data_8QRX
# 
_entry.id   8QRX 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.395 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   8QRX         pdb_00008qrx 10.2210/pdb8qrx/pdb 
WWPDB D_1292133649 ?            ?                   
BMRB  34869        ?            10.13018/BMR34869   
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2024-06-26 
2 'Structure model' 1 1 2024-07-03 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
_pdbx_audit_revision_group.ordinal             1 
_pdbx_audit_revision_group.revision_ordinal    2 
_pdbx_audit_revision_group.data_content_type   'Structure model' 
_pdbx_audit_revision_group.group               'Database references' 
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 2 'Structure model' citation        
2 2 'Structure model' citation_author 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  2 'Structure model' '_citation.country'                 
2  2 'Structure model' '_citation.journal_abbrev'          
3  2 'Structure model' '_citation.journal_id_CSD'          
4  2 'Structure model' '_citation.journal_id_ISSN'         
5  2 'Structure model' '_citation.journal_volume'          
6  2 'Structure model' '_citation.page_first'              
7  2 'Structure model' '_citation.page_last'               
8  2 'Structure model' '_citation.pdbx_database_id_DOI'    
9  2 'Structure model' '_citation.pdbx_database_id_PubMed' 
10 2 'Structure model' '_citation.title'                   
11 2 'Structure model' '_citation.year'                    
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  . 
_pdbx_database_status.entry_id                        8QRX 
_pdbx_database_status.recvd_initial_deposition_date   2023-10-09 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.status_code_cs                  . 
_pdbx_database_status.status_code_nmr_data            REL 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
_pdbx_database_related.db_name        BMRB 
_pdbx_database_related.details        
;Solution NMR structure of the peptidyl carrier domain TomAPCP from the Tomaymycin non-ribosomal peptide synthetase in its substrate-loaded state
;
_pdbx_database_related.db_id          34869 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_contact_author.id                 2 
_pdbx_contact_author.email              t.carlomagno@bham.ac.uk 
_pdbx_contact_author.name_first         Teresa 
_pdbx_contact_author.name_last          Carlomagno 
_pdbx_contact_author.name_mi            ? 
_pdbx_contact_author.role               'principal investigator/group leader' 
_pdbx_contact_author.identifier_ORCID   0000-0002-2437-2760 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Karanth, M.N.'     1 0000-0003-3392-6523 
'Kirkpatrick, J.P.' 2 0000-0002-9761-3377 
'Carlomagno, T.'    3 0000-0002-2437-2760 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'Sci Adv' 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            ? 
_citation.journal_id_ISSN           2375-2548 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            10 
_citation.language                  ? 
_citation.page_first                eadm9404 
_citation.page_last                 eadm9404 
_citation.title                     
'The specificity of intermodular recognition in a prototypical nonribosomal peptide synthetase depends on an adaptor domain.' 
_citation.year                      2024 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1126/sciadv.adm9404 
_citation.pdbx_database_id_PubMed   38896613 
_citation.pdbx_database_id_patent   ? 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Karanth, M.N.'     1 0000-0003-3392-6523 
primary 'Kirkpatrick, J.P.' 2 0000-0002-9761-3377 
primary 'Krausze, J.'       3 0000-0001-5333-8046 
primary 'Schmelz, S.'       4 0000-0002-2511-7593 
primary 'Scrima, A.'        5 0000-0003-2760-611X 
primary 'Carlomagno, T.'    6 0000-0002-2437-2760 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           'TomAPCP substrate-loaded from the Tomaymycin non-ribosomal peptide synthetase' 
_entity.formula_weight             10483.499 
_entity.pdbx_number_of_molecules   1 
_entity.pdbx_ec                    ? 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              ? 
_entity.details                    
;First four residues (GPMA) in the protein are from cloning artifacts. Therefore, the appropriate residue numbering has the first residue (G) designated as residue-number '-3', so that the fifth residue has residue-number '1'. A special modified residue SPA is designated for the serine residue covalently linked to a 4'-phosphopantetheine-anthranilate prosthetic group.
;
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   yes 
_entity_poly.pdbx_seq_one_letter_code       
;GPMATAVQNPLETVVLQAWKDISGADDFTTTDSFLGHGGN(WP9)LHFVQLASRLQKIFGVEVSTEDVFRHGTVEQLARF
VEQSRDTGRNPAAQTQ
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GPMATAVQNPLETVVLQAWKDISGADDFTTTDSFLGHGGNXLHFVQLASRLQKIFGVEVSTEDVFRHGTVEQLARFVEQS
RDTGRNPAAQTQ
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  GLY n 
1 2  PRO n 
1 3  MET n 
1 4  ALA n 
1 5  THR n 
1 6  ALA n 
1 7  VAL n 
1 8  GLN n 
1 9  ASN n 
1 10 PRO n 
1 11 LEU n 
1 12 GLU n 
1 13 THR n 
1 14 VAL n 
1 15 VAL n 
1 16 LEU n 
1 17 GLN n 
1 18 ALA n 
1 19 TRP n 
1 20 LYS n 
1 21 ASP n 
1 22 ILE n 
1 23 SER n 
1 24 GLY n 
1 25 ALA n 
1 26 ASP n 
1 27 ASP n 
1 28 PHE n 
1 29 THR n 
1 30 THR n 
1 31 THR n 
1 32 ASP n 
1 33 SER n 
1 34 PHE n 
1 35 LEU n 
1 36 GLY n 
1 37 HIS n 
1 38 GLY n 
1 39 GLY n 
1 40 ASN n 
1 41 WP9 n 
1 42 LEU n 
1 43 HIS n 
1 44 PHE n 
1 45 VAL n 
1 46 GLN n 
1 47 LEU n 
1 48 ALA n 
1 49 SER n 
1 50 ARG n 
1 51 LEU n 
1 52 GLN n 
1 53 LYS n 
1 54 ILE n 
1 55 PHE n 
1 56 GLY n 
1 57 VAL n 
1 58 GLU n 
1 59 VAL n 
1 60 SER n 
1 61 THR n 
1 62 GLU n 
1 63 ASP n 
1 64 VAL n 
1 65 PHE n 
1 66 ARG n 
1 67 HIS n 
1 68 GLY n 
1 69 THR n 
1 70 VAL n 
1 71 GLU n 
1 72 GLN n 
1 73 LEU n 
1 74 ALA n 
1 75 ARG n 
1 76 PHE n 
1 77 VAL n 
1 78 GLU n 
1 79 GLN n 
1 80 SER n 
1 81 ARG n 
1 82 ASP n 
1 83 THR n 
1 84 GLY n 
1 85 ARG n 
1 86 ASN n 
1 87 PRO n 
1 88 ALA n 
1 89 ALA n 
1 90 GLN n 
1 91 THR n 
1 92 GLN n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   92 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Streptomyces regensis' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     68263 
_entity_src_gen.pdbx_gene_src_variant              FH6421 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'        133.103 
GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE ? 'C2 H5 N O2'        75.067  
HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1'    156.162 
ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S'     149.211 
PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3'        105.093 
THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2'     204.225 
VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2'       117.146 
WP9 non-polymer         . 
;~{S}-[2-[3-[[(2~{R})-4-[[(2~{S})-2-azanyl-3-oxidanylidene-propoxy]-oxidanyl-phosphoryl]oxy-3,3-dimethyl-2-oxidanyl-butanoyl]amino]propanoylamino]ethyl] 2-azanylbenzenecarbothioate
;
? 'C21 H33 N4 O9 P S' 548.547 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  GLY 1  -3 -3 GLY GLY A . n 
A 1 2  PRO 2  -2 -2 PRO PRO A . n 
A 1 3  MET 3  -1 -1 MET MET A . n 
A 1 4  ALA 4  0  0  ALA ALA A . n 
A 1 5  THR 5  1  1  THR THR A . n 
A 1 6  ALA 6  2  2  ALA ALA A . n 
A 1 7  VAL 7  3  3  VAL VAL A . n 
A 1 8  GLN 8  4  4  GLN GLN A . n 
A 1 9  ASN 9  5  5  ASN ASN A . n 
A 1 10 PRO 10 6  6  PRO PRO A . n 
A 1 11 LEU 11 7  7  LEU LEU A . n 
A 1 12 GLU 12 8  8  GLU GLU A . n 
A 1 13 THR 13 9  9  THR THR A . n 
A 1 14 VAL 14 10 10 VAL VAL A . n 
A 1 15 VAL 15 11 11 VAL VAL A . n 
A 1 16 LEU 16 12 12 LEU LEU A . n 
A 1 17 GLN 17 13 13 GLN GLN A . n 
A 1 18 ALA 18 14 14 ALA ALA A . n 
A 1 19 TRP 19 15 15 TRP TRP A . n 
A 1 20 LYS 20 16 16 LYS LYS A . n 
A 1 21 ASP 21 17 17 ASP ASP A . n 
A 1 22 ILE 22 18 18 ILE ILE A . n 
A 1 23 SER 23 19 19 SER SER A . n 
A 1 24 GLY 24 20 20 GLY GLY A . n 
A 1 25 ALA 25 21 21 ALA ALA A . n 
A 1 26 ASP 26 22 22 ASP ASP A . n 
A 1 27 ASP 27 23 23 ASP ASP A . n 
A 1 28 PHE 28 24 24 PHE PHE A . n 
A 1 29 THR 29 25 25 THR THR A . n 
A 1 30 THR 30 26 26 THR THR A . n 
A 1 31 THR 31 27 27 THR THR A . n 
A 1 32 ASP 32 28 28 ASP ASP A . n 
A 1 33 SER 33 29 29 SER SER A . n 
A 1 34 PHE 34 30 30 PHE PHE A . n 
A 1 35 LEU 35 31 31 LEU LEU A . n 
A 1 36 GLY 36 32 32 GLY GLY A . n 
A 1 37 HIS 37 33 33 HIS HIS A . n 
A 1 38 GLY 38 34 34 GLY GLY A . n 
A 1 39 GLY 39 35 35 GLY GLY A . n 
A 1 40 ASN 40 36 36 ASN ASN A . n 
A 1 41 WP9 41 37 37 WP9 SPA A . n 
A 1 42 LEU 42 38 38 LEU LEU A . n 
A 1 43 HIS 43 39 39 HIS HIS A . n 
A 1 44 PHE 44 40 40 PHE PHE A . n 
A 1 45 VAL 45 41 41 VAL VAL A . n 
A 1 46 GLN 46 42 42 GLN GLN A . n 
A 1 47 LEU 47 43 43 LEU LEU A . n 
A 1 48 ALA 48 44 44 ALA ALA A . n 
A 1 49 SER 49 45 45 SER SER A . n 
A 1 50 ARG 50 46 46 ARG ARG A . n 
A 1 51 LEU 51 47 47 LEU LEU A . n 
A 1 52 GLN 52 48 48 GLN GLN A . n 
A 1 53 LYS 53 49 49 LYS LYS A . n 
A 1 54 ILE 54 50 50 ILE ILE A . n 
A 1 55 PHE 55 51 51 PHE PHE A . n 
A 1 56 GLY 56 52 52 GLY GLY A . n 
A 1 57 VAL 57 53 53 VAL VAL A . n 
A 1 58 GLU 58 54 54 GLU GLU A . n 
A 1 59 VAL 59 55 55 VAL VAL A . n 
A 1 60 SER 60 56 56 SER SER A . n 
A 1 61 THR 61 57 57 THR THR A . n 
A 1 62 GLU 62 58 58 GLU GLU A . n 
A 1 63 ASP 63 59 59 ASP ASP A . n 
A 1 64 VAL 64 60 60 VAL VAL A . n 
A 1 65 PHE 65 61 61 PHE PHE A . n 
A 1 66 ARG 66 62 62 ARG ARG A . n 
A 1 67 HIS 67 63 63 HIS HIS A . n 
A 1 68 GLY 68 64 64 GLY GLY A . n 
A 1 69 THR 69 65 65 THR THR A . n 
A 1 70 VAL 70 66 66 VAL VAL A . n 
A 1 71 GLU 71 67 67 GLU GLU A . n 
A 1 72 GLN 72 68 68 GLN GLN A . n 
A 1 73 LEU 73 69 69 LEU LEU A . n 
A 1 74 ALA 74 70 70 ALA ALA A . n 
A 1 75 ARG 75 71 71 ARG ARG A . n 
A 1 76 PHE 76 72 72 PHE PHE A . n 
A 1 77 VAL 77 73 73 VAL VAL A . n 
A 1 78 GLU 78 74 74 GLU GLU A . n 
A 1 79 GLN 79 75 75 GLN GLN A . n 
A 1 80 SER 80 76 76 SER SER A . n 
A 1 81 ARG 81 77 77 ARG ARG A . n 
A 1 82 ASP 82 78 78 ASP ASP A . n 
A 1 83 THR 83 79 79 THR THR A . n 
A 1 84 GLY 84 80 80 GLY GLY A . n 
A 1 85 ARG 85 81 81 ARG ARG A . n 
A 1 86 ASN 86 82 82 ASN ASN A . n 
A 1 87 PRO 87 83 83 PRO PRO A . n 
A 1 88 ALA 88 84 84 ALA ALA A . n 
A 1 89 ALA 89 85 85 ALA ALA A . n 
A 1 90 GLN 90 86 86 GLN GLN A . n 
A 1 91 THR 91 87 87 THR THR A . n 
A 1 92 GLN 92 88 88 GLN GLN A . n 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   8QRX 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.method                     'SOLUTION NMR' 
_exptl.method_details             ? 
# 
_struct.entry_id                     8QRX 
_struct.title                        
;Solution NMR structure of the peptidyl carrier domain TomAPCP from the Tomaymycin non-ribosomal peptide synthetase in its substrate-loaded state
;
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        8QRX 
_struct_keywords.text            
;Non-ribosomal peptide synthetase, NRPS, Tomaymycin, Peptidyl carrier protein, PCP, phosphopantetheine, Donor, loaded, substrate-loaded, BIOSYNTHETIC PROTEIN
;
_struct_keywords.pdbx_keywords   'BIOSYNTHETIC PROTEIN' 
# 
_struct_asym.id                            A 
_struct_asym.pdbx_blank_PDB_chainid_flag   N 
_struct_asym.pdbx_modified                 N 
_struct_asym.entity_id                     1 
_struct_asym.details                       ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    PDB 
_struct_ref.db_code                    8QRX 
_struct_ref.pdbx_db_accession          8QRX 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_align_begin           1 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              8QRX 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 92 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             8QRX 
_struct_ref_seq.db_align_beg                  -3 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  88 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       -3 
_struct_ref_seq.pdbx_auth_seq_align_end       88 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A 
# 
_pdbx_struct_assembly_auth_evidence.id                     1 
_pdbx_struct_assembly_auth_evidence.assembly_id            1 
_pdbx_struct_assembly_auth_evidence.experimental_support   'gel filtration' 
_pdbx_struct_assembly_auth_evidence.details                'not applicable' 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   ? 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 AA1 LEU A 11 ? SER A 23 ? LEU A 7  SER A 19 1 ? 13 
HELX_P HELX_P2 AA2 WP9 A 41 ? PHE A 55 ? WP9 A 37 PHE A 51 1 ? 15 
HELX_P HELX_P3 AA3 THR A 61 ? HIS A 67 ? THR A 57 HIS A 63 1 ? 7  
HELX_P HELX_P4 AA4 VAL A 70 ? THR A 83 ? VAL A 66 THR A 79 1 ? 14 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
covale1 covale one ? A ASN 40 C ? ? ? 1_555 A WP9 41 N ? ? A ASN 36 A WP9 37 1_555 ? ? ? ? ? ? ? 1.327 ? ? 
covale2 covale one ? A WP9 41 C ? ? ? 1_555 A LEU 42 N ? ? A WP9 37 A LEU 38 1_555 ? ? ? ? ? ? ? 1.327 ? ? 
# 
_struct_conn_type.id          covale 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 3 OD1 A ASP 28 ? ? HD1 A HIS 33 ? ? 1.59 
2 5 HG1 A THR 25 ? ? OD2 A ASP 28 ? ? 1.57 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1  PRO A -2 ? ? -58.62  108.64  
2  1  ASN A 82 ? ? 60.27   85.16   
3  2  ALA A 2  ? ? -164.27 48.64   
4  2  THR A 87 ? ? -153.74 -71.87  
5  3  MET A -1 ? ? 74.00   -61.72  
6  3  ALA A 2  ? ? -161.89 104.33  
7  4  GLN A 4  ? ? -109.94 60.68   
8  4  ASN A 5  ? ? 63.65   72.28   
9  4  ARG A 81 ? ? -121.58 -53.85  
10 4  ASN A 82 ? ? 54.17   81.40   
11 5  ALA A 0  ? ? 69.73   146.96  
12 5  THR A 1  ? ? 74.60   -51.71  
13 5  ALA A 2  ? ? -99.97  44.45   
14 5  ALA A 85 ? ? -99.40  41.70   
15 6  ALA A 0  ? ? 179.84  -74.15  
16 6  ALA A 2  ? ? 63.32   -175.92 
17 6  GLN A 4  ? ? -139.46 -60.54  
18 7  ASN A 5  ? ? -164.97 65.38   
19 7  THR A 87 ? ? 74.10   -65.35  
20 8  THR A 1  ? ? -107.85 -70.48  
21 8  PRO A 6  ? ? -79.77  -117.58 
22 8  ALA A 84 ? ? -54.04  102.06  
23 9  ASP A 23 ? ? -90.03  30.54   
24 9  ASN A 82 ? ? 68.64   121.84  
25 9  ALA A 85 ? ? 66.19   120.43  
26 9  GLN A 86 ? ? 62.79   -161.52 
27 9  THR A 87 ? ? 70.17   33.76   
28 10 THR A 1  ? ? 67.60   86.67   
29 10 GLN A 4  ? ? 69.05   -83.84  
30 10 PRO A 6  ? ? -60.37  -77.55  
31 10 ASN A 82 ? ? 71.93   120.57  
# 
_pdbx_entry_details.entry_id                   8QRX 
_pdbx_entry_details.nonpolymer_details         ? 
_pdbx_entry_details.sequence_details           ? 
_pdbx_entry_details.compound_details           ? 
_pdbx_entry_details.source_details             ? 
_pdbx_entry_details.has_ligand_of_interest     Y 
_pdbx_entry_details.has_protein_modification   ? 
# 
_pdbx_nmr_ensemble.entry_id                                      8QRX 
_pdbx_nmr_ensemble.conformers_calculated_total_number            100 
_pdbx_nmr_ensemble.conformers_submitted_total_number             10 
_pdbx_nmr_ensemble.conformer_selection_criteria                  'structures with the lowest energy' 
_pdbx_nmr_ensemble.representative_conformer                      ? 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.entry_id             8QRX 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.selection_criteria   'closest to the average' 
# 
loop_
_pdbx_nmr_sample_details.solution_id 
_pdbx_nmr_sample_details.contents 
_pdbx_nmr_sample_details.solvent_system 
_pdbx_nmr_sample_details.label 
_pdbx_nmr_sample_details.type 
_pdbx_nmr_sample_details.details 
1 
;350 uM [U-13C; U-15N] TomAPCP substrate-loaded, 50 mM sodium phosphate, 150 mM sodium chloride, 0.02 w/v sodium azide, 10 v/v [U-2H] D2O, 90% H2O/10% D2O
;
'90% H2O/10% D2O' 13C15N_sample     solution ? 
3 
;100 uM [U-13C; U-15N] TomAPCP substrate-loaded, 50 mM sodium phosphate, 150 mM sodium chloride, 0.02 w/v sodium azide, 10 v/v [U-2H] D2O, 90% H2O/10% D2O
;
'90% H2O/10% D2O' 13C15N_sample_2   solution ? 
2 
;500 uM [U-13C; U-15N] TomAPCP substrate-loaded, 50 mM sodium phosphate, 150 mM sodium chloride, 0.02 % w/v sodium azide, 100 v/v [U-2H] D2O, 100% D2O
;
'100% D2O'        13C15N_D2O_sample solution ? 
# 
loop_
_pdbx_nmr_exptl_sample.solution_id 
_pdbx_nmr_exptl_sample.component 
_pdbx_nmr_exptl_sample.concentration 
_pdbx_nmr_exptl_sample.concentration_range 
_pdbx_nmr_exptl_sample.concentration_units 
_pdbx_nmr_exptl_sample.isotopic_labeling 
1 'TomAPCP substrate-loaded' 350  ? uM      '[U-13C; U-15N]'    
1 'sodium phosphate'         50   ? mM      'natural abundance' 
1 'sodium chloride'          150  ? mM      'natural abundance' 
1 'sodium azide'             0.02 ? w/v     'natural abundance' 
1 D2O                        10   ? v/v     '[U-2H]'            
3 'TomAPCP substrate-loaded' 100  ? uM      '[U-13C; U-15N]'    
3 'sodium phosphate'         50   ? mM      'natural abundance' 
3 'sodium chloride'          150  ? mM      'natural abundance' 
3 'sodium azide'             0.02 ? w/v     'natural abundance' 
3 D2O                        10   ? v/v     '[U-2H]'            
2 'TomAPCP substrate-loaded' 500  ? uM      '[U-13C; U-15N]'    
2 'sodium phosphate'         50   ? mM      'natural abundance' 
2 'sodium chloride'          150  ? mM      'natural abundance' 
2 'sodium azide'             0.02 ? '% w/v' 'natural abundance' 
2 D2O                        100  ? v/v     '[U-2H]'            
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id          1 
_pdbx_nmr_exptl_sample_conditions.temperature            298 
_pdbx_nmr_exptl_sample_conditions.pressure_units         atm 
_pdbx_nmr_exptl_sample_conditions.pressure               1 
_pdbx_nmr_exptl_sample_conditions.pH                     7.0 
_pdbx_nmr_exptl_sample_conditions.ionic_strength         265 
_pdbx_nmr_exptl_sample_conditions.details                ? 
_pdbx_nmr_exptl_sample_conditions.ionic_strength_err     ? 
_pdbx_nmr_exptl_sample_conditions.ionic_strength_units   mM 
_pdbx_nmr_exptl_sample_conditions.label                  conditions_1 
_pdbx_nmr_exptl_sample_conditions.pH_err                 ? 
_pdbx_nmr_exptl_sample_conditions.pH_units               pH 
_pdbx_nmr_exptl_sample_conditions.pressure_err           ? 
_pdbx_nmr_exptl_sample_conditions.temperature_err        ? 
_pdbx_nmr_exptl_sample_conditions.temperature_units      K 
# 
loop_
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.solution_id 
_pdbx_nmr_exptl.type 
_pdbx_nmr_exptl.spectrometer_id 
_pdbx_nmr_exptl.sample_state 
1 1 1 '2D 1H-15N HSQC'  1 isotropic 
2 1 3 '2D 1H-13C HSQC'  2 isotropic 
3 1 2 '2D 1H-13C HSQC'  2 isotropic 
4 1 1 '3D 1H-15N NOESY' 1 isotropic 
5 1 2 '3D 1H-13C NOESY' 2 isotropic 
# 
loop_
_pdbx_nmr_refine.entry_id 
_pdbx_nmr_refine.method 
_pdbx_nmr_refine.details 
_pdbx_nmr_refine.software_ordinal 
8QRX 'simulated annealing'    ? 7 
8QRX 'torsion angle dynamics' ? 8 
8QRX 'molecular dynamics'     ? 9 
# 
loop_
_pdbx_nmr_software.ordinal 
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.authors 
1 collection                  TopSpin           3.2  'Bruker Biospin'                                    
2 processing                  NMRPipe           10.2 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' 
3 'peak picking'              'CcpNmr Analysis' 2.4  CCPN                                                
4 'chemical shift assignment' 'CcpNmr Analysis' 2.4  CCPN                                                
5 'data analysis'             'CcpNmr Analysis' 2.4  CCPN                                                
6 'structure calculation'     ARIA              2.3  
;Linge, O'Donoghue and Nilges
;
7 'structure calculation'     CNS               1.21 'Brunger, Adams, Clore, Gros, Nilges and Read'      
8 'structure calculation'     CNS               1.21 'Brunger, Adams, Clore, Gros, Nilges and Read'      
9 'structure calculation'     CNS               1.21 'Brunger, Adams, Clore, Gros, Nilges and Read'      
# 
loop_
_chem_comp_atom.comp_id 
_chem_comp_atom.atom_id 
_chem_comp_atom.type_symbol 
_chem_comp_atom.pdbx_aromatic_flag 
_chem_comp_atom.pdbx_stereo_config 
_chem_comp_atom.pdbx_ordinal 
ALA N    N N N 1   
ALA CA   C N S 2   
ALA C    C N N 3   
ALA O    O N N 4   
ALA CB   C N N 5   
ALA OXT  O N N 6   
ALA H    H N N 7   
ALA H2   H N N 8   
ALA HA   H N N 9   
ALA HB1  H N N 10  
ALA HB2  H N N 11  
ALA HB3  H N N 12  
ALA HXT  H N N 13  
ARG N    N N N 14  
ARG CA   C N S 15  
ARG C    C N N 16  
ARG O    O N N 17  
ARG CB   C N N 18  
ARG CG   C N N 19  
ARG CD   C N N 20  
ARG NE   N N N 21  
ARG CZ   C N N 22  
ARG NH1  N N N 23  
ARG NH2  N N N 24  
ARG OXT  O N N 25  
ARG H    H N N 26  
ARG H2   H N N 27  
ARG HA   H N N 28  
ARG HB2  H N N 29  
ARG HB3  H N N 30  
ARG HG2  H N N 31  
ARG HG3  H N N 32  
ARG HD2  H N N 33  
ARG HD3  H N N 34  
ARG HE   H N N 35  
ARG HH11 H N N 36  
ARG HH12 H N N 37  
ARG HH21 H N N 38  
ARG HH22 H N N 39  
ARG HXT  H N N 40  
ASN N    N N N 41  
ASN CA   C N S 42  
ASN C    C N N 43  
ASN O    O N N 44  
ASN CB   C N N 45  
ASN CG   C N N 46  
ASN OD1  O N N 47  
ASN ND2  N N N 48  
ASN OXT  O N N 49  
ASN H    H N N 50  
ASN H2   H N N 51  
ASN HA   H N N 52  
ASN HB2  H N N 53  
ASN HB3  H N N 54  
ASN HD21 H N N 55  
ASN HD22 H N N 56  
ASN HXT  H N N 57  
ASP N    N N N 58  
ASP CA   C N S 59  
ASP C    C N N 60  
ASP O    O N N 61  
ASP CB   C N N 62  
ASP CG   C N N 63  
ASP OD1  O N N 64  
ASP OD2  O N N 65  
ASP OXT  O N N 66  
ASP H    H N N 67  
ASP H2   H N N 68  
ASP HA   H N N 69  
ASP HB2  H N N 70  
ASP HB3  H N N 71  
ASP HD2  H N N 72  
ASP HXT  H N N 73  
GLN N    N N N 74  
GLN CA   C N S 75  
GLN C    C N N 76  
GLN O    O N N 77  
GLN CB   C N N 78  
GLN CG   C N N 79  
GLN CD   C N N 80  
GLN OE1  O N N 81  
GLN NE2  N N N 82  
GLN OXT  O N N 83  
GLN H    H N N 84  
GLN H2   H N N 85  
GLN HA   H N N 86  
GLN HB2  H N N 87  
GLN HB3  H N N 88  
GLN HG2  H N N 89  
GLN HG3  H N N 90  
GLN HE21 H N N 91  
GLN HE22 H N N 92  
GLN HXT  H N N 93  
GLU N    N N N 94  
GLU CA   C N S 95  
GLU C    C N N 96  
GLU O    O N N 97  
GLU CB   C N N 98  
GLU CG   C N N 99  
GLU CD   C N N 100 
GLU OE1  O N N 101 
GLU OE2  O N N 102 
GLU OXT  O N N 103 
GLU H    H N N 104 
GLU H2   H N N 105 
GLU HA   H N N 106 
GLU HB2  H N N 107 
GLU HB3  H N N 108 
GLU HG2  H N N 109 
GLU HG3  H N N 110 
GLU HE2  H N N 111 
GLU HXT  H N N 112 
GLY N    N N N 113 
GLY CA   C N N 114 
GLY C    C N N 115 
GLY O    O N N 116 
GLY OXT  O N N 117 
GLY H    H N N 118 
GLY H2   H N N 119 
GLY HA2  H N N 120 
GLY HA3  H N N 121 
GLY HXT  H N N 122 
HIS N    N N N 123 
HIS CA   C N S 124 
HIS C    C N N 125 
HIS O    O N N 126 
HIS CB   C N N 127 
HIS CG   C Y N 128 
HIS ND1  N Y N 129 
HIS CD2  C Y N 130 
HIS CE1  C Y N 131 
HIS NE2  N Y N 132 
HIS OXT  O N N 133 
HIS H    H N N 134 
HIS H2   H N N 135 
HIS HA   H N N 136 
HIS HB2  H N N 137 
HIS HB3  H N N 138 
HIS HD1  H N N 139 
HIS HD2  H N N 140 
HIS HE1  H N N 141 
HIS HE2  H N N 142 
HIS HXT  H N N 143 
ILE N    N N N 144 
ILE CA   C N S 145 
ILE C    C N N 146 
ILE O    O N N 147 
ILE CB   C N S 148 
ILE CG1  C N N 149 
ILE CG2  C N N 150 
ILE CD1  C N N 151 
ILE OXT  O N N 152 
ILE H    H N N 153 
ILE H2   H N N 154 
ILE HA   H N N 155 
ILE HB   H N N 156 
ILE HG12 H N N 157 
ILE HG13 H N N 158 
ILE HG21 H N N 159 
ILE HG22 H N N 160 
ILE HG23 H N N 161 
ILE HD11 H N N 162 
ILE HD12 H N N 163 
ILE HD13 H N N 164 
ILE HXT  H N N 165 
LEU N    N N N 166 
LEU CA   C N S 167 
LEU C    C N N 168 
LEU O    O N N 169 
LEU CB   C N N 170 
LEU CG   C N N 171 
LEU CD1  C N N 172 
LEU CD2  C N N 173 
LEU OXT  O N N 174 
LEU H    H N N 175 
LEU H2   H N N 176 
LEU HA   H N N 177 
LEU HB2  H N N 178 
LEU HB3  H N N 179 
LEU HG   H N N 180 
LEU HD11 H N N 181 
LEU HD12 H N N 182 
LEU HD13 H N N 183 
LEU HD21 H N N 184 
LEU HD22 H N N 185 
LEU HD23 H N N 186 
LEU HXT  H N N 187 
LYS N    N N N 188 
LYS CA   C N S 189 
LYS C    C N N 190 
LYS O    O N N 191 
LYS CB   C N N 192 
LYS CG   C N N 193 
LYS CD   C N N 194 
LYS CE   C N N 195 
LYS NZ   N N N 196 
LYS OXT  O N N 197 
LYS H    H N N 198 
LYS H2   H N N 199 
LYS HA   H N N 200 
LYS HB2  H N N 201 
LYS HB3  H N N 202 
LYS HG2  H N N 203 
LYS HG3  H N N 204 
LYS HD2  H N N 205 
LYS HD3  H N N 206 
LYS HE2  H N N 207 
LYS HE3  H N N 208 
LYS HZ1  H N N 209 
LYS HZ2  H N N 210 
LYS HZ3  H N N 211 
LYS HXT  H N N 212 
MET N    N N N 213 
MET CA   C N S 214 
MET C    C N N 215 
MET O    O N N 216 
MET CB   C N N 217 
MET CG   C N N 218 
MET SD   S N N 219 
MET CE   C N N 220 
MET OXT  O N N 221 
MET H    H N N 222 
MET H2   H N N 223 
MET HA   H N N 224 
MET HB2  H N N 225 
MET HB3  H N N 226 
MET HG2  H N N 227 
MET HG3  H N N 228 
MET HE1  H N N 229 
MET HE2  H N N 230 
MET HE3  H N N 231 
MET HXT  H N N 232 
PHE N    N N N 233 
PHE CA   C N S 234 
PHE C    C N N 235 
PHE O    O N N 236 
PHE CB   C N N 237 
PHE CG   C Y N 238 
PHE CD1  C Y N 239 
PHE CD2  C Y N 240 
PHE CE1  C Y N 241 
PHE CE2  C Y N 242 
PHE CZ   C Y N 243 
PHE OXT  O N N 244 
PHE H    H N N 245 
PHE H2   H N N 246 
PHE HA   H N N 247 
PHE HB2  H N N 248 
PHE HB3  H N N 249 
PHE HD1  H N N 250 
PHE HD2  H N N 251 
PHE HE1  H N N 252 
PHE HE2  H N N 253 
PHE HZ   H N N 254 
PHE HXT  H N N 255 
PRO N    N N N 256 
PRO CA   C N S 257 
PRO C    C N N 258 
PRO O    O N N 259 
PRO CB   C N N 260 
PRO CG   C N N 261 
PRO CD   C N N 262 
PRO OXT  O N N 263 
PRO H    H N N 264 
PRO HA   H N N 265 
PRO HB2  H N N 266 
PRO HB3  H N N 267 
PRO HG2  H N N 268 
PRO HG3  H N N 269 
PRO HD2  H N N 270 
PRO HD3  H N N 271 
PRO HXT  H N N 272 
SER N    N N N 273 
SER CA   C N S 274 
SER C    C N N 275 
SER O    O N N 276 
SER CB   C N N 277 
SER OG   O N N 278 
SER OXT  O N N 279 
SER H    H N N 280 
SER H2   H N N 281 
SER HA   H N N 282 
SER HB2  H N N 283 
SER HB3  H N N 284 
SER HG   H N N 285 
SER HXT  H N N 286 
THR N    N N N 287 
THR CA   C N S 288 
THR C    C N N 289 
THR O    O N N 290 
THR CB   C N R 291 
THR OG1  O N N 292 
THR CG2  C N N 293 
THR OXT  O N N 294 
THR H    H N N 295 
THR H2   H N N 296 
THR HA   H N N 297 
THR HB   H N N 298 
THR HG1  H N N 299 
THR HG21 H N N 300 
THR HG22 H N N 301 
THR HG23 H N N 302 
THR HXT  H N N 303 
TRP N    N N N 304 
TRP CA   C N S 305 
TRP C    C N N 306 
TRP O    O N N 307 
TRP CB   C N N 308 
TRP CG   C Y N 309 
TRP CD1  C Y N 310 
TRP CD2  C Y N 311 
TRP NE1  N Y N 312 
TRP CE2  C Y N 313 
TRP CE3  C Y N 314 
TRP CZ2  C Y N 315 
TRP CZ3  C Y N 316 
TRP CH2  C Y N 317 
TRP OXT  O N N 318 
TRP H    H N N 319 
TRP H2   H N N 320 
TRP HA   H N N 321 
TRP HB2  H N N 322 
TRP HB3  H N N 323 
TRP HD1  H N N 324 
TRP HE1  H N N 325 
TRP HE3  H N N 326 
TRP HZ2  H N N 327 
TRP HZ3  H N N 328 
TRP HH2  H N N 329 
TRP HXT  H N N 330 
VAL N    N N N 331 
VAL CA   C N S 332 
VAL C    C N N 333 
VAL O    O N N 334 
VAL CB   C N N 335 
VAL CG1  C N N 336 
VAL CG2  C N N 337 
VAL OXT  O N N 338 
VAL H    H N N 339 
VAL H2   H N N 340 
VAL HA   H N N 341 
VAL HB   H N N 342 
VAL HG11 H N N 343 
VAL HG12 H N N 344 
VAL HG13 H N N 345 
VAL HG21 H N N 346 
VAL HG22 H N N 347 
VAL HG23 H N N 348 
VAL HXT  H N N 349 
WP9 N    N N N 350 
WP9 CA   C N S 351 
WP9 C    C N N 352 
WP9 O    O N N 353 
WP9 CB   C N N 354 
WP9 OG   O N N 355 
WP9 P24  P N N 356 
WP9 C11  C N N 357 
WP9 O11  O N N 358 
WP9 C12  C Y N 359 
WP9 C13  C Y N 360 
WP9 N13  N N N 361 
WP9 C14  C Y N 362 
WP9 C15  C Y N 363 
WP9 C16  C Y N 364 
WP9 C17  C Y N 365 
WP9 O23  O N N 366 
WP9 O26  O N N 367 
WP9 O27  O N N 368 
WP9 C28  C N N 369 
WP9 C29  C N N 370 
WP9 C30  C N N 371 
WP9 C31  C N N 372 
WP9 C32  C N R 373 
WP9 O33  O N N 374 
WP9 C34  C N N 375 
WP9 O35  O N N 376 
WP9 N36  N N N 377 
WP9 C37  C N N 378 
WP9 C38  C N N 379 
WP9 C39  C N N 380 
WP9 O40  O N N 381 
WP9 N41  N N N 382 
WP9 C42  C N N 383 
WP9 C43  C N N 384 
WP9 S44  S N N 385 
WP9 HN   H N N 386 
WP9 H1   H N N 387 
WP9 HA   H N N 388 
WP9 H3   H N N 389 
WP9 HB1  H N N 390 
WP9 HB2  H N N 391 
WP9 H131 H N N 392 
WP9 H132 H N N 393 
WP9 H14  H N N 394 
WP9 H15  H N N 395 
WP9 H16  H N N 396 
WP9 H17  H N N 397 
WP9 H4   H N N 398 
WP9 H281 H N N 399 
WP9 H282 H N N 400 
WP9 H302 H N N 401 
WP9 H303 H N N 402 
WP9 H301 H N N 403 
WP9 H312 H N N 404 
WP9 H313 H N N 405 
WP9 H311 H N N 406 
WP9 H32  H N N 407 
WP9 H33  H N N 408 
WP9 H36  H N N 409 
WP9 H371 H N N 410 
WP9 H372 H N N 411 
WP9 H381 H N N 412 
WP9 H382 H N N 413 
WP9 H41  H N N 414 
WP9 H422 H N N 415 
WP9 H421 H N N 416 
WP9 H431 H N N 417 
WP9 H432 H N N 418 
# 
loop_
_chem_comp_bond.comp_id 
_chem_comp_bond.atom_id_1 
_chem_comp_bond.atom_id_2 
_chem_comp_bond.value_order 
_chem_comp_bond.pdbx_aromatic_flag 
_chem_comp_bond.pdbx_stereo_config 
_chem_comp_bond.pdbx_ordinal 
ALA N   CA   sing N N 1   
ALA N   H    sing N N 2   
ALA N   H2   sing N N 3   
ALA CA  C    sing N N 4   
ALA CA  CB   sing N N 5   
ALA CA  HA   sing N N 6   
ALA C   O    doub N N 7   
ALA C   OXT  sing N N 8   
ALA CB  HB1  sing N N 9   
ALA CB  HB2  sing N N 10  
ALA CB  HB3  sing N N 11  
ALA OXT HXT  sing N N 12  
ARG N   CA   sing N N 13  
ARG N   H    sing N N 14  
ARG N   H2   sing N N 15  
ARG CA  C    sing N N 16  
ARG CA  CB   sing N N 17  
ARG CA  HA   sing N N 18  
ARG C   O    doub N N 19  
ARG C   OXT  sing N N 20  
ARG CB  CG   sing N N 21  
ARG CB  HB2  sing N N 22  
ARG CB  HB3  sing N N 23  
ARG CG  CD   sing N N 24  
ARG CG  HG2  sing N N 25  
ARG CG  HG3  sing N N 26  
ARG CD  NE   sing N N 27  
ARG CD  HD2  sing N N 28  
ARG CD  HD3  sing N N 29  
ARG NE  CZ   sing N N 30  
ARG NE  HE   sing N N 31  
ARG CZ  NH1  sing N N 32  
ARG CZ  NH2  doub N N 33  
ARG NH1 HH11 sing N N 34  
ARG NH1 HH12 sing N N 35  
ARG NH2 HH21 sing N N 36  
ARG NH2 HH22 sing N N 37  
ARG OXT HXT  sing N N 38  
ASN N   CA   sing N N 39  
ASN N   H    sing N N 40  
ASN N   H2   sing N N 41  
ASN CA  C    sing N N 42  
ASN CA  CB   sing N N 43  
ASN CA  HA   sing N N 44  
ASN C   O    doub N N 45  
ASN C   OXT  sing N N 46  
ASN CB  CG   sing N N 47  
ASN CB  HB2  sing N N 48  
ASN CB  HB3  sing N N 49  
ASN CG  OD1  doub N N 50  
ASN CG  ND2  sing N N 51  
ASN ND2 HD21 sing N N 52  
ASN ND2 HD22 sing N N 53  
ASN OXT HXT  sing N N 54  
ASP N   CA   sing N N 55  
ASP N   H    sing N N 56  
ASP N   H2   sing N N 57  
ASP CA  C    sing N N 58  
ASP CA  CB   sing N N 59  
ASP CA  HA   sing N N 60  
ASP C   O    doub N N 61  
ASP C   OXT  sing N N 62  
ASP CB  CG   sing N N 63  
ASP CB  HB2  sing N N 64  
ASP CB  HB3  sing N N 65  
ASP CG  OD1  doub N N 66  
ASP CG  OD2  sing N N 67  
ASP OD2 HD2  sing N N 68  
ASP OXT HXT  sing N N 69  
GLN N   CA   sing N N 70  
GLN N   H    sing N N 71  
GLN N   H2   sing N N 72  
GLN CA  C    sing N N 73  
GLN CA  CB   sing N N 74  
GLN CA  HA   sing N N 75  
GLN C   O    doub N N 76  
GLN C   OXT  sing N N 77  
GLN CB  CG   sing N N 78  
GLN CB  HB2  sing N N 79  
GLN CB  HB3  sing N N 80  
GLN CG  CD   sing N N 81  
GLN CG  HG2  sing N N 82  
GLN CG  HG3  sing N N 83  
GLN CD  OE1  doub N N 84  
GLN CD  NE2  sing N N 85  
GLN NE2 HE21 sing N N 86  
GLN NE2 HE22 sing N N 87  
GLN OXT HXT  sing N N 88  
GLU N   CA   sing N N 89  
GLU N   H    sing N N 90  
GLU N   H2   sing N N 91  
GLU CA  C    sing N N 92  
GLU CA  CB   sing N N 93  
GLU CA  HA   sing N N 94  
GLU C   O    doub N N 95  
GLU C   OXT  sing N N 96  
GLU CB  CG   sing N N 97  
GLU CB  HB2  sing N N 98  
GLU CB  HB3  sing N N 99  
GLU CG  CD   sing N N 100 
GLU CG  HG2  sing N N 101 
GLU CG  HG3  sing N N 102 
GLU CD  OE1  doub N N 103 
GLU CD  OE2  sing N N 104 
GLU OE2 HE2  sing N N 105 
GLU OXT HXT  sing N N 106 
GLY N   CA   sing N N 107 
GLY N   H    sing N N 108 
GLY N   H2   sing N N 109 
GLY CA  C    sing N N 110 
GLY CA  HA2  sing N N 111 
GLY CA  HA3  sing N N 112 
GLY C   O    doub N N 113 
GLY C   OXT  sing N N 114 
GLY OXT HXT  sing N N 115 
HIS N   CA   sing N N 116 
HIS N   H    sing N N 117 
HIS N   H2   sing N N 118 
HIS CA  C    sing N N 119 
HIS CA  CB   sing N N 120 
HIS CA  HA   sing N N 121 
HIS C   O    doub N N 122 
HIS C   OXT  sing N N 123 
HIS CB  CG   sing N N 124 
HIS CB  HB2  sing N N 125 
HIS CB  HB3  sing N N 126 
HIS CG  ND1  sing Y N 127 
HIS CG  CD2  doub Y N 128 
HIS ND1 CE1  doub Y N 129 
HIS ND1 HD1  sing N N 130 
HIS CD2 NE2  sing Y N 131 
HIS CD2 HD2  sing N N 132 
HIS CE1 NE2  sing Y N 133 
HIS CE1 HE1  sing N N 134 
HIS NE2 HE2  sing N N 135 
HIS OXT HXT  sing N N 136 
ILE N   CA   sing N N 137 
ILE N   H    sing N N 138 
ILE N   H2   sing N N 139 
ILE CA  C    sing N N 140 
ILE CA  CB   sing N N 141 
ILE CA  HA   sing N N 142 
ILE C   O    doub N N 143 
ILE C   OXT  sing N N 144 
ILE CB  CG1  sing N N 145 
ILE CB  CG2  sing N N 146 
ILE CB  HB   sing N N 147 
ILE CG1 CD1  sing N N 148 
ILE CG1 HG12 sing N N 149 
ILE CG1 HG13 sing N N 150 
ILE CG2 HG21 sing N N 151 
ILE CG2 HG22 sing N N 152 
ILE CG2 HG23 sing N N 153 
ILE CD1 HD11 sing N N 154 
ILE CD1 HD12 sing N N 155 
ILE CD1 HD13 sing N N 156 
ILE OXT HXT  sing N N 157 
LEU N   CA   sing N N 158 
LEU N   H    sing N N 159 
LEU N   H2   sing N N 160 
LEU CA  C    sing N N 161 
LEU CA  CB   sing N N 162 
LEU CA  HA   sing N N 163 
LEU C   O    doub N N 164 
LEU C   OXT  sing N N 165 
LEU CB  CG   sing N N 166 
LEU CB  HB2  sing N N 167 
LEU CB  HB3  sing N N 168 
LEU CG  CD1  sing N N 169 
LEU CG  CD2  sing N N 170 
LEU CG  HG   sing N N 171 
LEU CD1 HD11 sing N N 172 
LEU CD1 HD12 sing N N 173 
LEU CD1 HD13 sing N N 174 
LEU CD2 HD21 sing N N 175 
LEU CD2 HD22 sing N N 176 
LEU CD2 HD23 sing N N 177 
LEU OXT HXT  sing N N 178 
LYS N   CA   sing N N 179 
LYS N   H    sing N N 180 
LYS N   H2   sing N N 181 
LYS CA  C    sing N N 182 
LYS CA  CB   sing N N 183 
LYS CA  HA   sing N N 184 
LYS C   O    doub N N 185 
LYS C   OXT  sing N N 186 
LYS CB  CG   sing N N 187 
LYS CB  HB2  sing N N 188 
LYS CB  HB3  sing N N 189 
LYS CG  CD   sing N N 190 
LYS CG  HG2  sing N N 191 
LYS CG  HG3  sing N N 192 
LYS CD  CE   sing N N 193 
LYS CD  HD2  sing N N 194 
LYS CD  HD3  sing N N 195 
LYS CE  NZ   sing N N 196 
LYS CE  HE2  sing N N 197 
LYS CE  HE3  sing N N 198 
LYS NZ  HZ1  sing N N 199 
LYS NZ  HZ2  sing N N 200 
LYS NZ  HZ3  sing N N 201 
LYS OXT HXT  sing N N 202 
MET N   CA   sing N N 203 
MET N   H    sing N N 204 
MET N   H2   sing N N 205 
MET CA  C    sing N N 206 
MET CA  CB   sing N N 207 
MET CA  HA   sing N N 208 
MET C   O    doub N N 209 
MET C   OXT  sing N N 210 
MET CB  CG   sing N N 211 
MET CB  HB2  sing N N 212 
MET CB  HB3  sing N N 213 
MET CG  SD   sing N N 214 
MET CG  HG2  sing N N 215 
MET CG  HG3  sing N N 216 
MET SD  CE   sing N N 217 
MET CE  HE1  sing N N 218 
MET CE  HE2  sing N N 219 
MET CE  HE3  sing N N 220 
MET OXT HXT  sing N N 221 
PHE N   CA   sing N N 222 
PHE N   H    sing N N 223 
PHE N   H2   sing N N 224 
PHE CA  C    sing N N 225 
PHE CA  CB   sing N N 226 
PHE CA  HA   sing N N 227 
PHE C   O    doub N N 228 
PHE C   OXT  sing N N 229 
PHE CB  CG   sing N N 230 
PHE CB  HB2  sing N N 231 
PHE CB  HB3  sing N N 232 
PHE CG  CD1  doub Y N 233 
PHE CG  CD2  sing Y N 234 
PHE CD1 CE1  sing Y N 235 
PHE CD1 HD1  sing N N 236 
PHE CD2 CE2  doub Y N 237 
PHE CD2 HD2  sing N N 238 
PHE CE1 CZ   doub Y N 239 
PHE CE1 HE1  sing N N 240 
PHE CE2 CZ   sing Y N 241 
PHE CE2 HE2  sing N N 242 
PHE CZ  HZ   sing N N 243 
PHE OXT HXT  sing N N 244 
PRO N   CA   sing N N 245 
PRO N   CD   sing N N 246 
PRO N   H    sing N N 247 
PRO CA  C    sing N N 248 
PRO CA  CB   sing N N 249 
PRO CA  HA   sing N N 250 
PRO C   O    doub N N 251 
PRO C   OXT  sing N N 252 
PRO CB  CG   sing N N 253 
PRO CB  HB2  sing N N 254 
PRO CB  HB3  sing N N 255 
PRO CG  CD   sing N N 256 
PRO CG  HG2  sing N N 257 
PRO CG  HG3  sing N N 258 
PRO CD  HD2  sing N N 259 
PRO CD  HD3  sing N N 260 
PRO OXT HXT  sing N N 261 
SER N   CA   sing N N 262 
SER N   H    sing N N 263 
SER N   H2   sing N N 264 
SER CA  C    sing N N 265 
SER CA  CB   sing N N 266 
SER CA  HA   sing N N 267 
SER C   O    doub N N 268 
SER C   OXT  sing N N 269 
SER CB  OG   sing N N 270 
SER CB  HB2  sing N N 271 
SER CB  HB3  sing N N 272 
SER OG  HG   sing N N 273 
SER OXT HXT  sing N N 274 
THR N   CA   sing N N 275 
THR N   H    sing N N 276 
THR N   H2   sing N N 277 
THR CA  C    sing N N 278 
THR CA  CB   sing N N 279 
THR CA  HA   sing N N 280 
THR C   O    doub N N 281 
THR C   OXT  sing N N 282 
THR CB  OG1  sing N N 283 
THR CB  CG2  sing N N 284 
THR CB  HB   sing N N 285 
THR OG1 HG1  sing N N 286 
THR CG2 HG21 sing N N 287 
THR CG2 HG22 sing N N 288 
THR CG2 HG23 sing N N 289 
THR OXT HXT  sing N N 290 
TRP N   CA   sing N N 291 
TRP N   H    sing N N 292 
TRP N   H2   sing N N 293 
TRP CA  C    sing N N 294 
TRP CA  CB   sing N N 295 
TRP CA  HA   sing N N 296 
TRP C   O    doub N N 297 
TRP C   OXT  sing N N 298 
TRP CB  CG   sing N N 299 
TRP CB  HB2  sing N N 300 
TRP CB  HB3  sing N N 301 
TRP CG  CD1  doub Y N 302 
TRP CG  CD2  sing Y N 303 
TRP CD1 NE1  sing Y N 304 
TRP CD1 HD1  sing N N 305 
TRP CD2 CE2  doub Y N 306 
TRP CD2 CE3  sing Y N 307 
TRP NE1 CE2  sing Y N 308 
TRP NE1 HE1  sing N N 309 
TRP CE2 CZ2  sing Y N 310 
TRP CE3 CZ3  doub Y N 311 
TRP CE3 HE3  sing N N 312 
TRP CZ2 CH2  doub Y N 313 
TRP CZ2 HZ2  sing N N 314 
TRP CZ3 CH2  sing Y N 315 
TRP CZ3 HZ3  sing N N 316 
TRP CH2 HH2  sing N N 317 
TRP OXT HXT  sing N N 318 
VAL N   CA   sing N N 319 
VAL N   H    sing N N 320 
VAL N   H2   sing N N 321 
VAL CA  C    sing N N 322 
VAL CA  CB   sing N N 323 
VAL CA  HA   sing N N 324 
VAL C   O    doub N N 325 
VAL C   OXT  sing N N 326 
VAL CB  CG1  sing N N 327 
VAL CB  CG2  sing N N 328 
VAL CB  HB   sing N N 329 
VAL CG1 HG11 sing N N 330 
VAL CG1 HG12 sing N N 331 
VAL CG1 HG13 sing N N 332 
VAL CG2 HG21 sing N N 333 
VAL CG2 HG22 sing N N 334 
VAL CG2 HG23 sing N N 335 
VAL OXT HXT  sing N N 336 
WP9 C17 C15  doub Y N 337 
WP9 C17 C16  sing Y N 338 
WP9 C15 C13  sing Y N 339 
WP9 C16 C14  doub Y N 340 
WP9 C13 N13  sing N N 341 
WP9 C13 C12  doub Y N 342 
WP9 C14 C12  sing Y N 343 
WP9 C12 C11  sing N N 344 
WP9 O11 C11  doub N N 345 
WP9 C11 S44  sing N N 346 
WP9 O33 C32  sing N N 347 
WP9 C32 C34  sing N N 348 
WP9 C32 C29  sing N N 349 
WP9 S44 C43  sing N N 350 
WP9 C43 C42  sing N N 351 
WP9 C31 C29  sing N N 352 
WP9 C34 N36  sing N N 353 
WP9 C34 O35  doub N N 354 
WP9 N36 C37  sing N N 355 
WP9 O23 P24  doub N N 356 
WP9 CB  CA   sing N N 357 
WP9 CB  OG   sing N N 358 
WP9 C29 C28  sing N N 359 
WP9 C29 C30  sing N N 360 
WP9 O27 P24  sing N N 361 
WP9 O27 C28  sing N N 362 
WP9 C37 C38  sing N N 363 
WP9 CA  N    sing N N 364 
WP9 CA  C    sing N N 365 
WP9 C42 N41  sing N N 366 
WP9 P24 OG   sing N N 367 
WP9 P24 O26  sing N N 368 
WP9 N41 C39  sing N N 369 
WP9 O40 C39  doub N N 370 
WP9 C39 C38  sing N N 371 
WP9 C   O    doub N N 372 
WP9 N   HN   sing N N 373 
WP9 N   H1   sing N N 374 
WP9 CA  HA   sing N N 375 
WP9 C   H3   sing N N 376 
WP9 CB  HB1  sing N N 377 
WP9 CB  HB2  sing N N 378 
WP9 N13 H131 sing N N 379 
WP9 N13 H132 sing N N 380 
WP9 C14 H14  sing N N 381 
WP9 C15 H15  sing N N 382 
WP9 C16 H16  sing N N 383 
WP9 C17 H17  sing N N 384 
WP9 O26 H4   sing N N 385 
WP9 C28 H281 sing N N 386 
WP9 C28 H282 sing N N 387 
WP9 C30 H302 sing N N 388 
WP9 C30 H303 sing N N 389 
WP9 C30 H301 sing N N 390 
WP9 C31 H312 sing N N 391 
WP9 C31 H313 sing N N 392 
WP9 C31 H311 sing N N 393 
WP9 C32 H32  sing N N 394 
WP9 O33 H33  sing N N 395 
WP9 N36 H36  sing N N 396 
WP9 C37 H371 sing N N 397 
WP9 C37 H372 sing N N 398 
WP9 C38 H381 sing N N 399 
WP9 C38 H382 sing N N 400 
WP9 N41 H41  sing N N 401 
WP9 C42 H422 sing N N 402 
WP9 C42 H421 sing N N 403 
WP9 C43 H431 sing N N 404 
WP9 C43 H432 sing N N 405 
# 
_pdbx_audit_support.funding_organization   'German Research Foundation (DFG)' 
_pdbx_audit_support.country                Germany 
_pdbx_audit_support.grant_number           CA294/16-1 
_pdbx_audit_support.ordinal                1 
# 
_pdbx_entity_instance_feature.ordinal        1 
_pdbx_entity_instance_feature.comp_id        WP9 
_pdbx_entity_instance_feature.asym_id        ? 
_pdbx_entity_instance_feature.seq_num        ? 
_pdbx_entity_instance_feature.auth_comp_id   WP9 
_pdbx_entity_instance_feature.auth_asym_id   ? 
_pdbx_entity_instance_feature.auth_seq_num   ? 
_pdbx_entity_instance_feature.feature_type   'SUBJECT OF INVESTIGATION' 
_pdbx_entity_instance_feature.details        ? 
# 
loop_
_pdbx_nmr_spectrometer.spectrometer_id 
_pdbx_nmr_spectrometer.model 
_pdbx_nmr_spectrometer.type 
_pdbx_nmr_spectrometer.manufacturer 
_pdbx_nmr_spectrometer.field_strength 
_pdbx_nmr_spectrometer.details 
1 'AVANCE III'    ? Bruker 600 ? 
2 'AVANCE III HD' ? Bruker 850 ? 
# 
_atom_sites.entry_id                    8QRX 
_atom_sites.Cartn_transf_matrix[1][1]   ? 
_atom_sites.Cartn_transf_matrix[1][2]   ? 
_atom_sites.Cartn_transf_matrix[1][3]   ? 
_atom_sites.Cartn_transf_matrix[2][1]   ? 
_atom_sites.Cartn_transf_matrix[2][2]   ? 
_atom_sites.Cartn_transf_matrix[2][3]   ? 
_atom_sites.Cartn_transf_matrix[3][1]   ? 
_atom_sites.Cartn_transf_matrix[3][2]   ? 
_atom_sites.Cartn_transf_matrix[3][3]   ? 
_atom_sites.Cartn_transf_vector[1]      ? 
_atom_sites.Cartn_transf_vector[2]      ? 
_atom_sites.Cartn_transf_vector[3]      ? 
_atom_sites.Cartn_transform_axes        ? 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
_atom_sites.solution_primary            ? 
_atom_sites.solution_secondary          ? 
_atom_sites.solution_hydrogens          ? 
_atom_sites.special_details             ? 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
P 
S 
# 
loop_