE CG CD1 doub Y N 332 PHE CG CD2 sing Y N 333 PHE CD1 CE1 sing Y N 334 PHE CD1 HD1 sing N N 335 PHE CD2 CE2 doub Y N 336 PHE CD2 HD2 sing N N 337 PHE CE1 CZ doub Y N 338 PHE CE1 HE1 sing N N 339 PHE CE2 CZ sing Y N 340 PHE CE2 HE2 sing N N 341 PHE CZ HZ sing N N 342 PHE OXT HXT sing N N 343 PRO N CA sing N N 344 PRO N CD sing N N 345 PRO N H sing N N 346 PRO CA C sing N N 347 PRO CA CB sing N N 348 PRO CA HA sing N N 349 PRO C O doub N N 350 PRO C OXT sing N N 351 PRO CB CG sing N N 352 PRO CB HB2 sing N N 353 PRO CB HB3 sing N N 354 PRO CG CD sing N N 355 PRO CG HG2 sing N N 356 PRO CG HG3 sing N N 357 PRO CD HD2 sing N N 358 PRO CD HD3 sing N N 359 PRO OXT HXT sing N N 360 SER N CA sing N N 361 SER N H sing N N 362 SER N H2 sing N N 363 SER CA C sing N N 364 SER CA CB sing N N 365 SER CA HA sing N N 366 SER C O doub N N 367 SER C OXT sing N N 368 SER CB OG sing N N 369 SER CB HB2 sing N N 370 SER CB HB3 sing N N 371 SER OG HG sing N N 372 SER OXT HXT sing N N 373 THR N CA sing N N 374 THR N H sing N N 375 THR N H2 sing N N 376 THR CA C sing N N 377 THR CA CB sing N N 378 THR CA HA sing N N 379 THR C O doub N N 380 THR C OXT sing N N 381 THR CB OG1 sing N N 382 THR CB CG2 sing N N 383 THR CB HB sing N N 384 THR OG1 HG1 sing N N 385 THR CG2 HG21 sing N N 386 THR CG2 HG22 sing N N 387 THR CG2 HG23 sing N N 388 THR OXT HXT sing N N 389 TYR N CA sing N N 390 TYR N H sing N N 391 TYR N H2 sing N N 392 TYR CA C sing N N 393 TYR CA CB sing N N 394 TYR CA HA sing N N 395 TYR C O doub N N 396 TYR C OXT sing N N 397 TYR CB CG sing N N 398 TYR CB HB2 sing N N 399 TYR CB HB3 sing N N 400 TYR CG CD1 doub Y N 401 TYR CG CD2 sing Y N 402 TYR CD1 CE1 sing Y N 403 TYR CD1 HD1 sing N N 404 TYR CD2 CE2 doub Y N 405 TYR CD2 HD2 sing N N 406 TYR CE1 CZ doub Y N 407 TYR CE1 HE1 sing N N 408 TYR CE2 CZ sing Y N 409 TYR CE2 HE2 sing N N 410 TYR CZ OH sing N N 411 TYR OH HH sing N N 412 TYR OXT HXT sing N N 413 VAL N CA sing N N 414 VAL N H sing N N 415 VAL N H2 sing N N 416 VAL CA C sing N N 417 VAL CA CB sing N N 418 VAL CA HA sing N N 419 VAL C O doub N N 420 VAL C OXT sing N N 421 VAL CB CG1 sing N N 422 VAL CB CG2 sing N N 423 VAL CB HB sing N N 424 VAL CG1 HG11 sing N N 425 VAL CG1 HG12 sing N N 426 VAL CG1 HG13 sing N N 427 VAL CG2 HG21 sing N N 428 VAL CG2 HG22 sing N N 429 VAL CG2 HG23 sing N N 430 VAL OXT HXT sing N N 431 # _pdbx_audit_support.funding_organization 'Biotechnology and Biological Sciences Research Council (BBSRC)' _pdbx_audit_support.country 'United Kingdom' _pdbx_audit_support.grant_number BB/N019970/1 _pdbx_audit_support.ordinal 1 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id HEC _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id HEC _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # _atom_sites.entry_id 8Q1V _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 0.010791 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.010791 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.010791 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.pdbx_scat_Z _atom_type.pdbx_N_electrons _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c C 6 6 2.3103 20.8439 1.0201 10.2075 1.5888 0.5687 0.8651 51.6512 0.2156 CL 17 17 11.4601 0.0104 7.1962 1.1662 6.2554 18.5194 1.6455 47.7784 -9.3485 FE 26 26 11.7738 4.7611 7.3600 0.3072 3.5235 15.3535 2.3054 76.8805 1.2872 H 1 1 0.4930 10.5109 0.3229 26.1257 0.1402 3.1424 0.0408 57.7997 0.0030 N 7 7 12.2220 0.0057 3.1346 9.8933 2.0141 28.9975 1.1672 0.5826 -11.5379 O 8 8 3.0487 13.2771 2.2870 5.7011 1.5464 0.3239 0.8671 32.9089 0.2508 S 16 16 6.9054 1.4679 5.2035 22.2151 1.4379 0.2536 1.5863 56.1720 1.0457 # loop_