data_8QOB # _entry.id 8QOB # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.404 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 8QOB pdb_00008qob 10.2210/pdb8qob/pdb WWPDB D_1292133647 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date _pdbx_audit_revision_history.part_number 1 'Structure model' 1 0 2024-10-09 ? 2 'Structure model' 1 1 2025-08-06 ? # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_audit_revision_group.ordinal 1 _pdbx_audit_revision_group.revision_ordinal 2 _pdbx_audit_revision_group.data_content_type 'Structure model' _pdbx_audit_revision_group.group 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.id' 3 2 'Structure model' '_citation.journal_abbrev' 4 2 'Structure model' '_citation.journal_id_ASTM' 5 2 'Structure model' '_citation.journal_id_CSD' 6 2 'Structure model' '_citation.journal_id_ISSN' 7 2 'Structure model' '_citation.pdbx_database_id_DOI' 8 2 'Structure model' '_citation.pdbx_database_id_PubMed' 9 2 'Structure model' '_citation.title' 10 2 'Structure model' '_citation.year' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 8QOB _pdbx_database_status.recvd_initial_deposition_date 2023-09-28 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_contact_author.id 2 _pdbx_contact_author.email johan.wouters@unamur.be _pdbx_contact_author.name_first Johan _pdbx_contact_author.name_last Wouters _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-4920-6857 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Scaillet, T.' 1 0000-0002-5762-4901 'Wouters, J.' 2 0000-0002-4920-6857 # loop_ _citation.abstract _citation.abstract_id_CAS _citation.book_id_ISBN _citation.book_publisher _citation.book_publisher_city _citation.book_title _citation.coordinate_linkage _citation.country _citation.database_id_Medline _citation.details _citation.id _citation.journal_abbrev _citation.journal_id_ASTM _citation.journal_id_CSD _citation.journal_id_ISSN _citation.journal_full _citation.journal_issue _citation.journal_volume _citation.language _citation.page_first _citation.page_last _citation.title _citation.year _citation.database_id_CSD _citation.pdbx_database_id_DOI _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_patent _citation.unpublished_flag ? ? ? ? ? ? ? US ? ? primary Proteins PSFGEY 0867 1097-0134 ? ? ? ? ? ? 'Structural and Enzymological Characterization of Phosphoserine Phosphatase From Brucella melitensis.' 2025 ? 10.1002/prot.70027 40719280 ? ? ? ? ? ? ? ? ? US ? ? 1 'J Synchrotron Radiat' JSYRES ? 1600-5775 ? ? 26 ? 393 405 'MXCuBE2: the dawn of MXCuBE Collaboration.' 2019 ? 10.1107/S1600577519001267 30855248 ? ? ? ? ? ? ? ? ? US ? ? 2 'Acta Crystallogr D Biol Crystallogr' ABCRE6 ? 1399-0047 ? ? 66 ? 486 501 'Features and development of Coot.' 2010 ? 10.1107/S0907444910007493 20383002 ? ? ? ? ? ? ? ? ? US ? ? 3 'Acta Crystallogr D Biol Crystallogr' ABCRE6 ? 1399-0047 ? ? 66 ? 133 144 'Integration, scaling, space-group assignment and post-refinement.' 2010 ? 10.1107/S0907444909047374 20124693 ? ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Scaillet, T.' 1 ? primary 'Pierson, E.' 2 ? primary 'Fillet, M.' 3 ? primary 'Wouters, J.' 4 ? 1 'Oscarsson, M.' 5 ? 1 'Beteva, A.' 6 ? 1 'Flot, D.' 7 ? 1 'Gordon, E.' 8 ? 1 'Guijarro, M.' 9 ? 1 'Leonard, G.' 10 0000-0001-5030-0122 1 'McSweeney, S.' 11 ? 1 'Monaco, S.' 12 ? 1 'Mueller-Dieckmann, C.' 13 0000-0003-3625-2747 1 'Nanao, M.' 14 ? 1 'Nurizzo, D.' 15 ? 1 'Popov, A.N.' 16 ? 1 'von Stetten, D.' 17 ? 1 'Svensson, O.' 18 ? 1 'Rey-Bakaikoa, V.' 19 0000-0003-2987-6391 1 'Chado, I.' 20 ? 1 'Chavas, L.M.G.' 21 0000-0001-9973-9355 1 'Gadea, L.' 22 ? 1 'Gourhant, P.' 23 ? 1 'Isabet, T.' 24 ? 1 'Legrand, P.' 25 ? 1 'Savko, M.' 26 ? 1 'Sirigu, S.' 27 ? 1 'Shepard, W.' 28 ? 1 'Thompson, A.' 29 ? 1 'Mueller, U.' 30 ? 1 'Nan, J.' 31 ? 1 'Eguiraun, M.' 32 ? 1 'Bolmsten, F.' 33 ? 1 'Nardella, A.' 34 ? 1 'Milan-Otero, A.' 35 ? 1 'Thunnissen, M.' 36 ? 1 'Hellmig, M.' 37 ? 1 'Kastner, A.' 38 ? 1 'Schmuckermaier, L.' 39 ? 1 'Gerlach, M.' 40 ? 1 'Feiler, C.' 41 ? 1 'Weiss, M.S.' 42 ? 1 'Bowler, M.W.' 43 ? 1 'Gobbo, A.' 44 ? 1 'Papp, G.' 45 0000-0002-5702-843X 1 'Sinoir, J.' 46 ? 1 'McCarthy, A.A.' 47 0000-0003-4478-0136 1 'Karpics, I.' 48 ? 1 'Nikolova, M.' 49 ? 1 'Bourenkov, G.' 50 ? 1 'Schneider, T.' 51 0000-0001-6955-7374 1 'Andreu, J.' 52 0000-0003-0865-5741 1 'Cuni, G.' 53 0000-0002-7092-4749 1 'Juanhuix, J.' 54 0000-0003-3728-8215 1 'Boer, R.' 55 ? 1 'Fogh, R.' 56 ? 1 'Keller, P.' 57 ? 1 'Flensburg, C.' 58 ? 1 'Paciorek, W.' 59 ? 1 'Vonrhein, C.' 60 ? 1 'Bricogne, G.' 61 ? 1 'de Sanctis, D.' 62 ? 2 'Emsley, P.' 63 ? 2 'Lohkamp, B.' 64 ? 2 'Scott, W.G.' 65 ? 2 'Cowtan, K.' 66 ? 3 'Kabsch, W.' 67 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Phosphoserine phosphatase' 32549.479 1 3.1.3.3 ? ? ? 2 non-polymer syn '(2~{R})-2-azanyl-3-phosphono-propanoic acid' 169.073 1 ? ? ? ? 3 non-polymer syn 'MAGNESIUM ION' 24.305 1 ? ? ? ? 4 non-polymer syn 'CHLORIDE ION' 35.453 1 ? ? ? ? 5 water nat water 18.015 93 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'O-phosphoserine phosphohydrolase' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GPGSMLLSMSQQVSLVATLIANPAKAALAPSLGIKASAAVNATGLYWLADDIACDIPLPLGMEASEADASLRATLDGAPI DVVVQEQERRRKKILIADMDSTMIGQECIDELAEEAGLRDHVAAITARAMNGEIAFEPALRERVALLKGLPLSVIDKVIS TRITLTPGGPQLVRTMRKHGAYTALVSGGFTSFTRRIAEMIGFNEERANRLIDDGTRLTGTVAEPILGREAKVEKLVEIA ERVGLTPEDAIAVGDGANDLGMIQLAGTGVALHAKPAVAAQAKMRIDHGDLTALLYIQGYRKADFVQ ; _entity_poly.pdbx_seq_one_letter_code_can ;GPGSMLLSMSQQVSLVATLIANPAKAALAPSLGIKASAAVNATGLYWLADDIACDIPLPLGMEASEADASLRATLDGAPI DVVVQEQERRRKKILIADMDSTMIGQECIDELAEEAGLRDHVAAITARAMNGEIAFEPALRERVALLKGLPLSVIDKVIS TRITLTPGGPQLVRTMRKHGAYTALVSGGFTSFTRRIAEMIGFNEERANRLIDDGTRLTGTVAEPILGREAKVEKLVEIA ERVGLTPEDAIAVGDGANDLGMIQLAGTGVALHAKPAVAAQAKMRIDHGDLTALLYIQGYRKADFVQ ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 '(2~{R})-2-azanyl-3-phosphono-propanoic acid' WHT 3 'MAGNESIUM ION' MG 4 'CHLORIDE ION' CL 5 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 PRO n 1 3 GLY n 1 4 SER n 1 5 MET n 1 6 LEU n 1 7 LEU n 1 8 SER n 1 9 MET n 1 10 SER n 1 11 GLN n 1 12 GLN n 1 13 VAL n 1 14 SER n 1 15 LEU n 1 16 VAL n 1 17 ALA n 1 18 THR n 1 19 LEU n 1 20 ILE n 1 21 ALA n 1 22 ASN n 1 23 PRO n 1 24 ALA n 1 25 LYS n 1 26 ALA n 1 27 ALA n 1 28 LEU n 1 29 ALA n 1 30 PRO n 1 31 SER n 1 32 LEU n 1 33 GLY n 1 34 ILE n 1 35 LYS n 1 36 ALA n 1 37 SER n 1 38 ALA n 1 39 ALA n 1 40 VAL n 1 41 ASN n 1 42 ALA n 1 43 THR n 1 44 GLY n 1 45 LEU n 1 46 TYR n 1 47 TRP n 1 48 LEU n 1 49 ALA n 1 50 ASP n 1 51 ASP n 1 52 ILE n 1 53 ALA n 1 54 CYS n 1 55 ASP n 1 56 ILE n 1 57 PRO n 1 58 LEU n 1 59 PRO n 1 60 LEU n 1 61 GLY n 1 62 MET n 1 63 GLU n 1 64 ALA n 1 65 SER n 1 66 GLU n 1 67 ALA n 1 68 ASP n 1 69 ALA n 1 70 SER n 1 71 LEU n 1 72 ARG n 1 73 ALA n 1 74 THR n 1 75 LEU n 1 76 ASP n 1 77 GLY n 1 78 ALA n 1 79 PRO n 1 80 ILE n 1 81 ASP n 1 82 VAL n 1 83 VAL n 1 84 VAL n 1 85 GLN n 1 86 GLU n 1 87 GLN n 1 88 GLU n 1 89 ARG n 1 90 ARG n 1 91 ARG n 1 92 LYS n 1 93 LYS n 1 94 ILE n 1 95 LEU n 1 96 ILE n 1 97 ALA n 1 98 ASP n 1 99 MET n 1 100 ASP n 1 101 SER n 1 102 THR n 1 103 MET n 1 104 ILE n 1 105 GLY n 1 106 GLN n 1 107 GLU n 1 108 CYS n 1 109 ILE n 1 110 ASP n 1 111 GLU n 1 112 LEU n 1 113 ALA n 1 114 GLU n 1 115 GLU n 1 116 ALA n 1 117 GLY n 1 118 LEU n 1 119 ARG n 1 120 ASP n 1 121 HIS n 1 122 VAL n 1 123 ALA n 1 124 ALA n 1 125 ILE n 1 126 THR n 1 127 ALA n 1 128 ARG n 1 129 ALA n 1 130 MET n 1 131 ASN n 1 132 GLY n 1 133 GLU n 1 134 ILE n 1 135 ALA n 1 136 PHE n 1 137 GLU n 1 138 PRO n 1 139 ALA n 1 140 LEU n 1 141 ARG n 1 142 GLU n 1 143 ARG n 1 144 VAL n 1 145 ALA n 1 146 LEU n 1 147 LEU n 1 148 LYS n 1 149 GLY n 1 150 LEU n 1 151 PRO n 1 152 LEU n 1 153 SER n 1 154 VAL n 1 155 ILE n 1 156 ASP n 1 157 LYS n 1 158 VAL n 1 159 ILE n 1 160 SER n 1 161 THR n 1 162 ARG n 1 163 ILE n 1 164 THR n 1 165 LEU n 1 166 THR n 1 167 PRO n 1 168 GLY n 1 169 GLY n 1 170 PRO n 1 171 GLN n 1 172 LEU n 1 173 VAL n 1 174 ARG n 1 175 THR n 1 176 MET n 1 177 ARG n 1 178 LYS n 1 179 HIS n 1 180 GLY n 1 181 ALA n 1 182 TYR n 1 183 THR n 1 184 ALA n 1 185 LEU n 1 186 VAL n 1 187 SER n 1 188 GLY n 1 189 GLY n 1 190 PHE n 1 191 THR n 1 192 SER n 1 193 PHE n 1 194 THR n 1 195 ARG n 1 196 ARG n 1 197 ILE n 1 198 ALA n 1 199 GLU n 1 200 MET n 1 201 ILE n 1 202 GLY n 1 203 PHE n 1 204 ASN n 1 205 GLU n 1 206 GLU n 1 207 ARG n 1 208 ALA n 1 209 ASN n 1 210 ARG n 1 211 LEU n 1 212 ILE n 1 213 ASP n 1 214 ASP n 1 215 GLY n 1 216 THR n 1 217 ARG n 1 218 LEU n 1 219 THR n 1 220 GLY n 1 221 THR n 1 222 VAL n 1 223 ALA n 1 224 GLU n 1 225 PRO n 1 226 ILE n 1 227 LEU n 1 228 GLY n 1 229 ARG n 1 230 GLU n 1 231 ALA n 1 232 LYS n 1 233 VAL n 1 234 GLU n 1 235 LYS n 1 236 LEU n 1 237 VAL n 1 238 GLU n 1 239 ILE n 1 240 ALA n 1 241 GLU n 1 242 ARG n 1 243 VAL n 1 244 GLY n 1 245 LEU n 1 246 THR n 1 247 PRO n 1 248 GLU n 1 249 ASP n 1 250 ALA n 1 251 ILE n 1 252 ALA n 1 253 VAL n 1 254 GLY n 1 255 ASP n 1 256 GLY n 1 257 ALA n 1 258 ASN n 1 259 ASP n 1 260 LEU n 1 261 GLY n 1 262 MET n 1 263 ILE n 1 264 GLN n 1 265 LEU n 1 266 ALA n 1 267 GLY n 1 268 THR n 1 269 GLY n 1 270 VAL n 1 271 ALA n 1 272 LEU n 1 273 HIS n 1 274 ALA n 1 275 LYS n 1 276 PRO n 1 277 ALA n 1 278 VAL n 1 279 ALA n 1 280 ALA n 1 281 GLN n 1 282 ALA n 1 283 LYS n 1 284 MET n 1 285 ARG n 1 286 ILE n 1 287 ASP n 1 288 HIS n 1 289 GLY n 1 290 ASP n 1 291 LEU n 1 292 THR n 1 293 ALA n 1 294 LEU n 1 295 LEU n 1 296 TYR n 1 297 ILE n 1 298 GLN n 1 299 GLY n 1 300 TYR n 1 301 ARG n 1 302 LYS n 1 303 ALA n 1 304 ASP n 1 305 PHE n 1 306 VAL n 1 307 GLN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 307 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene BMEI0615 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Brucella melitensis' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 29459 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CL non-polymer . 'CHLORIDE ION' ? 'Cl -1' 35.453 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MG non-polymer . 'MAGNESIUM ION' ? 'Mg 2' 24.305 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 WHT non-polymer . '(2~{R})-2-azanyl-3-phosphono-propanoic acid' ? 'C3 H8 N O5 P' 169.073 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 -11 ? ? ? A . n A 1 2 PRO 2 -10 ? ? ? A . n A 1 3 GLY 3 -9 ? ? ? A . n A 1 4 SER 4 -8 ? ? ? A . n A 1 5 MET 5 -7 ? ? ? A . n A 1 6 LEU 6 -6 ? ? ? A . n A 1 7 LEU 7 -5 ? ? ? A . n A 1 8 SER 8 -4 ? ? ? A . n A 1 9 MET 9 -3 ? ? ? A . n A 1 10 SER 10 -2 ? ? ? A . n A 1 11 GLN 11 -1 ? ? ? A . n A 1 12 GLN 12 0 ? ? ? A . n A 1 13 VAL 13 1 1 VAL VAL A . n A 1 14 SER 14 2 2 SER SER A . n A 1 15 LEU 15 3 3 LEU LEU A . n A 1 16 VAL 16 4 4 VAL VAL A . n A 1 17 ALA 17 5 5 ALA ALA A . n A 1 18 THR 18 6 6 THR THR A . n A 1 19 LEU 19 7 7 LEU LEU A . n A 1 20 ILE 20 8 8 ILE ILE A . n A 1 21 ALA 21 9 9 ALA ALA A . n A 1 22 ASN 22 10 10 ASN ASN A . n A 1 23 PRO 23 11 11 PRO PRO A . n A 1 24 ALA 24 12 12 ALA ALA A . n A 1 25 LYS 25 13 13 LYS LYS A . n A 1 26 ALA 26 14 14 ALA ALA A . n A 1 27 ALA 27 15 15 ALA ALA A . n A 1 28 LEU 28 16 16 LEU LEU A . n A 1 29 ALA 29 17 17 ALA ALA A . n A 1 30 PRO 30 18 18 PRO PRO A . n A 1 31 SER 31 19 19 SER SER A . n A 1 32 LEU 32 20 20 LEU LEU A . n A 1 33 GLY 33 21 21 GLY GLY A . n A 1 34 ILE 34 22 22 ILE ILE A . n A 1 35 LYS 35 23 23 LYS LYS A . n A 1 36 ALA 36 24 24 ALA ALA A . n A 1 37 SER 37 25 25 SER SER A . n A 1 38 ALA 38 26 26 ALA ALA A . n A 1 39 ALA 39 27 27 ALA ALA A . n A 1 40 VAL 40 28 28 VAL VAL A . n A 1 41 ASN 41 29 29 ASN ASN A . n A 1 42 ALA 42 30 30 ALA ALA A . n A 1 43 THR 43 31 31 THR THR A . n A 1 44 GLY 44 32 32 GLY GLY A . n A 1 45 LEU 45 33 33 LEU LEU A . n A 1 46 TYR 46 34 34 TYR TYR A . n A 1 47 TRP 47 35 35 TRP TRP A . n A 1 48 LEU 48 36 36 LEU LEU A . n A 1 49 ALA 49 37 37 ALA ALA A . n A 1 50 ASP 50 38 38 ASP ASP A . n A 1 51 ASP 51 39 39 ASP ASP A . n A 1 52 ILE 52 40 40 ILE ILE A . n A 1 53 ALA 53 41 41 ALA ALA A . n A 1 54 CYS 54 42 42 CYS CYS A . n A 1 55 ASP 55 43 43 ASP ASP A . n A 1 56 ILE 56 44 44 ILE ILE A . n A 1 57 PRO 57 45 45 PRO PRO A . n A 1 58 LEU 58 46 46 LEU LEU A . n A 1 59 PRO 59 47 47 PRO PRO A . n A 1 60 LEU 60 48 48 LEU LEU A . n A 1 61 GLY 61 49 49 GLY GLY A . n A 1 62 MET 62 50 50 MET MET A . n A 1 63 GLU 63 51 51 GLU GLU A . n A 1 64 ALA 64 52 52 ALA ALA A . n A 1 65 SER 65 53 53 SER SER A . n A 1 66 GLU 66 54 54 GLU GLU A . n A 1 67 ALA 67 55 55 ALA ALA A . n A 1 68 ASP 68 56 56 ASP ASP A . n A 1 69 ALA 69 57 57 ALA ALA A . n A 1 70 SER 70 58 58 SER SER A . n A 1 71 LEU 71 59 59 LEU LEU A . n A 1 72 ARG 72 60 60 ARG ARG A . n A 1 73 ALA 73 61 61 ALA ALA A . n A 1 74 THR 74 62 62 THR THR A . n A 1 75 LEU 75 63 63 LEU LEU A . n A 1 76 ASP 76 64 64 ASP ASP A . n A 1 77 GLY 77 65 65 GLY GLY A . n A 1 78 ALA 78 66 66 ALA ALA A . n A 1 79 PRO 79 67 67 PRO PRO A . n A 1 80 ILE 80 68 68 ILE ILE A . n A 1 81 ASP 81 69 69 ASP ASP A . n A 1 82 VAL 82 70 70 VAL VAL A . n A 1 83 VAL 83 71 71 VAL VAL A . n A 1 84 VAL 84 72 72 VAL VAL A . n A 1 85 GLN 85 73 73 GLN GLN A . n A 1 86 GLU 86 74 74 GLU GLU A . n A 1 87 GLN 87 75 75 GLN GLN A . n A 1 88 GLU 88 76 76 GLU GLU A . n A 1 89 ARG 89 77 77 ARG ARG A . n A 1 90 ARG 90 78 78 ARG ARG A . n A 1 91 ARG 91 79 79 ARG ARG A . n A 1 92 LYS 92 80 80 LYS LYS A . n A 1 93 LYS 93 81 81 LYS LYS A . n A 1 94 ILE 94 82 82 ILE ILE A . n A 1 95 LEU 95 83 83 LEU LEU A . n A 1 96 ILE 96 84 84 ILE ILE A . n A 1 97 ALA 97 85 85 ALA ALA A . n A 1 98 ASP 98 86 86 ASP ASP A . n A 1 99 MET 99 87 87 MET MET A . n A 1 100 ASP 100 88 88 ASP ASP A . n A 1 101 SER 101 89 89 SER SER A . n A 1 102 THR 102 90 90 THR THR A . n A 1 103 MET 103 91 91 MET MET A . n A 1 104 ILE 104 92 92 ILE ILE A . n A 1 105 GLY 105 93 93 GLY GLY A . n A 1 106 GLN 106 94 94 GLN GLN A . n A 1 107 GLU 107 95 95 GLU GLU A . n A 1 108 CYS 108 96 96 CYS CYS A . n A 1 109 ILE 109 97 97 ILE ILE A . n A 1 110 ASP 110 98 98 ASP ASP A . n A 1 111 GLU 111 99 99 GLU GLU A . n A 1 112 LEU 112 100 100 LEU LEU A . n A 1 113 ALA 113 101 101 ALA ALA A . n A 1 114 GLU 114 102 102 GLU GLU A . n A 1 115 GLU 115 103 103 GLU GLU A . n A 1 116 ALA 116 104 104 ALA ALA A . n A 1 117 GLY 117 105 105 GLY GLY A . n A 1 118 LEU 118 106 106 LEU LEU A . n A 1 119 ARG 119 107 107 ARG ARG A . n A 1 120 ASP 120 108 108 ASP ASP A . n A 1 121 HIS 121 109 109 HIS HIS A . n A 1 122 VAL 122 110 110 VAL VAL A . n A 1 123 ALA 123 111 111 ALA ALA A . n A 1 124 ALA 124 112 112 ALA ALA A . n A 1 125 ILE 125 113 113 ILE ILE A . n A 1 126 THR 126 114 114 THR THR A . n A 1 127 ALA 127 115 115 ALA ALA A . n A 1 128 ARG 128 116 116 ARG ARG A . n A 1 129 ALA 129 117 117 ALA ALA A . n A 1 130 MET 130 118 118 MET MET A . n A 1 131 ASN 131 119 119 ASN ASN A . n A 1 132 GLY 132 120 120 GLY GLY A . n A 1 133 GLU 133 121 121 GLU GLU A . n A 1 134 ILE 134 122 122 ILE ILE A . n A 1 135 ALA 135 123 123 ALA ALA A . n A 1 136 PHE 136 124 124 PHE PHE A . n A 1 137 GLU 137 125 125 GLU GLU A . n A 1 138 PRO 138 126 126 PRO PRO A . n A 1 139 ALA 139 127 127 ALA ALA A . n A 1 140 LEU 140 128 128 LEU LEU A . n A 1 141 ARG 141 129 129 ARG ARG A . n A 1 142 GLU 142 130 130 GLU GLU A . n A 1 143 ARG 143 131 131 ARG ARG A . n A 1 144 VAL 144 132 132 VAL VAL A . n A 1 145 ALA 145 133 133 ALA ALA A . n A 1 146 LEU 146 134 134 LEU LEU A . n A 1 147 LEU 147 135 135 LEU LEU A . n A 1 148 LYS 148 136 136 LYS LYS A . n A 1 149 GLY 149 137 137 GLY GLY A . n A 1 150 LEU 150 138 138 LEU LEU A . n A 1 151 PRO 151 139 139 PRO PRO A . n A 1 152 LEU 152 140 140 LEU LEU A . n A 1 153 SER 153 141 141 SER SER A . n A 1 154 VAL 154 142 142 VAL VAL A . n A 1 155 ILE 155 143 143 ILE ILE A . n A 1 156 ASP 156 144 144 ASP ASP A . n A 1 157 LYS 157 145 145 LYS LYS A . n A 1 158 VAL 158 146 146 VAL VAL A . n A 1 159 ILE 159 147 147 ILE ILE A . n A 1 160 SER 160 148 148 SER SER A . n A 1 161 THR 161 149 149 THR THR A . n A 1 162 ARG 162 150 150 ARG ARG A . n A 1 163 ILE 163 151 151 ILE ILE A . n A 1 164 THR 164 152 152 THR THR A . n A 1 165 LEU 165 153 153 LEU LEU A . n A 1 166 THR 166 154 154 THR THR A . n A 1 167 PRO 167 155 155 PRO PRO A . n A 1 168 GLY 168 156 156 GLY GLY A . n A 1 169 GLY 169 157 157 GLY GLY A . n A 1 170 PRO 170 158 158 PRO PRO A . n A 1 171 GLN 171 159 159 GLN GLN A . n A 1 172 LEU 172 160 160 LEU LEU A . n A 1 173 VAL 173 161 161 VAL VAL A . n A 1 174 ARG 174 162 162 ARG ARG A . n A 1 175 THR 175 163 163 THR THR A . n A 1 176 MET 176 164 164 MET MET A . n A 1 177 ARG 177 165 165 ARG ARG A . n A 1 178 LYS 178 166 166 LYS LYS A . n A 1 179 HIS 179 167 167 HIS HIS A . n A 1 180 GLY 180 168 168 GLY GLY A . n A 1 181 ALA 181 169 169 ALA ALA A . n A 1 182 TYR 182 170 170 TYR TYR A . n A 1 183 THR 183 171 171 THR THR A . n A 1 184 ALA 184 172 172 ALA ALA A . n A 1 185 LEU 185 173 173 LEU LEU A . n A 1 186 VAL 186 174 174 VAL VAL A . n A 1 187 SER 187 175 175 SER SER A . n A 1 188 GLY 188 176 176 GLY GLY A . n A 1 189 GLY 189 177 177 GLY GLY A . n A 1 190 PHE 190 178 178 PHE PHE A . n A 1 191 THR 191 179 179 THR THR A . n A 1 192 SER 192 180 180 SER SER A . n A 1 193 PHE 193 181 181 PHE PHE A . n A 1 194 THR 194 182 182 THR THR A . n A 1 195 ARG 195 183 183 ARG ARG A . n A 1 196 ARG 196 184 184 ARG ARG A . n A 1 197 ILE 197 185 185 ILE ILE A . n A 1 198 ALA 198 186 186 ALA ALA A . n A 1 199 GLU 199 187 187 GLU GLU A . n A 1 200 MET 200 188 188 MET MET A . n A 1 201 ILE 201 189 189 ILE ILE A . n A 1 202 GLY 202 190 190 GLY GLY A . n A 1 203 PHE 203 191 191 PHE PHE A . n A 1 204 ASN 204 192 192 ASN ASN A . n A 1 205 GLU 205 193 193 GLU GLU A . n A 1 206 GLU 206 194 194 GLU GLU A . n A 1 207 ARG 207 195 195 ARG ARG A . n A 1 208 ALA 208 196 196 ALA ALA A . n A 1 209 ASN 209 197 197 ASN ASN A . n A 1 210 ARG 210 198 198 ARG ARG A . n A 1 211 LEU 211 199 199 LEU LEU A . n A 1 212 ILE 212 200 200 ILE ILE A . n A 1 213 ASP 213 201 201 ASP ASP A . n A 1 214 ASP 214 202 202 ASP ASP A . n A 1 215 GLY 215 203 203 GLY GLY A . n A 1 216 THR 216 204 204 THR THR A . n A 1 217 ARG 217 205 205 ARG ARG A . n A 1 218 LEU 218 206 206 LEU LEU A . n A 1 219 THR 219 207 207 THR THR A . n A 1 220 GLY 220 208 208 GLY GLY A . n A 1 221 THR 221 209 209 THR THR A . n A 1 222 VAL 222 210 210 VAL VAL A . n A 1 223 ALA 223 211 211 ALA ALA A . n A 1 224 GLU 224 212 212 GLU GLU A . n A 1 225 PRO 225 213 213 PRO PRO A . n A 1 226 ILE 226 214 214 ILE ILE A . n A 1 227 LEU 227 215 215 LEU LEU A . n A 1 228 GLY 228 216 216 GLY GLY A . n A 1 229 ARG 229 217 217 ARG ARG A . n A 1 230 GLU 230 218 218 GLU GLU A . n A 1 231 ALA 231 219 219 ALA ALA A . n A 1 232 LYS 232 220 220 LYS LYS A . n A 1 233 VAL 233 221 221 VAL VAL A . n A 1 234 GLU 234 222 222 GLU GLU A . n A 1 235 LYS 235 223 223 LYS LYS A . n A 1 236 LEU 236 224 224 LEU LEU A . n A 1 237 VAL 237 225 225 VAL VAL A . n A 1 238 GLU 238 226 226 GLU GLU A . n A 1 239 ILE 239 227 227 ILE ILE A . n A 1 240 ALA 240 228 228 ALA ALA A . n A 1 241 GLU 241 229 229 GLU GLU A . n A 1 242 ARG 242 230 230 ARG ARG A . n A 1 243 VAL 243 231 231 VAL VAL A . n A 1 244 GLY 244 232 232 GLY GLY A . n A 1 245 LEU 245 233 233 LEU LEU A . n A 1 246 THR 246 234 234 THR THR A . n A 1 247 PRO 247 235 235 PRO PRO A . n A 1 248 GLU 248 236 236 GLU GLU A . n A 1 249 ASP 249 237 237 ASP ASP A . n A 1 250 ALA 250 238 238 ALA ALA A . n A 1 251 ILE 251 239 239 ILE ILE A . n A 1 252 ALA 252 240 240 ALA ALA A . n A 1 253 VAL 253 241 241 VAL VAL A . n A 1 254 GLY 254 242 242 GLY GLY A . n A 1 255 ASP 255 243 243 ASP ASP A . n A 1 256 GLY 256 244 244 GLY GLY A . n A 1 257 ALA 257 245 245 ALA ALA A . n A 1 258 ASN 258 246 246 ASN ASN A . n A 1 259 ASP 259 247 247 ASP ASP A . n A 1 260 LEU 260 248 248 LEU LEU A . n A 1 261 GLY 261 249 249 GLY GLY A . n A 1 262 MET 262 250 250 MET MET A . n A 1 263 ILE 263 251 251 ILE ILE A . n A 1 264 GLN 264 252 252 GLN GLN A . n A 1 265 LEU 265 253 253 LEU LEU A . n A 1 266 ALA 266 254 254 ALA ALA A . n A 1 267 GLY 267 255 255 GLY GLY A . n A 1 268 THR 268 256 256 THR THR A . n A 1 269 GLY 269 257 257 GLY GLY A . n A 1 270 VAL 270 258 258 VAL VAL A . n A 1 271 ALA 271 259 259 ALA ALA A . n A 1 272 LEU 272 260 260 LEU LEU A . n A 1 273 HIS 273 261 261 HIS HIS A . n A 1 274 ALA 274 262 262 ALA ALA A . n A 1 275 LYS 275 263 263 LYS LYS A . n A 1 276 PRO 276 264 264 PRO PRO A . n A 1 277 ALA 277 265 265 ALA ALA A . n A 1 278 VAL 278 266 266 VAL VAL A . n A 1 279 ALA 279 267 267 ALA ALA A . n A 1 280 ALA 280 268 268 ALA ALA A . n A 1 281 GLN 281 269 269 GLN GLN A . n A 1 282 ALA 282 270 270 ALA ALA A . n A 1 283 LYS 283 271 271 LYS LYS A . n A 1 284 MET 284 272 272 MET MET A . n A 1 285 ARG 285 273 273 ARG ARG A . n A 1 286 ILE 286 274 274 ILE ILE A . n A 1 287 ASP 287 275 275 ASP ASP A . n A 1 288 HIS 288 276 276 HIS HIS A . n A 1 289 GLY 289 277 277 GLY GLY A . n A 1 290 ASP 290 278 278 ASP ASP A . n A 1 291 LEU 291 279 279 LEU LEU A . n A 1 292 THR 292 280 280 THR THR A . n A 1 293 ALA 293 281 281 ALA ALA A . n A 1 294 LEU 294 282 282 LEU LEU A . n A 1 295 LEU 295 283 283 LEU LEU A . n A 1 296 TYR 296 284 284 TYR TYR A . n A 1 297 ILE 297 285 285 ILE ILE A . n A 1 298 GLN 298 286 286 GLN GLN A . n A 1 299 GLY 299 287 287 GLY GLY A . n A 1 300 TYR 300 288 288 TYR TYR A . n A 1 301 ARG 301 289 289 ARG ARG A . n A 1 302 LYS 302 290 290 LYS LYS A . n A 1 303 ALA 303 291 291 ALA ALA A . n A 1 304 ASP 304 292 292 ASP ASP A . n A 1 305 PHE 305 293 293 PHE PHE A . n A 1 306 VAL 306 294 294 VAL VAL A . n A 1 307 GLN 307 295 295 GLN GLN A . n # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id WHT _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id WHT _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 WHT 1 301 301 WHT AP3 A . C 3 MG 1 302 1 MG MG A . D 4 CL 1 303 1 CL CL A . E 5 HOH 1 401 77 HOH HOH A . E 5 HOH 2 402 27 HOH HOH A . E 5 HOH 3 403 39 HOH HOH A . E 5 HOH 4 404 83 HOH HOH A . E 5 HOH 5 405 110 HOH HOH A . E 5 HOH 6 406 65 HOH HOH A . E 5 HOH 7 407 64 HOH HOH A . E 5 HOH 8 408 26 HOH HOH A . E 5 HOH 9 409 7 HOH HOH A . E 5 HOH 10 410 17 HOH HOH A . E 5 HOH 11 411 107 HOH HOH A . E 5 HOH 12 412 45 HOH HOH A . E 5 HOH 13 413 4 HOH HOH A . E 5 HOH 14 414 32 HOH HOH A . E 5 HOH 15 415 5 HOH HOH A . E 5 HOH 16 416 18 HOH HOH A . E 5 HOH 17 417 6 HOH HOH A . E 5 HOH 18 418 41 HOH HOH A . E 5 HOH 19 419 2 HOH HOH A . E 5 HOH 20 420 9 HOH HOH A . E 5 HOH 21 421 99 HOH HOH A . E 5 HOH 22 422 33 HOH HOH A . E 5 HOH 23 423 24 HOH HOH A . E 5 HOH 24 424 10 HOH HOH A . E 5 HOH 25 425 103 HOH HOH A . E 5 HOH 26 426 12 HOH HOH A . E 5 HOH 27 427 89 HOH HOH A . E 5 HOH 28 428 3 HOH HOH A . E 5 HOH 29 429 57 HOH HOH A . E 5 HOH 30 430 14 HOH HOH A . E 5 HOH 31 431 11 HOH HOH A . E 5 HOH 32 432 13 HOH HOH A . E 5 HOH 33 433 15 HOH HOH A . E 5 HOH 34 434 102 HOH HOH A . E 5 HOH 35 435 97 HOH HOH A . E 5 HOH 36 436 70 HOH HOH A . E 5 HOH 37 437 100 HOH HOH A . E 5 HOH 38 438 55 HOH HOH A . E 5 HOH 39 439 20 HOH HOH A . E 5 HOH 40 440 30 HOH HOH A . E 5 HOH 41 441 52 HOH HOH A . E 5 HOH 42 442 104 HOH HOH A . E 5 HOH 43 443 35 HOH HOH A . E 5 HOH 44 444 36 HOH HOH A . E 5 HOH 45 445 16 HOH HOH A . E 5 HOH 46 446 25 HOH HOH A . E 5 HOH 47 447 93 HOH HOH A . E 5 HOH 48 448 62 HOH HOH A . E 5 HOH 49 449 78 HOH HOH A . E 5 HOH 50 450 74 HOH HOH A . E 5 HOH 51 451 111 HOH HOH A . E 5 HOH 52 452 108 HOH HOH A . E 5 HOH 53 453 96 HOH HOH A . E 5 HOH 54 454 76 HOH HOH A . E 5 HOH 55 455 37 HOH HOH A . E 5 HOH 56 456 48 HOH HOH A . E 5 HOH 57 457 38 HOH HOH A . E 5 HOH 58 458 63 HOH HOH A . E 5 HOH 59 459 34 HOH HOH A . E 5 HOH 60 460 71 HOH HOH A . E 5 HOH 61 461 61 HOH HOH A . E 5 HOH 62 462 29 HOH HOH A . E 5 HOH 63 463 84 HOH HOH A . E 5 HOH 64 464 46 HOH HOH A . E 5 HOH 65 465 81 HOH HOH A . E 5 HOH 66 466 43 HOH HOH A . E 5 HOH 67 467 58 HOH HOH A . E 5 HOH 68 468 21 HOH HOH A . E 5 HOH 69 469 85 HOH HOH A . E 5 HOH 70 470 44 HOH HOH A . E 5 HOH 71 471 94 HOH HOH A . E 5 HOH 72 472 66 HOH HOH A . E 5 HOH 73 473 72 HOH HOH A . E 5 HOH 74 474 69 HOH HOH A . E 5 HOH 75 475 109 HOH HOH A . E 5 HOH 76 476 92 HOH HOH A . E 5 HOH 77 477 106 HOH HOH A . E 5 HOH 78 478 56 HOH HOH A . E 5 HOH 79 479 88 HOH HOH A . E 5 HOH 80 480 47 HOH HOH A . E 5 HOH 81 481 98 HOH HOH A . E 5 HOH 82 482 87 HOH HOH A . E 5 HOH 83 483 80 HOH HOH A . E 5 HOH 84 484 82 HOH HOH A . E 5 HOH 85 485 54 HOH HOH A . E 5 HOH 86 486 68 HOH HOH A . E 5 HOH 87 487 86 HOH HOH A . E 5 HOH 88 488 79 HOH HOH A . E 5 HOH 89 489 42 HOH HOH A . E 5 HOH 90 490 75 HOH HOH A . E 5 HOH 91 491 22 HOH HOH A . E 5 HOH 92 492 67 HOH HOH A . E 5 HOH 93 493 91 HOH HOH A . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 0 A LYS 23 ? CD ? A LYS 35 CD 2 1 Y 0 A LYS 23 ? CE ? A LYS 35 CE 3 1 Y 0 A LYS 23 ? NZ ? A LYS 35 NZ 4 1 Y 0 A LEU 48 ? CG ? A LEU 60 CG 5 1 Y 0 A LEU 48 ? CD1 ? A LEU 60 CD1 6 1 Y 0 A LEU 48 ? CD2 ? A LEU 60 CD2 7 1 Y 0 A GLU 76 ? CD ? A GLU 88 CD 8 1 Y 0 A GLU 76 ? OE1 ? A GLU 88 OE1 9 1 Y 0 A GLU 76 ? OE2 ? A GLU 88 OE2 10 1 Y 0 A LYS 271 ? CD ? A LYS 283 CD 11 1 Y 0 A LYS 271 ? CE ? A LYS 283 CE 12 1 Y 0 A LYS 271 ? NZ ? A LYS 283 NZ # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.20.1_4487 1 ? 'data collection' ? ? ? ? ? ? ? ? ? ? ? MxCuBE ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XSCALE ? ? ? . 3 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 4 ? 'model building' ? ? ? ? ? ? ? ? ? ? ? Coot ? ? ? 0.9.8.1 5 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 6 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 8QOB _cell.details ? _cell.formula_units_Z ? _cell.length_a 145.267 _cell.length_a_esd ? _cell.length_b 145.267 _cell.length_b_esd ? _cell.length_c 145.267 _cell.length_c_esd ? _cell.volume 3065497.055 _cell.volume_esd ? _cell.Z_PDB 24 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 8QOB _symmetry.cell_setting ? _symmetry.Int_Tables_number 199 _symmetry.space_group_name_Hall 'I 2b 2c 3' _symmetry.space_group_name_H-M 'I 21 3' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 8QOB _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 3.92 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 68.66 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 7.0 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details 'Room Temperature' _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details 'PEG 3350, sodium malonate, Bis-Tris propane' _exptl_crystal_grow.pdbx_pH_range 6.5-8.0 _exptl_crystal_grow.temp 293 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER X 9M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2023-04-28 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.980112 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SOLEIL BEAMLINE PROXIMA 2' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.980112 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 'PROXIMA 2' _diffrn_source.pdbx_synchrotron_site SOLEIL # _reflns.B_iso_Wilson_estimate 64.90 _reflns.entry_id 8QOB _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.74 _reflns.d_resolution_low 45.94 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 13539 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.86 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 39.8 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 19.41 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.1837 _reflns.pdbx_Rpim_I_all 0.02917 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.999 _reflns.pdbx_CC_star 1 _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs 0.1814 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 2.74 _reflns_shell.d_res_low 2.84 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 3.64 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 1314 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 39.7 _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all 1.523 _reflns_shell.pdbx_Rpim_I_all 0.2408 _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.891 _reflns_shell.pdbx_CC_star 0.971 _reflns_shell.pdbx_R_split ? _reflns_shell.percent_possible_all 99.03 _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 1.504 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 64.09 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 8QOB _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.74 _refine.ls_d_res_low 45.94 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 13526 _refine.ls_number_reflns_R_free 677 _refine.ls_number_reflns_R_work 12849 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.89 _refine.ls_percent_reflns_R_free 5.01 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1829 _refine.ls_R_factor_R_free 0.2431 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1802 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.35 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values 'GeoStd + Monomer Library + CDL v1.2' _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1000 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 29.6500 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.3827 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 2.74 _refine_hist.d_res_low 45.94 _refine_hist.number_atoms_solvent 93 _refine_hist.number_atoms_total 2298 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 2193 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 12 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.0089 ? 2269 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 1.0842 ? 3081 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.0573 ? 368 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.0089 ? 406 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 8.3918 ? 331 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free _refine_ls_shell.R_factor_R_free 'X-RAY DIFFRACTION' 2.74 2.95 . . 133 2521 99.51 . . . . 0.2616 . . . . . . . . . . . 0.3734 'X-RAY DIFFRACTION' 2.95 3.25 . . 134 2554 100.00 . . . . 0.2281 . . . . . . . . . . . 0.3479 'X-RAY DIFFRACTION' 3.25 3.72 . . 136 2564 100.00 . . . . 0.2105 . . . . . . . . . . . 0.2789 'X-RAY DIFFRACTION' 3.72 4.68 . . 134 2567 99.93 . . . . 0.1651 . . . . . . . . . . . 0.2329 'X-RAY DIFFRACTION' 4.69 45.94 . . 140 2643 100.00 . . . . 0.1507 . . . . . . . . . . . 0.1852 # _struct.entry_id 8QOB _struct.title 'Crystal structure of phosphoserine phosphatase (SerB) from Brucella melitensis in complex with AP3 and magnesium' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 8QOB _struct_keywords.text 'Complex, Inhibitor, Serine biosynthesis, Magnesium cofactor, HYDROLASE' _struct_keywords.pdbx_keywords HYDROLASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? E N N 5 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q8YI30_BRUME _struct_ref.pdbx_db_accession Q8YI30 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;LSMSQQVSLVATLIANPAKAALAPSLGIKASAAVNATGLYWLADDIACDIPLPLGMEASEADASLRATLDGAPIDVVVQE QERRRKKILIADMDSTMIGQECIDELAEEAGLRDHVAAITARAMNGEIAFEPALRERVALLKGLPLSVIDKVISTRITLT PGGPQLVRTMRKHGAYTALVSGGFTSFTRRIAEMIGFNEERANRLIDDGTRLTGTVAEPILGREAKVEKLVEIAERVGLT PEDAIAVGDGANDLGMIQLAGTGVALHAKPAVAAQAKMRIDHGDLTALLYIQGYRKADFVQ ; _struct_ref.pdbx_align_begin 2 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 8QOB _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 7 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 307 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q8YI30 _struct_ref_seq.db_align_beg 2 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 302 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg -5 _struct_ref_seq.pdbx_auth_seq_align_end 295 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 8QOB GLY A 1 ? UNP Q8YI30 ? ? 'expression tag' -11 1 1 8QOB PRO A 2 ? UNP Q8YI30 ? ? 'expression tag' -10 2 1 8QOB GLY A 3 ? UNP Q8YI30 ? ? 'expression tag' -9 3 1 8QOB SER A 4 ? UNP Q8YI30 ? ? 'expression tag' -8 4 1 8QOB MET A 5 ? UNP Q8YI30 ? ? 'expression tag' -7 5 1 8QOB LEU A 6 ? UNP Q8YI30 ? ? 'expression tag' -6 6 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 240 ? 1 MORE -22 ? 1 'SSA (A^2)' 12300 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support SAXS _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ALA A 29 ? VAL A 40 ? ALA A 17 VAL A 28 1 ? 12 HELX_P HELX_P2 AA2 GLU A 63 ? LEU A 75 ? GLU A 51 LEU A 63 1 ? 13 HELX_P HELX_P3 AA3 GLU A 107 ? GLU A 115 ? GLU A 95 GLU A 103 1 ? 9 HELX_P HELX_P4 AA4 LEU A 118 ? ASN A 131 ? LEU A 106 ASN A 119 1 ? 14 HELX_P HELX_P5 AA5 ALA A 135 ? LEU A 146 ? ALA A 123 LEU A 134 1 ? 12 HELX_P HELX_P6 AA6 SER A 153 ? ILE A 163 ? SER A 141 ILE A 151 1 ? 11 HELX_P HELX_P7 AA7 GLY A 168 ? LYS A 178 ? GLY A 156 LYS A 166 1 ? 11 HELX_P HELX_P8 AA8 THR A 191 ? GLY A 202 ? THR A 179 GLY A 190 1 ? 12 HELX_P HELX_P9 AA9 GLY A 228 ? VAL A 243 ? GLY A 216 VAL A 231 1 ? 16 HELX_P HELX_P10 AB1 THR A 246 ? GLU A 248 ? THR A 234 GLU A 236 5 ? 3 HELX_P HELX_P11 AB2 GLY A 256 ? ASN A 258 ? GLY A 244 ASN A 246 5 ? 3 HELX_P HELX_P12 AB3 ASP A 259 ? ALA A 266 ? ASP A 247 ALA A 254 1 ? 8 HELX_P HELX_P13 AB4 LYS A 275 ? ALA A 282 ? LYS A 263 ALA A 270 1 ? 8 HELX_P HELX_P14 AB5 LEU A 291 ? GLN A 298 ? LEU A 279 GLN A 286 1 ? 8 HELX_P HELX_P15 AB6 ARG A 301 ? PHE A 305 ? ARG A 289 PHE A 293 5 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A ASP 98 OD2 ? ? ? 1_555 C MG . MG ? ? A ASP 86 A MG 302 1_555 ? ? ? ? ? ? ? 2.086 ? ? metalc2 metalc ? ? A ASP 100 O ? ? ? 1_555 C MG . MG ? ? A ASP 88 A MG 302 1_555 ? ? ? ? ? ? ? 2.210 ? ? metalc3 metalc ? ? A ASP 255 OD1 ? ? ? 1_555 C MG . MG ? ? A ASP 243 A MG 302 1_555 ? ? ? ? ? ? ? 2.107 ? ? metalc4 metalc ? ? B WHT . O08 ? ? ? 1_555 C MG . MG ? ? A WHT 301 A MG 302 1_555 ? ? ? ? ? ? ? 2.297 ? ? metalc5 metalc ? ? C MG . MG ? ? ? 1_555 E HOH . O ? ? A MG 302 A HOH 402 1_555 ? ? ? ? ? ? ? 2.439 ? ? metalc6 metalc ? ? C MG . MG ? ? ? 1_555 E HOH . O ? ? A MG 302 A HOH 408 1_555 ? ? ? ? ? ? ? 2.131 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OD2 ? A ASP 98 ? A ASP 86 ? 1_555 MG ? C MG . ? A MG 302 ? 1_555 O ? A ASP 100 ? A ASP 88 ? 1_555 82.0 ? 2 OD2 ? A ASP 98 ? A ASP 86 ? 1_555 MG ? C MG . ? A MG 302 ? 1_555 OD1 ? A ASP 255 ? A ASP 243 ? 1_555 86.5 ? 3 O ? A ASP 100 ? A ASP 88 ? 1_555 MG ? C MG . ? A MG 302 ? 1_555 OD1 ? A ASP 255 ? A ASP 243 ? 1_555 100.5 ? 4 OD2 ? A ASP 98 ? A ASP 86 ? 1_555 MG ? C MG . ? A MG 302 ? 1_555 O08 ? B WHT . ? A WHT 301 ? 1_555 81.3 ? 5 O ? A ASP 100 ? A ASP 88 ? 1_555 MG ? C MG . ? A MG 302 ? 1_555 O08 ? B WHT . ? A WHT 301 ? 1_555 92.3 ? 6 OD1 ? A ASP 255 ? A ASP 243 ? 1_555 MG ? C MG . ? A MG 302 ? 1_555 O08 ? B WHT . ? A WHT 301 ? 1_555 160.9 ? 7 OD2 ? A ASP 98 ? A ASP 86 ? 1_555 MG ? C MG . ? A MG 302 ? 1_555 O ? E HOH . ? A HOH 402 ? 1_555 78.3 ? 8 O ? A ASP 100 ? A ASP 88 ? 1_555 MG ? C MG . ? A MG 302 ? 1_555 O ? E HOH . ? A HOH 402 ? 1_555 160.0 ? 9 OD1 ? A ASP 255 ? A ASP 243 ? 1_555 MG ? C MG . ? A MG 302 ? 1_555 O ? E HOH . ? A HOH 402 ? 1_555 81.8 ? 10 O08 ? B WHT . ? A WHT 301 ? 1_555 MG ? C MG . ? A MG 302 ? 1_555 O ? E HOH . ? A HOH 402 ? 1_555 81.4 ? 11 OD2 ? A ASP 98 ? A ASP 86 ? 1_555 MG ? C MG . ? A MG 302 ? 1_555 O ? E HOH . ? A HOH 408 ? 1_555 168.6 ? 12 O ? A ASP 100 ? A ASP 88 ? 1_555 MG ? C MG . ? A MG 302 ? 1_555 O ? E HOH . ? A HOH 408 ? 1_555 97.8 ? 13 OD1 ? A ASP 255 ? A ASP 243 ? 1_555 MG ? C MG . ? A MG 302 ? 1_555 O ? E HOH . ? A HOH 408 ? 1_555 82.3 ? 14 O08 ? B WHT . ? A WHT 301 ? 1_555 MG ? C MG . ? A MG 302 ? 1_555 O ? E HOH . ? A HOH 408 ? 1_555 110.1 ? 15 O ? E HOH . ? A HOH 402 ? 1_555 MG ? C MG . ? A MG 302 ? 1_555 O ? E HOH . ? A HOH 408 ? 1_555 102.2 ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 GLU 224 A . ? GLU 212 A PRO 225 A ? PRO 213 A 1 -6.74 2 GLU 224 A . ? GLU 212 A PRO 225 A ? PRO 213 A 1 5.01 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 4 ? AA2 ? 6 ? AA3 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA2 1 2 ? parallel AA2 2 3 ? parallel AA2 3 4 ? parallel AA2 4 5 ? parallel AA2 5 6 ? parallel AA3 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 TYR A 46 ? ALA A 49 ? TYR A 34 ALA A 37 AA1 2 ALA A 53 ? ILE A 56 ? ALA A 41 ILE A 44 AA1 3 LEU A 15 ? ALA A 21 ? LEU A 3 ALA A 9 AA1 4 ILE A 80 ? GLU A 86 ? ILE A 68 GLU A 74 AA2 1 GLU A 205 ? ASN A 209 ? GLU A 193 ASN A 197 AA2 2 TYR A 182 ? PHE A 190 ? TYR A 170 PHE A 178 AA2 3 ILE A 94 ? ALA A 97 ? ILE A 82 ALA A 85 AA2 4 ALA A 250 ? GLY A 254 ? ALA A 238 GLY A 242 AA2 5 THR A 268 ? LEU A 272 ? THR A 256 LEU A 260 AA2 6 MET A 284 ? ILE A 286 ? MET A 272 ILE A 274 AA3 1 LEU A 211 ? ASP A 213 ? LEU A 199 ASP A 201 AA3 2 LEU A 218 ? VAL A 222 ? LEU A 206 VAL A 210 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N TYR A 46 ? N TYR A 34 O ASP A 55 ? O ASP A 43 AA1 2 3 O ILE A 56 ? O ILE A 44 N ALA A 17 ? N ALA A 5 AA1 3 4 N ILE A 20 ? N ILE A 8 O ASP A 81 ? O ASP A 69 AA2 1 2 O GLU A 205 ? O GLU A 193 N LEU A 185 ? N LEU A 173 AA2 2 3 O ALA A 184 ? O ALA A 172 N LEU A 95 ? N LEU A 83 AA2 3 4 N ILE A 94 ? N ILE A 82 O ILE A 251 ? O ILE A 239 AA2 4 5 N ALA A 252 ? N ALA A 240 O VAL A 270 ? O VAL A 258 AA2 5 6 N ALA A 271 ? N ALA A 259 O MET A 284 ? O MET A 272 AA3 1 2 N ILE A 212 ? N ILE A 200 O THR A 219 ? O THR A 207 # _pdbx_entry_details.entry_id 8QOB _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_protein_modification N # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 O05 _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 WHT _pdbx_validate_close_contact.auth_seq_id_1 301 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 O _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 HOH _pdbx_validate_close_contact.auth_seq_id_2 401 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 2.14 # _pdbx_validate_rmsd_angle.id 1 _pdbx_validate_rmsd_angle.PDB_model_num 1 _pdbx_validate_rmsd_angle.auth_atom_id_1 CA _pdbx_validate_rmsd_angle.auth_asym_id_1 A _pdbx_validate_rmsd_angle.auth_comp_id_1 CYS _pdbx_validate_rmsd_angle.auth_seq_id_1 96 _pdbx_validate_rmsd_angle.PDB_ins_code_1 ? _pdbx_validate_rmsd_angle.label_alt_id_1 B _pdbx_validate_rmsd_angle.auth_atom_id_2 CB _pdbx_validate_rmsd_angle.auth_asym_id_2 A _pdbx_validate_rmsd_angle.auth_comp_id_2 CYS _pdbx_validate_rmsd_angle.auth_seq_id_2 96 _pdbx_validate_rmsd_angle.PDB_ins_code_2 ? _pdbx_validate_rmsd_angle.label_alt_id_2 B _pdbx_validate_rmsd_angle.auth_atom_id_3 SG _pdbx_validate_rmsd_angle.auth_asym_id_3 A _pdbx_validate_rmsd_angle.auth_comp_id_3 CYS _pdbx_validate_rmsd_angle.auth_seq_id_3 96 _pdbx_validate_rmsd_angle.PDB_ins_code_3 ? _pdbx_validate_rmsd_angle.label_alt_id_3 B _pdbx_validate_rmsd_angle.angle_value 123.98 _pdbx_validate_rmsd_angle.angle_target_value 114.20 _pdbx_validate_rmsd_angle.angle_deviation 9.78 _pdbx_validate_rmsd_angle.angle_standard_deviation 1.10 _pdbx_validate_rmsd_angle.linker_flag N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LYS A 13 ? ? -152.55 56.63 2 1 THR A 31 ? ? -85.43 -87.75 3 1 MET A 87 ? ? -91.86 -76.58 4 1 SER A 89 ? ? 67.24 -9.01 5 1 THR A 204 ? ? -135.45 -50.81 6 1 ASP A 278 ? ? -98.25 -159.74 # _pdbx_struct_special_symmetry.id 1 _pdbx_struct_special_symmetry.PDB_model_num 1 _pdbx_struct_special_symmetry.auth_asym_id A _pdbx_struct_special_symmetry.auth_comp_id HOH _pdbx_struct_special_symmetry.auth_seq_id 460 _pdbx_struct_special_symmetry.PDB_ins_code ? _pdbx_struct_special_symmetry.label_asym_id E _pdbx_struct_special_symmetry.label_comp_id HOH _pdbx_struct_special_symmetry.label_seq_id . # loop_ _space_group_symop.id _space_group_symop.operation_xyz 1 x,y,z 2 z,x,y 3 y,z,x 4 -y,-z+1/2,x 5 z,-x,-y+1/2 6 -y+1/2,z,-x 7 -z,-x+1/2,y 8 -z+1/2,x,-y 9 y,-z,-x+1/2 10 x,-y,-z+1/2 11 -x+1/2,y,-z 12 -x,-y+1/2,z 13 x+1/2,y+1/2,z+1/2 14 z+1/2,x+1/2,y+1/2 15 y+1/2,z+1/2,x+1/2 16 -y+1/2,-z+1,x+1/2 17 z+1/2,-x+1/2,-y+1 18 -y+1,z+1/2,-x+1/2 19 -z+1/2,-x+1,y+1/2 20 -z+1,x+1/2,-y+1/2 21 y+1/2,-z+1/2,-x+1 22 x+1/2,-y+1/2,-z+1 23 -x+1,y+1/2,-z+1/2 24 -x+1/2,-y+1,z+1/2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY -11 ? A GLY 1 2 1 Y 1 A PRO -10 ? A PRO 2 3 1 Y 1 A GLY -9 ? A GLY 3 4 1 Y 1 A SER -8 ? A SER 4 5 1 Y 1 A MET -7 ? A MET 5 6 1 Y 1 A LEU -6 ? A LEU 6 7 1 Y 1 A LEU -5 ? A LEU 7 8 1 Y 1 A SER -4 ? A SER 8 9 1 Y 1 A MET -3 ? A MET 9 10 1 Y 1 A SER -2 ? A SER 10 11 1 Y 1 A GLN -1 ? A GLN 11 12 1 Y 1 A GLN 0 ? A GLN 12 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CL CL CL N N 74 CYS N N N N 75 CYS CA C N R 76 CYS C C N N 77 CYS O O N N 78 CYS CB C N N 79 CYS SG S N N 80 CYS OXT O N N 81 CYS H H N N 82 CYS H2 H N N 83 CYS HA H N N 84 CYS HB2 H N N 85 CYS HB3 H N N 86 CYS HG H N N 87 CYS HXT H N N 88 GLN N N N N 89 GLN CA C N S 90 GLN C C N N 91 GLN O O N N 92 GLN CB C N N 93 GLN CG C N N 94 GLN CD C N N 95 GLN OE1 O N N 96 GLN NE2 N N N 97 GLN OXT O N N 98 GLN H H N N 99 GLN H2 H N N 100 GLN HA H N N 101 GLN HB2 H N N 102 GLN HB3 H N N 103 GLN HG2 H N N 104 GLN HG3 H N N 105 GLN HE21 H N N 106 GLN HE22 H N N 107 GLN HXT H N N 108 GLU N N N N 109 GLU CA C N S 110 GLU C C N N 111 GLU O O N N 112 GLU CB C N N 113 GLU CG C N N 114 GLU CD C N N 115 GLU OE1 O N N 116 GLU OE2 O N N 117 GLU OXT O N N 118 GLU H H N N 119 GLU H2 H N N 120 GLU HA H N N 121 GLU HB2 H N N 122 GLU HB3 H N N 123 GLU HG2 H N N 124 GLU HG3 H N N 125 GLU HE2 H N N 126 GLU HXT H N N 127 GLY N N N N 128 GLY CA C N N 129 GLY C C N N 130 GLY O O N N 131 GLY OXT O N N 132 GLY H H N N 133 GLY H2 H N N 134 GLY HA2 H N N 135 GLY HA3 H N N 136 GLY HXT H N N 137 HIS N N N N 138 HIS CA C N S 139 HIS C C N N 140 HIS O O N N 141 HIS CB C N N 142 HIS CG C Y N 143 HIS ND1 N Y N 144 HIS CD2 C Y N 145 HIS CE1 C Y N 146 HIS NE2 N Y N 147 HIS OXT O N N 148 HIS H H N N 149 HIS H2 H N N 150 HIS HA H N N 151 HIS HB2 H N N 152 HIS HB3 H N N 153 HIS HD1 H N N 154 HIS HD2 H N N 155 HIS HE1 H N N 156 HIS HE2 H N N 157 HIS HXT H N N 158 HOH O O N N 159 HOH H1 H N N 160 HOH H2 H N N 161 ILE N N N N 162 ILE CA C N S 163 ILE C C N N 164 ILE O O N N 165 ILE CB C N S 166 ILE CG1 C N N 167 ILE CG2 C N N 168 ILE CD1 C N N 169 ILE OXT O N N 170 ILE H H N N 171 ILE H2 H N N 172 ILE HA H N N 173 ILE HB H N N 174 ILE HG12 H N N 175 ILE HG13 H N N 176 ILE HG21 H N N 177 ILE HG22 H N N 178 ILE HG23 H N N 179 ILE HD11 H N N 180 ILE HD12 H N N 181 ILE HD13 H N N 182 ILE HXT H N N 183 LEU N N N N 184 LEU CA C N S 185 LEU C C N N 186 LEU O O N N 187 LEU CB C N N 188 LEU CG C N N 189 LEU CD1 C N N 190 LEU CD2 C N N 191 LEU OXT O N N 192 LEU H H N N 193 LEU H2 H N N 194 LEU HA H N N 195 LEU HB2 H N N 196 LEU HB3 H N N 197 LEU HG H N N 198 LEU HD11 H N N 199 LEU HD12 H N N 200 LEU HD13 H N N 201 LEU HD21 H N N 202 LEU HD22 H N N 203 LEU HD23 H N N 204 LEU HXT H N N 205 LYS N N N N 206 LYS CA C N S 207 LYS C C N N 208 LYS O O N N 209 LYS CB C N N 210 LYS CG C N N 211 LYS CD C N N 212 LYS CE C N N 213 LYS NZ N N N 214 LYS OXT O N N 215 LYS H H N N 216 LYS H2 H N N 217 LYS HA H N N 218 LYS HB2 H N N 219 LYS HB3 H N N 220 LYS HG2 H N N 221 LYS HG3 H N N 222 LYS HD2 H N N 223 LYS HD3 H N N 224 LYS HE2 H N N 225 LYS HE3 H N N 226 LYS HZ1 H N N 227 LYS HZ2 H N N 228 LYS HZ3 H N N 229 LYS HXT H N N 230 MET N N N N 231 MET CA C N S 232 MET C C N N 233 MET O O N N 234 MET CB C N N 235 MET CG C N N 236 MET SD S N N 237 MET CE C N N 238 MET OXT O N N 239 MET H H N N 240 MET H2 H N N 241 MET HA H N N 242 MET HB2 H N N 243 MET HB3 H N N 244 MET HG2 H N N 245 MET HG3 H N N 246 MET HE1 H N N 247 MET HE2 H N N 248 MET HE3 H N N 249 MET HXT H N N 250 MG MG MG N N 251 PHE N N N N 252 PHE CA C N S 253 PHE C C N N 254 PHE O O N N 255 PHE CB C N N 256 PHE CG C Y N 257 PHE CD1 C Y N 258 PHE CD2 C Y N 259 PHE CE1 C Y N 260 PHE CE2 C Y N 261 PHE CZ C Y N 262 PHE OXT O N N 263 PHE H H N N 264 PHE H2 H N N 265 PHE HA H N N 266 PHE HB2 H N N 267 PHE HB3 H N N 268 PHE HD1 H N N 269 PHE HD2 H N N 270 PHE HE1 H N N 271 PHE HE2 H N N 272 PHE HZ H N N 273 PHE HXT H N N 274 PRO N N N N 275 PRO CA C N S 276 PRO C C N N 277 PRO O O N N 278 PRO CB C N N 279 PRO CG C N N 280 PRO CD C N N 281 PRO OXT O N N 282 PRO H H N N 283 PRO HA H N N 284 PRO HB2 H N N 285 PRO HB3 H N N 286 PRO HG2 H N N 287 PRO HG3 H N N 288 PRO HD2 H N N 289 PRO HD3 H N N 290 PRO HXT H N N 291 SER N N N N 292 SER CA C N S 293 SER C C N N 294 SER O O N N 295 SER CB C N N 296 SER OG O N N 297 SER OXT O N N 298 SER H H N N 299 SER H2 H N N 300 SER HA H N N 301 SER HB2 H N N 302 SER HB3 H N N 303 SER HG H N N 304 SER HXT H N N 305 THR N N N N 306 THR CA C N S 307 THR C C N N 308 THR O O N N 309 THR CB C N R 310 THR OG1 O N N 311 THR CG2 C N N 312 THR OXT O N N 313 THR H H N N 314 THR H2 H N N 315 THR HA H N N 316 THR HB H N N 317 THR HG1 H N N 318 THR HG21 H N N 319 THR HG22 H N N 320 THR HG23 H N N 321 THR HXT H N N 322 TRP N N N N 323 TRP CA C N S 324 TRP C C N N 325 TRP O O N N 326 TRP CB C N N 327 TRP CG C Y N 328 TRP CD1 C Y N 329 TRP CD2 C Y N 330 TRP NE1 N Y N 331 TRP CE2 C Y N 332 TRP CE3 C Y N 333 TRP CZ2 C Y N 334 TRP CZ3 C Y N 335 TRP CH2 C Y N 336 TRP OXT O N N 337 TRP H H N N 338 TRP H2 H N N 339 TRP HA H N N 340 TRP HB2 H N N 341 TRP HB3 H N N 342 TRP HD1 H N N 343 TRP HE1 H N N 344 TRP HE3 H N N 345 TRP HZ2 H N N 346 TRP HZ3 H N N 347 TRP HH2 H N N 348 TRP HXT H N N 349 TYR N N N N 350 TYR CA C N S 351 TYR C C N N 352 TYR O O N N 353 TYR CB C N N 354 TYR CG C Y N 355 TYR CD1 C Y N 356 TYR CD2 C Y N 357 TYR CE1 C Y N 358 TYR CE2 C Y N 359 TYR CZ C Y N 360 TYR OH O N N 361 TYR OXT O N N 362 TYR H H N N 363 TYR H2 H N N 364 TYR HA H N N 365 TYR HB2 H N N 366 TYR HB3 H N N 367 TYR HD1 H N N 368 TYR HD2 H N N 369 TYR HE1 H N N 370 TYR HE2 H N N 371 TYR HH H N N 372 TYR HXT H N N 373 VAL N N N N 374 VAL CA C N S 375 VAL C C N N 376 VAL O O N N 377 VAL CB C N N 378 VAL CG1 C N N 379 VAL CG2 C N N 380 VAL OXT O N N 381 VAL H H N N 382 VAL H2 H N N 383 VAL HA H N N 384 VAL HB H N N 385 VAL HG11 H N N 386 VAL HG12 H N N 387 VAL HG13 H N N 388 VAL HG21 H N N 389 VAL HG22 H N N 390 VAL HG23 H N N 391 VAL HXT H N N 392 WHT C01 C N N 393 WHT C02 C N R 394 WHT C03 C N N 395 WHT N06 N N N 396 WHT O04 O N N 397 WHT O05 O N N 398 WHT O08 O N N 399 WHT O09 O N N 400 WHT O10 O N N 401 WHT P07 P N N 402 WHT H012 H N N 403 WHT H011 H N N 404 WHT H021 H N N 405 WHT H061 H N N 406 WHT H062 H N N 407 WHT H2 H N N 408 WHT H3 H N N 409 WHT H4 H N N 410 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MET N CA sing N N 218 MET N H sing N N 219 MET N H2 sing N N 220 MET CA C sing N N 221 MET CA CB sing N N 222 MET CA HA sing N N 223 MET C O doub N N 224 MET C OXT sing N N 225 MET CB CG sing N N 226 MET CB HB2 sing N N 227 MET CB HB3 sing N N 228 MET CG SD sing N N 229 MET CG HG2 sing N N 230 MET CG HG3 sing N N 231 MET SD CE sing N N 232 MET CE HE1 sing N N 233 MET CE HE2 sing N N 234 MET CE HE3 sing N N 235 MET OXT HXT sing N N 236 PHE N CA sing N N 237 PHE N H sing N N 238 PHE N H2 sing N N 239 PHE CA C sing N N 240 PHE CA CB sing N N 241 PHE CA HA sing N N 242 PHE C O doub N N 243 PHE C OXT sing N N 244 PHE CB CG sing N N 245 PHE CB HB2 sing N N 246 PHE CB HB3 sing N N 247 PHE CG CD1 doub Y N 248 PHE CG CD2 sing Y N 249 PHE CD1 CE1 sing Y N 250 PHE CD1 HD1 sing N N 251 PHE CD2 CE2 doub Y N 252 PHE CD2 HD2 sing N N 253 PHE CE1 CZ doub Y N 254 PHE CE1 HE1 sing N N 255 PHE CE2 CZ sing Y N 256 PHE CE2 HE2 sing N N 257 PHE CZ HZ sing N N 258 PHE OXT HXT sing N N 259 PRO N CA sing N N 260 PRO N CD sing N N 261 PRO N H sing N N 262 PRO CA C sing N N 263 PRO CA CB sing N N 264 PRO CA HA sing N N 265 PRO C O doub N N 266 PRO C OXT sing N N 267 PRO CB CG sing N N 268 PRO CB HB2 sing N N 269 PRO CB HB3 sing N N 270 PRO CG CD sing N N 271 PRO CG HG2 sing N N 272 PRO CG HG3 sing N N 273 PRO CD HD2 sing N N 274 PRO CD HD3 sing N N 275 PRO OXT HXT sing N N 276 SER N CA sing N N 277 SER N H sing N N 278 SER N H2 sing N N 279 SER CA C sing N N 280 SER CA CB sing N N 281 SER CA HA sing N N 282 SER C O doub N N 283 SER C OXT sing N N 284 SER CB OG sing N N 285 SER CB HB2 sing N N 286 SER CB HB3 sing N N 287 SER OG HG sing N N 288 SER OXT HXT sing N N 289 THR N CA sing N N 290 THR N H sing N N 291 THR N H2 sing N N 292 THR CA C sing N N 293 THR CA CB sing N N 294 THR CA HA sing N N 295 THR C O doub N N 296 THR C OXT sing N N 297 THR CB OG1 sing N N 298 THR CB CG2 sing N N 299 THR CB HB sing N N 300 THR OG1 HG1 sing N N 301 THR CG2 HG21 sing N N 302 THR CG2 HG22 sing N N 303 THR CG2 HG23 sing N N 304 THR OXT HXT sing N N 305 TRP N CA sing N N 306 TRP N H sing N N 307 TRP N H2 sing N N 308 TRP CA C sing N N 309 TRP CA CB sing N N 310 TRP CA HA sing N N 311 TRP C O doub N N 312 TRP C OXT sing N N 313 TRP CB CG sing N N 314 TRP CB HB2 sing N N 315 TRP CB HB3 sing N N 316 TRP CG CD1 doub Y N 317 TRP CG CD2 sing Y N 318 TRP CD1 NE1 sing Y N 319 TRP CD1 HD1 sing N N 320 TRP CD2 CE2 doub Y N 321 TRP CD2 CE3 sing Y N 322 TRP NE1 CE2 sing Y N 323 TRP NE1 HE1 sing N N 324 TRP CE2 CZ2 sing Y N 325 TRP CE3 CZ3 doub Y N 326 TRP CE3 HE3 sing N N 327 TRP CZ2 CH2 doub Y N 328 TRP CZ2 HZ2 sing N N 329 TRP CZ3 CH2 sing Y N 330 TRP CZ3 HZ3 sing N N 331 TRP CH2 HH2 sing N N 332 TRP OXT HXT sing N N 333 TYR N CA sing N N 334 TYR N H sing N N 335 TYR N H2 sing N N 336 TYR CA C sing N N 337 TYR CA CB sing N N 338 TYR CA HA sing N N 339 TYR C O doub N N 340 TYR C OXT sing N N 341 TYR CB CG sing N N 342 TYR CB HB2 sing N N 343 TYR CB HB3 sing N N 344 TYR CG CD1 doub Y N 345 TYR CG CD2 sing Y N 346 TYR CD1 CE1 sing Y N 347 TYR CD1 HD1 sing N N 348 TYR CD2 CE2 doub Y N 349 TYR CD2 HD2 sing N N 350 TYR CE1 CZ doub Y N 351 TYR CE1 HE1 sing N N 352 TYR CE2 CZ sing Y N 353 TYR CE2 HE2 sing N N 354 TYR CZ OH sing N N 355 TYR OH HH sing N N 356 TYR OXT HXT sing N N 357 VAL N CA sing N N 358 VAL N H sing N N 359 VAL N H2 sing N N 360 VAL CA C sing N N 361 VAL CA CB sing N N 362 VAL CA HA sing N N 363 VAL C O doub N N 364 VAL C OXT sing N N 365 VAL CB CG1 sing N N 366 VAL CB CG2 sing N N 367 VAL CB HB sing N N 368 VAL CG1 HG11 sing N N 369 VAL CG1 HG12 sing N N 370 VAL CG1 HG13 sing N N 371 VAL CG2 HG21 sing N N 372 VAL CG2 HG22 sing N N 373 VAL CG2 HG23 sing N N 374 VAL OXT HXT sing N N 375 WHT O04 C03 doub N N 376 WHT O05 C03 sing N N 377 WHT C03 C02 sing N N 378 WHT N06 C02 sing N N 379 WHT C02 C01 sing N N 380 WHT P07 C01 sing N N 381 WHT O08 P07 doub N N 382 WHT O09 P07 sing N N 383 WHT O10 P07 sing N N 384 WHT C01 H012 sing N N 385 WHT C01 H011 sing N N 386 WHT C02 H021 sing N N 387 WHT N06 H061 sing N N 388 WHT N06 H062 sing N N 389 WHT O05 H2 sing N N 390 WHT O09 H3 sing N N 391 WHT O10 H4 sing N N 392 # _pdbx_audit_support.funding_organization 'Not funded' _pdbx_audit_support.country ? _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 7QPL _pdbx_initial_refinement_model.details ? # _space_group.name_H-M_alt 'I 21 3' _space_group.name_Hall 'I 2b 2c 3' _space_group.IT_number 199 _space_group.crystal_system cubic _space_group.id 1 # _atom_sites.entry_id 8QOB _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 0.006884 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.006884 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.006884 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.scat_dispersion_real _atom_type.scat_dispersion_imag _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c _atom_type.scat_source _atom_type.scat_dispersion_source C ? ? 3.54356 2.42580 ? ? 25.62398 1.50364 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? CL ? ? 9.50761 7.44341 ? ? 1.04373 23.83732 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? MG ? ? 9.41153 2.53737 ? ? 2.59044 63.03566 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? N ? ? 4.01032 2.96436 ? ? 19.97189 1.75589 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O ? ? 7.96527 ? ? ? 9.05267 ? ? ? 0.0 ;1-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? P ? ? 9.51135 5.44231 ? ? 1.42069 35.72801 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? S ? ? 9.55732 6.39887 ? ? 1.23737 29.19336 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? # loop_ #