data_8QAJ # _entry.id 8QAJ # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.406 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 8QAJ pdb_00008qaj 10.2210/pdb8qaj/pdb WWPDB D_1292132920 ? ? BMRB 34847 ? 10.13018/BMR34847 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date _pdbx_audit_revision_history.part_number 1 'Structure model' 1 0 2024-09-11 ? 2 'Structure model' 1 1 2024-11-13 ? 3 'Structure model' 1 2 2025-09-24 ? # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Structure summary' 2 3 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' pdbx_entry_details 2 2 'Structure model' pdbx_modification_feature 3 3 'Structure model' citation 4 3 'Structure model' citation_author # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_citation.country' 2 3 'Structure model' '_citation.journal_abbrev' 3 3 'Structure model' '_citation.journal_id_CSD' 4 3 'Structure model' '_citation.journal_id_ISSN' 5 3 'Structure model' '_citation.pdbx_database_id_DOI' 6 3 'Structure model' '_citation.title' 7 3 'Structure model' '_citation.year' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr . _pdbx_database_status.entry_id 8QAJ _pdbx_database_status.recvd_initial_deposition_date 2023-08-22 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs . _pdbx_database_status.status_code_nmr_data REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_database_related.db_name BMRB _pdbx_database_related.details 'NMR solution structure of C-terminal domain of CDNF' _pdbx_database_related.db_id 34847 _pdbx_database_related.content_type unspecified # _pdbx_contact_author.id 2 _pdbx_contact_author.email perttu.permi@jyu.fi _pdbx_contact_author.name_first Perttu _pdbx_contact_author.name_last Permi _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-6281-1138 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Tossavainen, H.' 1 ? 'Permi, P.' 2 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Biorxiv _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2692-8205 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title ;Non-invasive peripheral delivery of CDNF fragment protects neurons in models of Parkinson's and ALS ; _citation.year 2025 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1101/2025.02.09.637291 _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Yu, L.Y.' 1 ? primary 'Viljakainen, T.' 2 ? primary 'Beckett, L.' 3 ? primary 'Nam, J.' 4 ? primary 'Hyysalo, A.' 5 ? primary 'Luningschror, P.' 6 ? primary 'Albert, K.' 7 ? primary 'Koppinen, T.' 8 ? primary 'Hyvarinen, T.' 9 ? primary 'Tossavainen, H.' 10 ? primary 'Hellman, M.' 11 ? primary 'Airavaara, M.' 12 ? primary 'Sendtner, M.' 13 ? primary 'Permi, P.' 14 ? primary 'Lindholm, P.' 15 ? primary 'Saarma, M.' 16 ? primary 'Voutilainen, M.H.' 17 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Cerebral dopamine neurotrophic factor' _entity.formula_weight 7472.620 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details 'GSHM expression artefact' # _entity_name_com.entity_id 1 _entity_name_com.name 'ARMET-like protein 1,Conserved dopamine neurotrophic factor' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GSHMKYEKTLDLASVDLRKMRVAELKQILHSWGEECRACAEKTDYVNLIQELAPKYAATHPKTEL _entity_poly.pdbx_seq_one_letter_code_can GSHMKYEKTLDLASVDLRKMRVAELKQILHSWGEECRACAEKTDYVNLIQELAPKYAATHPKTEL _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 HIS n 1 4 MET n 1 5 LYS n 1 6 TYR n 1 7 GLU n 1 8 LYS n 1 9 THR n 1 10 LEU n 1 11 ASP n 1 12 LEU n 1 13 ALA n 1 14 SER n 1 15 VAL n 1 16 ASP n 1 17 LEU n 1 18 ARG n 1 19 LYS n 1 20 MET n 1 21 ARG n 1 22 VAL n 1 23 ALA n 1 24 GLU n 1 25 LEU n 1 26 LYS n 1 27 GLN n 1 28 ILE n 1 29 LEU n 1 30 HIS n 1 31 SER n 1 32 TRP n 1 33 GLY n 1 34 GLU n 1 35 GLU n 1 36 CYS n 1 37 ARG n 1 38 ALA n 1 39 CYS n 1 40 ALA n 1 41 GLU n 1 42 LYS n 1 43 THR n 1 44 ASP n 1 45 TYR n 1 46 VAL n 1 47 ASN n 1 48 LEU n 1 49 ILE n 1 50 GLN n 1 51 GLU n 1 52 LEU n 1 53 ALA n 1 54 PRO n 1 55 LYS n 1 56 TYR n 1 57 ALA n 1 58 ALA n 1 59 THR n 1 60 HIS n 1 61 PRO n 1 62 LYS n 1 63 THR n 1 64 GLU n 1 65 LEU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 65 _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'CDNF, ARMETL1' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 97 123 GLY GLY A . n A 1 2 SER 2 98 124 SER SER A . n A 1 3 HIS 3 99 125 HIS HIS A . n A 1 4 MET 4 100 126 MET MET A . n A 1 5 LYS 5 101 127 LYS LYS A . n A 1 6 TYR 6 102 128 TYR TYR A . n A 1 7 GLU 7 103 129 GLU GLU A . n A 1 8 LYS 8 104 130 LYS LYS A . n A 1 9 THR 9 105 131 THR THR A . n A 1 10 LEU 10 106 132 LEU LEU A . n A 1 11 ASP 11 107 133 ASP ASP A . n A 1 12 LEU 12 108 134 LEU LEU A . n A 1 13 ALA 13 109 135 ALA ALA A . n A 1 14 SER 14 110 136 SER SER A . n A 1 15 VAL 15 111 137 VAL VAL A . n A 1 16 ASP 16 112 138 ASP ASP A . n A 1 17 LEU 17 113 139 LEU LEU A . n A 1 18 ARG 18 114 140 ARG ARG A . n A 1 19 LYS 19 115 141 LYS LYS A . n A 1 20 MET 20 116 142 MET MET A . n A 1 21 ARG 21 117 143 ARG ARG A . n A 1 22 VAL 22 118 144 VAL VAL A . n A 1 23 ALA 23 119 145 ALA ALA A . n A 1 24 GLU 24 120 146 GLU GLU A . n A 1 25 LEU 25 121 147 LEU LEU A . n A 1 26 LYS 26 122 148 LYS LYS A . n A 1 27 GLN 27 123 149 GLN GLN A . n A 1 28 ILE 28 124 150 ILE ILE A . n A 1 29 LEU 29 125 151 LEU LEU A . n A 1 30 HIS 30 126 152 HIS HIS A . n A 1 31 SER 31 127 153 SER SER A . n A 1 32 TRP 32 128 154 TRP TRP A . n A 1 33 GLY 33 129 155 GLY GLY A . n A 1 34 GLU 34 130 156 GLU GLU A . n A 1 35 GLU 35 131 157 GLU GLU A . n A 1 36 CYS 36 132 158 CYS CYS A . n A 1 37 ARG 37 133 159 ARG ARG A . n A 1 38 ALA 38 134 160 ALA ALA A . n A 1 39 CYS 39 135 161 CYS CYS A . n A 1 40 ALA 40 136 162 ALA ALA A . n A 1 41 GLU 41 137 163 GLU GLU A . n A 1 42 LYS 42 138 164 LYS LYS A . n A 1 43 THR 43 139 165 THR THR A . n A 1 44 ASP 44 140 166 ASP ASP A . n A 1 45 TYR 45 141 167 TYR TYR A . n A 1 46 VAL 46 142 168 VAL VAL A . n A 1 47 ASN 47 143 169 ASN ASN A . n A 1 48 LEU 48 144 170 LEU LEU A . n A 1 49 ILE 49 145 171 ILE ILE A . n A 1 50 GLN 50 146 172 GLN GLN A . n A 1 51 GLU 51 147 173 GLU GLU A . n A 1 52 LEU 52 148 174 LEU LEU A . n A 1 53 ALA 53 149 175 ALA ALA A . n A 1 54 PRO 54 150 176 PRO PRO A . n A 1 55 LYS 55 151 177 LYS LYS A . n A 1 56 TYR 56 152 178 TYR TYR A . n A 1 57 ALA 57 153 179 ALA ALA A . n A 1 58 ALA 58 154 180 ALA ALA A . n A 1 59 THR 59 155 181 THR THR A . n A 1 60 HIS 60 156 182 HIS HIS A . n A 1 61 PRO 61 157 183 PRO PRO A . n A 1 62 LYS 62 158 184 LYS LYS A . n A 1 63 THR 63 159 185 THR THR A . n A 1 64 GLU 64 160 186 GLU GLU A . n A 1 65 LEU 65 161 187 LEU LEU A . n # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 8QAJ _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 8QAJ _struct.title 'NMR solution structure of C-terminal domain of CDNF' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 8QAJ _struct_keywords.text 'neurotrophic factor, SIGNALING PROTEIN' _struct_keywords.pdbx_keywords 'SIGNALING PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code CDNF_HUMAN _struct_ref.pdbx_db_accession Q49AH0 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code KYEKTLDLASVDLRKMRVAELKQILHSWGEECRACAEKTDYVNLIQELAPKYAATHPKTEL _struct_ref.pdbx_align_begin 127 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 8QAJ _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 5 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 65 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q49AH0 _struct_ref_seq.db_align_beg 127 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 187 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 101 _struct_ref_seq.pdbx_auth_seq_align_end 161 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 8QAJ GLY A 1 ? UNP Q49AH0 ? ? 'expression tag' 97 1 1 8QAJ SER A 2 ? UNP Q49AH0 ? ? 'expression tag' 98 2 1 8QAJ HIS A 3 ? UNP Q49AH0 ? ? 'expression tag' 99 3 1 8QAJ MET A 4 ? UNP Q49AH0 ? ? 'expression tag' 100 4 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'NMR Distance Restraints' _pdbx_struct_assembly_auth_evidence.details 'not applicable' # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0 _pdbx_struct_oper_list.matrix[1][2] 0.0 _pdbx_struct_oper_list.matrix[1][3] 0.0 _pdbx_struct_oper_list.vector[1] 0.0 _pdbx_struct_oper_list.matrix[2][1] 0.0 _pdbx_struct_oper_list.matrix[2][2] 1.0 _pdbx_struct_oper_list.matrix[2][3] 0.0 _pdbx_struct_oper_list.vector[2] 0.0 _pdbx_struct_oper_list.matrix[3][1] 0.0 _pdbx_struct_oper_list.matrix[3][2] 0.0 _pdbx_struct_oper_list.matrix[3][3] 1.0 _pdbx_struct_oper_list.vector[3] 0.0 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASP A 11 ? VAL A 15 ? ASP A 107 VAL A 111 5 ? 5 HELX_P HELX_P2 AA2 ARG A 21 ? TRP A 32 ? ARG A 117 TRP A 128 1 ? 12 HELX_P HELX_P3 AA3 GLU A 41 ? ALA A 57 ? GLU A 137 ALA A 153 1 ? 17 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id disulf1 _struct_conn.conn_type_id disulf _struct_conn.pdbx_leaving_atom_flag ? _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id CYS _struct_conn.ptnr1_label_seq_id 36 _struct_conn.ptnr1_label_atom_id SG _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id A _struct_conn.ptnr2_label_comp_id CYS _struct_conn.ptnr2_label_seq_id 39 _struct_conn.ptnr2_label_atom_id SG _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id CYS _struct_conn.ptnr1_auth_seq_id 132 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id CYS _struct_conn.ptnr2_auth_seq_id 135 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 2.037 _struct_conn.pdbx_value_order ? _struct_conn.pdbx_role ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # _pdbx_modification_feature.ordinal 1 _pdbx_modification_feature.label_comp_id CYS _pdbx_modification_feature.label_asym_id A _pdbx_modification_feature.label_seq_id 36 _pdbx_modification_feature.label_alt_id ? _pdbx_modification_feature.modified_residue_label_comp_id CYS _pdbx_modification_feature.modified_residue_label_asym_id A _pdbx_modification_feature.modified_residue_label_seq_id 39 _pdbx_modification_feature.modified_residue_label_alt_id ? _pdbx_modification_feature.auth_comp_id CYS _pdbx_modification_feature.auth_asym_id A _pdbx_modification_feature.auth_seq_id 132 _pdbx_modification_feature.PDB_ins_code ? _pdbx_modification_feature.symmetry 1_555 _pdbx_modification_feature.modified_residue_auth_comp_id CYS _pdbx_modification_feature.modified_residue_auth_asym_id A _pdbx_modification_feature.modified_residue_auth_seq_id 135 _pdbx_modification_feature.modified_residue_PDB_ins_code ? _pdbx_modification_feature.modified_residue_symmetry 1_555 _pdbx_modification_feature.comp_id_linking_atom SG _pdbx_modification_feature.modified_residue_id_linking_atom SG _pdbx_modification_feature.modified_residue_id . _pdbx_modification_feature.ref_pcm_id . _pdbx_modification_feature.ref_comp_id . _pdbx_modification_feature.type None _pdbx_modification_feature.category 'Disulfide bridge' # _pdbx_entry_details.entry_id 8QAJ _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 15 OE1 A GLU 130 ? ? HH A TYR 152 ? ? 1.60 2 20 OD2 A ASP 107 ? ? HG A SER 110 ? ? 1.60 # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 NE A ARG 117 ? ? CZ A ARG 117 ? ? NH1 A ARG 117 ? ? 124.07 120.30 3.77 0.50 N 2 2 NE A ARG 114 ? ? CZ A ARG 114 ? ? NH1 A ARG 114 ? ? 124.34 120.30 4.04 0.50 N 3 2 NE A ARG 117 ? ? CZ A ARG 117 ? ? NH1 A ARG 117 ? ? 125.03 120.30 4.73 0.50 N 4 2 NE A ARG 133 ? ? CZ A ARG 133 ? ? NH1 A ARG 133 ? ? 123.46 120.30 3.16 0.50 N 5 3 NE A ARG 114 ? ? CZ A ARG 114 ? ? NH1 A ARG 114 ? ? 123.59 120.30 3.29 0.50 N 6 3 NE A ARG 117 ? ? CZ A ARG 117 ? ? NH1 A ARG 117 ? ? 123.58 120.30 3.28 0.50 N 7 4 NE A ARG 114 ? ? CZ A ARG 114 ? ? NH1 A ARG 114 ? ? 124.00 120.30 3.70 0.50 N 8 4 NE A ARG 133 ? ? CZ A ARG 133 ? ? NH1 A ARG 133 ? ? 124.56 120.30 4.26 0.50 N 9 5 NE A ARG 114 ? ? CZ A ARG 114 ? ? NH1 A ARG 114 ? ? 123.72 120.30 3.42 0.50 N 10 5 NE A ARG 117 ? ? CZ A ARG 117 ? ? NH1 A ARG 117 ? ? 123.53 120.30 3.23 0.50 N 11 6 NE A ARG 114 ? ? CZ A ARG 114 ? ? NH1 A ARG 114 ? ? 123.59 120.30 3.29 0.50 N 12 6 NE A ARG 133 ? ? CZ A ARG 133 ? ? NH1 A ARG 133 ? ? 123.42 120.30 3.12 0.50 N 13 8 NE A ARG 114 ? ? CZ A ARG 114 ? ? NH1 A ARG 114 ? ? 124.00 120.30 3.70 0.50 N 14 8 NE A ARG 117 ? ? CZ A ARG 117 ? ? NH1 A ARG 117 ? ? 123.83 120.30 3.53 0.50 N 15 8 NE A ARG 133 ? ? CZ A ARG 133 ? ? NH1 A ARG 133 ? ? 123.60 120.30 3.30 0.50 N 16 9 NE A ARG 114 ? ? CZ A ARG 114 ? ? NH1 A ARG 114 ? ? 123.87 120.30 3.57 0.50 N 17 10 NE A ARG 114 ? ? CZ A ARG 114 ? ? NH1 A ARG 114 ? ? 123.62 120.30 3.32 0.50 N 18 10 NE A ARG 117 ? ? CZ A ARG 117 ? ? NH1 A ARG 117 ? ? 124.33 120.30 4.03 0.50 N 19 11 NE A ARG 114 ? ? CZ A ARG 114 ? ? NH1 A ARG 114 ? ? 123.38 120.30 3.08 0.50 N 20 12 NE A ARG 114 ? ? CZ A ARG 114 ? ? NH1 A ARG 114 ? ? 124.16 120.30 3.86 0.50 N 21 12 NE A ARG 117 ? ? CZ A ARG 117 ? ? NH1 A ARG 117 ? ? 123.49 120.30 3.19 0.50 N 22 13 NE A ARG 114 ? ? CZ A ARG 114 ? ? NH1 A ARG 114 ? ? 124.76 120.30 4.46 0.50 N 23 13 NE A ARG 117 ? ? CZ A ARG 117 ? ? NH1 A ARG 117 ? ? 123.78 120.30 3.48 0.50 N 24 13 NE A ARG 133 ? ? CZ A ARG 133 ? ? NH1 A ARG 133 ? ? 124.38 120.30 4.08 0.50 N 25 14 NE A ARG 114 ? ? CZ A ARG 114 ? ? NH1 A ARG 114 ? ? 123.61 120.30 3.31 0.50 N 26 14 NE A ARG 117 ? ? CZ A ARG 117 ? ? NH1 A ARG 117 ? ? 123.75 120.30 3.45 0.50 N 27 14 NE A ARG 133 ? ? CZ A ARG 133 ? ? NH1 A ARG 133 ? ? 124.31 120.30 4.01 0.50 N 28 15 NE A ARG 117 ? ? CZ A ARG 117 ? ? NH1 A ARG 117 ? ? 123.63 120.30 3.33 0.50 N 29 15 NE A ARG 133 ? ? CZ A ARG 133 ? ? NH1 A ARG 133 ? ? 123.50 120.30 3.20 0.50 N 30 16 NE A ARG 133 ? ? CZ A ARG 133 ? ? NH1 A ARG 133 ? ? 123.67 120.30 3.37 0.50 N 31 17 NE A ARG 114 ? ? CZ A ARG 114 ? ? NH1 A ARG 114 ? ? 123.78 120.30 3.48 0.50 N 32 17 NE A ARG 133 ? ? CZ A ARG 133 ? ? NH1 A ARG 133 ? ? 124.26 120.30 3.96 0.50 N 33 18 NE A ARG 114 ? ? CZ A ARG 114 ? ? NH1 A ARG 114 ? ? 124.17 120.30 3.87 0.50 N 34 18 NE A ARG 117 ? ? CZ A ARG 117 ? ? NH1 A ARG 117 ? ? 123.93 120.30 3.63 0.50 N 35 18 NE A ARG 133 ? ? CZ A ARG 133 ? ? NH1 A ARG 133 ? ? 123.80 120.30 3.50 0.50 N 36 19 NE A ARG 117 ? ? CZ A ARG 117 ? ? NH1 A ARG 117 ? ? 123.35 120.30 3.05 0.50 N 37 20 NE A ARG 114 ? ? CZ A ARG 114 ? ? NH1 A ARG 114 ? ? 123.89 120.30 3.59 0.50 N 38 20 NE A ARG 117 ? ? CZ A ARG 117 ? ? NH1 A ARG 117 ? ? 123.48 120.30 3.18 0.50 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 2 ASP A 107 ? ? -115.01 71.95 2 4 LYS A 101 ? ? -142.50 -33.19 3 5 GLU A 103 ? ? -77.51 39.76 4 5 LEU A 106 ? ? -141.78 -3.10 5 6 ARG A 133 ? ? -121.77 -61.51 6 6 THR A 159 ? ? 48.18 73.13 7 7 LEU A 106 ? ? 55.22 70.69 8 7 ASP A 107 ? ? -88.97 36.48 9 7 ARG A 133 ? ? -95.49 -63.69 10 7 CYS A 135 ? ? 56.32 18.15 11 8 CYS A 135 ? ? 59.79 5.01 12 9 MET A 100 ? ? -150.43 9.00 13 9 ARG A 133 ? ? -108.72 -78.57 14 9 ALA A 154 ? ? -76.79 43.23 15 10 ASP A 107 ? ? -103.69 73.82 16 10 LYS A 158 ? ? -133.89 -87.24 17 10 THR A 159 ? ? -152.66 -26.81 18 11 ASP A 107 ? ? -109.02 71.03 19 11 PRO A 157 ? ? -68.28 20.20 20 13 LYS A 104 ? ? -77.41 47.86 21 13 LYS A 158 ? ? 56.19 -14.87 22 13 GLU A 160 ? ? -151.52 51.85 23 14 TYR A 102 ? ? 56.43 74.11 24 14 THR A 105 ? ? -69.21 96.99 25 14 LEU A 106 ? ? -142.45 12.95 26 15 GLU A 103 ? ? -92.67 58.27 27 15 ALA A 136 ? ? -142.01 -37.06 28 15 LYS A 158 ? ? 61.65 -12.74 29 16 LYS A 101 ? ? -134.58 -65.23 30 16 LYS A 104 ? ? -136.63 -37.31 31 16 THR A 159 ? ? -140.67 -17.36 32 17 SER A 98 ? ? -154.92 2.22 33 17 HIS A 99 ? ? -68.99 40.50 34 17 LEU A 106 ? ? -68.82 1.88 35 17 ALA A 154 ? ? -79.98 38.65 36 18 ALA A 136 ? ? -148.80 -50.05 37 18 ALA A 154 ? ? -79.02 47.53 38 18 PRO A 157 ? ? -49.77 101.26 39 19 LYS A 101 ? ? -137.42 -38.05 40 19 ALA A 136 ? ? -146.17 -19.03 41 20 THR A 105 ? ? 52.58 80.98 42 20 ALA A 136 ? ? -146.07 -34.16 43 20 LYS A 158 ? ? -76.20 30.87 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 7 ARG A 133 ? ? 0.082 'SIDE CHAIN' 2 10 ARG A 117 ? ? 0.091 'SIDE CHAIN' 3 14 TYR A 102 ? ? 0.064 'SIDE CHAIN' # _pdbx_nmr_ensemble.entry_id 8QAJ _pdbx_nmr_ensemble.conformers_calculated_total_number 300 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the least restraint violations' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 8QAJ _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'fewest violations' # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '1 mM [U-13C; U-15N] C-CDNF, 20 mM sodium phosphate, 50 mM sodium chloride, 93% H2O/7% D2O' _pdbx_nmr_sample_details.solvent_system '93% H2O/7% D2O' _pdbx_nmr_sample_details.label sample1 _pdbx_nmr_sample_details.type solution _pdbx_nmr_sample_details.details ? # loop_ _pdbx_nmr_exptl_sample.solution_id _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling 1 C-CDNF 1 ? mM '[U-13C; U-15N]' 1 'sodium phosphate' 20 ? mM 'natural abundance' 1 'sodium chloride' 50 ? mM 'natural abundance' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 6.5 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0.15 _pdbx_nmr_exptl_sample_conditions.details ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_err ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units M _pdbx_nmr_exptl_sample_conditions.label conditions1 _pdbx_nmr_exptl_sample_conditions.pH_err ? _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 '2D 1H-15N HSQC' 3 isotropic 2 1 1 '2D 1H-13C HSQC aliphatic' 3 isotropic 3 1 1 '2D 1H-13C HSQC aromatic' 3 isotropic 4 1 1 '3D HN(COCA)CB' 1 isotropic 6 1 1 '3D HNCACB' 1 isotropic 7 1 1 '3D HNCA' 1 isotropic 8 1 1 '3D HN(CO)CA' 1 isotropic 9 1 1 '3D HNCO' 1 isotropic 10 1 1 '3D HCACO' 3 isotropic 11 1 1 '3D C(CO)NH' 1 isotropic 12 1 1 '3D H(CCO)NH' 1 isotropic 13 1 1 '2D (HB)CB(CGCD)HD' 1 isotropic 14 1 1 '2D (HB)CB(CGCDCE)HE' 1 isotropic 15 1 1 '3D HCCH-COSY' 3 isotropic 16 1 1 '3D HCCmHm-TOCSY' 3 isotropic 17 1 1 '3D 1H-13C NOESY' 3 isotropic 18 1 1 '3D 1H-15N NOESY' 3 isotropic # loop_ _pdbx_nmr_refine.entry_id _pdbx_nmr_refine.method _pdbx_nmr_refine.details _pdbx_nmr_refine.software_ordinal 8QAJ 'simulated annealing' ? 3 8QAJ 'molecular dynamics' ? 4 # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 collection TopSpin ? 'Bruker Biospin' 2 'data analysis' 'CcpNmr Analysis' ? CCPN 3 'structure calculation' CYANA ? 'Guntert, Mumenthaler and Wuthrich' 4 refinement Amber ? 'Case, Darden, Cheatham III, Simmerling, Wang, Duke, Luo, ... and Kollman' # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 ILE N N N N 158 ILE CA C N S 159 ILE C C N N 160 ILE O O N N 161 ILE CB C N S 162 ILE CG1 C N N 163 ILE CG2 C N N 164 ILE CD1 C N N 165 ILE OXT O N N 166 ILE H H N N 167 ILE H2 H N N 168 ILE HA H N N 169 ILE HB H N N 170 ILE HG12 H N N 171 ILE HG13 H N N 172 ILE HG21 H N N 173 ILE HG22 H N N 174 ILE HG23 H N N 175 ILE HD11 H N N 176 ILE HD12 H N N 177 ILE HD13 H N N 178 ILE HXT H N N 179 LEU N N N N 180 LEU CA C N S 181 LEU C C N N 182 LEU O O N N 183 LEU CB C N N 184 LEU CG C N N 185 LEU CD1 C N N 186 LEU CD2 C N N 187 LEU OXT O N N 188 LEU H H N N 189 LEU H2 H N N 190 LEU HA H N N 191 LEU HB2 H N N 192 LEU HB3 H N N 193 LEU HG H N N 194 LEU HD11 H N N 195 LEU HD12 H N N 196 LEU HD13 H N N 197 LEU HD21 H N N 198 LEU HD22 H N N 199 LEU HD23 H N N 200 LEU HXT H N N 201 LYS N N N N 202 LYS CA C N S 203 LYS C C N N 204 LYS O O N N 205 LYS CB C N N 206 LYS CG C N N 207 LYS CD C N N 208 LYS CE C N N 209 LYS NZ N N N 210 LYS OXT O N N 211 LYS H H N N 212 LYS H2 H N N 213 LYS HA H N N 214 LYS HB2 H N N 215 LYS HB3 H N N 216 LYS HG2 H N N 217 LYS HG3 H N N 218 LYS HD2 H N N 219 LYS HD3 H N N 220 LYS HE2 H N N 221 LYS HE3 H N N 222 LYS HZ1 H N N 223 LYS HZ2 H N N 224 LYS HZ3 H N N 225 LYS HXT H N N 226 MET N N N N 227 MET CA C N S 228 MET C C N N 229 MET O O N N 230 MET CB C N N 231 MET CG C N N 232 MET SD S N N 233 MET CE C N N 234 MET OXT O N N 235 MET H H N N 236 MET H2 H N N 237 MET HA H N N 238 MET HB2 H N N 239 MET HB3 H N N 240 MET HG2 H N N 241 MET HG3 H N N 242 MET HE1 H N N 243 MET HE2 H N N 244 MET HE3 H N N 245 MET HXT H N N 246 PRO N N N N 247 PRO CA C N S 248 PRO C C N N 249 PRO O O N N 250 PRO CB C N N 251 PRO CG C N N 252 PRO CD C N N 253 PRO OXT O N N 254 PRO H H N N 255 PRO HA H N N 256 PRO HB2 H N N 257 PRO HB3 H N N 258 PRO HG2 H N N 259 PRO HG3 H N N 260 PRO HD2 H N N 261 PRO HD3 H N N 262 PRO HXT H N N 263 SER N N N N 264 SER CA C N S 265 SER C C N N 266 SER O O N N 267 SER CB C N N 268 SER OG O N N 269 SER OXT O N N 270 SER H H N N 271 SER H2 H N N 272 SER HA H N N 273 SER HB2 H N N 274 SER HB3 H N N 275 SER HG H N N 276 SER HXT H N N 277 THR N N N N 278 THR CA C N S 279 THR C C N N 280 THR O O N N 281 THR CB C N R 282 THR OG1 O N N 283 THR CG2 C N N 284 THR OXT O N N 285 THR H H N N 286 THR H2 H N N 287 THR HA H N N 288 THR HB H N N 289 THR HG1 H N N 290 THR HG21 H N N 291 THR HG22 H N N 292 THR HG23 H N N 293 THR HXT H N N 294 TRP N N N N 295 TRP CA C N S 296 TRP C C N N 297 TRP O O N N 298 TRP CB C N N 299 TRP CG C Y N 300 TRP CD1 C Y N 301 TRP CD2 C Y N 302 TRP NE1 N Y N 303 TRP CE2 C Y N 304 TRP CE3 C Y N 305 TRP CZ2 C Y N 306 TRP CZ3 C Y N 307 TRP CH2 C Y N 308 TRP OXT O N N 309 TRP H H N N 310 TRP H2 H N N 311 TRP HA H N N 312 TRP HB2 H N N 313 TRP HB3 H N N 314 TRP HD1 H N N 315 TRP HE1 H N N 316 TRP HE3 H N N 317 TRP HZ2 H N N 318 TRP HZ3 H N N 319 TRP HH2 H N N 320 TRP HXT H N N 321 TYR N N N N 322 TYR CA C N S 323 TYR C C N N 324 TYR O O N N 325 TYR CB C N N 326 TYR CG C Y N 327 TYR CD1 C Y N 328 TYR CD2 C Y N 329 TYR CE1 C Y N 330 TYR CE2 C Y N 331 TYR CZ C Y N 332 TYR OH O N N 333 TYR OXT O N N 334 TYR H H N N 335 TYR H2 H N N 336 TYR HA H N N 337 TYR HB2 H N N 338 TYR HB3 H N N 339 TYR HD1 H N N 340 TYR HD2 H N N 341 TYR HE1 H N N 342 TYR HE2 H N N 343 TYR HH H N N 344 TYR HXT H N N 345 VAL N N N N 346 VAL CA C N S 347 VAL C C N N 348 VAL O O N N 349 VAL CB C N N 350 VAL CG1 C N N 351 VAL CG2 C N N 352 VAL OXT O N N 353 VAL H H N N 354 VAL H2 H N N 355 VAL HA H N N 356 VAL HB H N N 357 VAL HG11 H N N 358 VAL HG12 H N N 359 VAL HG13 H N N 360 VAL HG21 H N N 361 VAL HG22 H N N 362 VAL HG23 H N N 363 VAL HXT H N N 364 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 ILE N CA sing N N 150 ILE N H sing N N 151 ILE N H2 sing N N 152 ILE CA C sing N N 153 ILE CA CB sing N N 154 ILE CA HA sing N N 155 ILE C O doub N N 156 ILE C OXT sing N N 157 ILE CB CG1 sing N N 158 ILE CB CG2 sing N N 159 ILE CB HB sing N N 160 ILE CG1 CD1 sing N N 161 ILE CG1 HG12 sing N N 162 ILE CG1 HG13 sing N N 163 ILE CG2 HG21 sing N N 164 ILE CG2 HG22 sing N N 165 ILE CG2 HG23 sing N N 166 ILE CD1 HD11 sing N N 167 ILE CD1 HD12 sing N N 168 ILE CD1 HD13 sing N N 169 ILE OXT HXT sing N N 170 LEU N CA sing N N 171 LEU N H sing N N 172 LEU N H2 sing N N 173 LEU CA C sing N N 174 LEU CA CB sing N N 175 LEU CA HA sing N N 176 LEU C O doub N N 177 LEU C OXT sing N N 178 LEU CB CG sing N N 179 LEU CB HB2 sing N N 180 LEU CB HB3 sing N N 181 LEU CG CD1 sing N N 182 LEU CG CD2 sing N N 183 LEU CG HG sing N N 184 LEU CD1 HD11 sing N N 185 LEU CD1 HD12 sing N N 186 LEU CD1 HD13 sing N N 187 LEU CD2 HD21 sing N N 188 LEU CD2 HD22 sing N N 189 LEU CD2 HD23 sing N N 190 LEU OXT HXT sing N N 191 LYS N CA sing N N 192 LYS N H sing N N 193 LYS N H2 sing N N 194 LYS CA C sing N N 195 LYS CA CB sing N N 196 LYS CA HA sing N N 197 LYS C O doub N N 198 LYS C OXT sing N N 199 LYS CB CG sing N N 200 LYS CB HB2 sing N N 201 LYS CB HB3 sing N N 202 LYS CG CD sing N N 203 LYS CG HG2 sing N N 204 LYS CG HG3 sing N N 205 LYS CD CE sing N N 206 LYS CD HD2 sing N N 207 LYS CD HD3 sing N N 208 LYS CE NZ sing N N 209 LYS CE HE2 sing N N 210 LYS CE HE3 sing N N 211 LYS NZ HZ1 sing N N 212 LYS NZ HZ2 sing N N 213 LYS NZ HZ3 sing N N 214 LYS OXT HXT sing N N 215 MET N CA sing N N 216 MET N H sing N N 217 MET N H2 sing N N 218 MET CA C sing N N 219 MET CA CB sing N N 220 MET CA HA sing N N 221 MET C O doub N N 222 MET C OXT sing N N 223 MET CB CG sing N N 224 MET CB HB2 sing N N 225 MET CB HB3 sing N N 226 MET CG SD sing N N 227 MET CG HG2 sing N N 228 MET CG HG3 sing N N 229 MET SD CE sing N N 230 MET CE HE1 sing N N 231 MET CE HE2 sing N N 232 MET CE HE3 sing N N 233 MET OXT HXT sing N N 234 PRO N CA sing N N 235 PRO N CD sing N N 236 PRO N H sing N N 237 PRO CA C sing N N 238 PRO CA CB sing N N 239 PRO CA HA sing N N 240 PRO C O doub N N 241 PRO C OXT sing N N 242 PRO CB CG sing N N 243 PRO CB HB2 sing N N 244 PRO CB HB3 sing N N 245 PRO CG CD sing N N 246 PRO CG HG2 sing N N 247 PRO CG HG3 sing N N 248 PRO CD HD2 sing N N 249 PRO CD HD3 sing N N 250 PRO OXT HXT sing N N 251 SER N CA sing N N 252 SER N H sing N N 253 SER N H2 sing N N 254 SER CA C sing N N 255 SER CA CB sing N N 256 SER CA HA sing N N 257 SER C O doub N N 258 SER C OXT sing N N 259 SER CB OG sing N N 260 SER CB HB2 sing N N 261 SER CB HB3 sing N N 262 SER OG HG sing N N 263 SER OXT HXT sing N N 264 THR N CA sing N N 265 THR N H sing N N 266 THR N H2 sing N N 267 THR CA C sing N N 268 THR CA CB sing N N 269 THR CA HA sing N N 270 THR C O doub N N 271 THR C OXT sing N N 272 THR CB OG1 sing N N 273 THR CB CG2 sing N N 274 THR CB HB sing N N 275 THR OG1 HG1 sing N N 276 THR CG2 HG21 sing N N 277 THR CG2 HG22 sing N N 278 THR CG2 HG23 sing N N 279 THR OXT HXT sing N N 280 TRP N CA sing N N 281 TRP N H sing N N 282 TRP N H2 sing N N 283 TRP CA C sing N N 284 TRP CA CB sing N N 285 TRP CA HA sing N N 286 TRP C O doub N N 287 TRP C OXT sing N N 288 TRP CB CG sing N N 289 TRP CB HB2 sing N N 290 TRP CB HB3 sing N N 291 TRP CG CD1 doub Y N 292 TRP CG CD2 sing Y N 293 TRP CD1 NE1 sing Y N 294 TRP CD1 HD1 sing N N 295 TRP CD2 CE2 doub Y N 296 TRP CD2 CE3 sing Y N 297 TRP NE1 CE2 sing Y N 298 TRP NE1 HE1 sing N N 299 TRP CE2 CZ2 sing Y N 300 TRP CE3 CZ3 doub Y N 301 TRP CE3 HE3 sing N N 302 TRP CZ2 CH2 doub Y N 303 TRP CZ2 HZ2 sing N N 304 TRP CZ3 CH2 sing Y N 305 TRP CZ3 HZ3 sing N N 306 TRP CH2 HH2 sing N N 307 TRP OXT HXT sing N N 308 TYR N CA sing N N 309 TYR N H sing N N 310 TYR N H2 sing N N 311 TYR CA C sing N N 312 TYR CA CB sing N N 313 TYR CA HA sing N N 314 TYR C O doub N N 315 TYR C OXT sing N N 316 TYR CB CG sing N N 317 TYR CB HB2 sing N N 318 TYR CB HB3 sing N N 319 TYR CG CD1 doub Y N 320 TYR CG CD2 sing Y N 321 TYR CD1 CE1 sing Y N 322 TYR CD1 HD1 sing N N 323 TYR CD2 CE2 doub Y N 324 TYR CD2 HD2 sing N N 325 TYR CE1 CZ doub Y N 326 TYR CE1 HE1 sing N N 327 TYR CE2 CZ sing Y N 328 TYR CE2 HE2 sing N N 329 TYR CZ OH sing N N 330 TYR OH HH sing N N 331 TYR OXT HXT sing N N 332 VAL N CA sing N N 333 VAL N H sing N N 334 VAL N H2 sing N N 335 VAL CA C sing N N 336 VAL CA CB sing N N 337 VAL CA HA sing N N 338 VAL C O doub N N 339 VAL C OXT sing N N 340 VAL CB CG1 sing N N 341 VAL CB CG2 sing N N 342 VAL CB HB sing N N 343 VAL CG1 HG11 sing N N 344 VAL CG1 HG12 sing N N 345 VAL CG1 HG13 sing N N 346 VAL CG2 HG21 sing N N 347 VAL CG2 HG22 sing N N 348 VAL CG2 HG23 sing N N 349 VAL OXT HXT sing N N 350 # _pdbx_audit_support.funding_organization 'Academy of Finland' _pdbx_audit_support.country Finland _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.type _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.details 1 INOVA ? Varian 600 ? 3 INOVA ? Varian 800 ? # _atom_sites.entry_id 8QAJ _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C H N O S # loop_ #