data_8QY9 # _entry.id 8QY9 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.396 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 8QY9 pdb_00008qy9 10.2210/pdb8qy9/pdb WWPDB D_1292133975 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2024-01-17 2 'Structure model' 2 0 2024-07-24 3 'Structure model' 2 1 2024-08-14 4 'Structure model' 2 2 2024-09-11 # loop_ _pdbx_audit_revision_details.ordinal _pdbx_audit_revision_details.revision_ordinal _pdbx_audit_revision_details.data_content_type _pdbx_audit_revision_details.provider _pdbx_audit_revision_details.type _pdbx_audit_revision_details.description _pdbx_audit_revision_details.details 1 1 'Structure model' repository 'Initial release' ? ? 2 2 'Structure model' author 'Coordinate replacement' 'Real space R-factor' 'further refinement for model improvement' # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' Advisory 2 2 'Structure model' 'Atomic model' 3 2 'Structure model' 'Data collection' 4 2 'Structure model' 'Database references' 5 2 'Structure model' 'Derived calculations' 6 2 'Structure model' 'Non-polymer description' 7 2 'Structure model' 'Polymer sequence' 8 2 'Structure model' 'Refinement description' 9 2 'Structure model' 'Source and taxonomy' 10 2 'Structure model' 'Structure summary' 11 3 'Structure model' 'Database references' 12 4 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' atom_site 2 2 'Structure model' atom_site_anisotrop 3 2 'Structure model' chem_comp 4 2 'Structure model' chem_comp_atom 5 2 'Structure model' chem_comp_bond 6 2 'Structure model' entity 7 2 'Structure model' entity_name_com 8 2 'Structure model' entity_poly 9 2 'Structure model' entity_poly_seq 10 2 'Structure model' entity_src_gen 11 2 'Structure model' pdbx_contact_author 12 2 'Structure model' pdbx_database_related 13 2 'Structure model' pdbx_distant_solvent_atoms 14 2 'Structure model' pdbx_entity_nonpoly 15 2 'Structure model' pdbx_nonpoly_scheme 16 2 'Structure model' pdbx_poly_seq_scheme 17 2 'Structure model' pdbx_refine_tls 18 2 'Structure model' pdbx_refine_tls_group 19 2 'Structure model' pdbx_struct_assembly_gen 20 2 'Structure model' pdbx_struct_assembly_prop 21 2 'Structure model' pdbx_struct_conn_angle 22 2 'Structure model' pdbx_struct_sheet_hbond 23 2 'Structure model' pdbx_unobs_or_zero_occ_residues 24 2 'Structure model' pdbx_validate_close_contact 25 2 'Structure model' pdbx_validate_polymer_linkage 26 2 'Structure model' pdbx_validate_symm_contact 27 2 'Structure model' pdbx_validate_torsion 28 2 'Structure model' refine 29 2 'Structure model' refine_hist 30 2 'Structure model' refine_ls_restr 31 2 'Structure model' refine_ls_shell 32 2 'Structure model' software 33 2 'Structure model' struct_asym 34 2 'Structure model' struct_conf 35 2 'Structure model' struct_conn 36 2 'Structure model' struct_mon_prot_cis 37 2 'Structure model' struct_ref 38 2 'Structure model' struct_ref_seq 39 2 'Structure model' struct_ref_seq_dif 40 2 'Structure model' struct_sheet 41 2 'Structure model' struct_sheet_order 42 2 'Structure model' struct_sheet_range 43 3 'Structure model' citation 44 4 'Structure model' citation 45 4 'Structure model' citation_author # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_chem_comp.formula' 2 2 'Structure model' '_chem_comp.formula_weight' 3 2 'Structure model' '_chem_comp.id' 4 2 'Structure model' '_chem_comp.mon_nstd_flag' 5 2 'Structure model' '_chem_comp.name' 6 2 'Structure model' '_chem_comp.type' 7 2 'Structure model' '_entity_poly.pdbx_seq_one_letter_code' 8 2 'Structure model' '_entity_poly.pdbx_seq_one_letter_code_can' 9 2 'Structure model' '_entity_src_gen.gene_src_common_name' 10 2 'Structure model' '_entity_src_gen.pdbx_end_seq_num' 11 2 'Structure model' '_entity_src_gen.pdbx_gene_src_gene' 12 2 'Structure model' '_pdbx_struct_assembly_gen.asym_id_list' 13 2 'Structure model' '_pdbx_struct_assembly_prop.value' 14 2 'Structure model' '_refine.B_iso_mean' 15 2 'Structure model' '_refine.ls_R_factor_R_free' 16 2 'Structure model' '_refine.ls_R_factor_R_work' 17 2 'Structure model' '_refine.ls_R_factor_obs' 18 2 'Structure model' '_refine.overall_SU_ML' 19 2 'Structure model' '_refine.pdbx_overall_phase_error' 20 2 'Structure model' '_refine.pdbx_solvent_vdw_probe_radii' 21 2 'Structure model' '_refine_hist.number_atoms_solvent' 22 2 'Structure model' '_refine_hist.number_atoms_total' 23 2 'Structure model' '_refine_ls_restr.dev_ideal' 24 2 'Structure model' '_refine_ls_restr.number' 25 2 'Structure model' '_refine_ls_shell.R_factor_R_free' 26 2 'Structure model' '_refine_ls_shell.R_factor_R_work' 27 2 'Structure model' '_software.version' 28 2 'Structure model' '_struct_mon_prot_cis.label_seq_id' 29 2 'Structure model' '_struct_mon_prot_cis.pdbx_label_seq_id_2' 30 2 'Structure model' '_struct_mon_prot_cis.pdbx_omega_angle' 31 2 'Structure model' '_struct_ref.db_code' 32 2 'Structure model' '_struct_ref.db_name' 33 2 'Structure model' '_struct_ref.pdbx_align_begin' 34 2 'Structure model' '_struct_ref.pdbx_db_accession' 35 2 'Structure model' '_struct_ref.pdbx_seq_one_letter_code' 36 2 'Structure model' '_struct_ref_seq.pdbx_db_accession' 37 2 'Structure model' '_struct_ref_seq.seq_align_end' 38 3 'Structure model' '_citation.country' 39 3 'Structure model' '_citation.journal_abbrev' 40 3 'Structure model' '_citation.journal_id_CSD' 41 3 'Structure model' '_citation.journal_id_ISSN' 42 3 'Structure model' '_citation.pdbx_database_id_DOI' 43 3 'Structure model' '_citation.pdbx_database_id_PubMed' 44 3 'Structure model' '_citation.title' 45 3 'Structure model' '_citation.year' 46 4 'Structure model' '_citation.journal_volume' 47 4 'Structure model' '_citation.page_first' 48 4 'Structure model' '_citation.page_last' 49 4 'Structure model' '_citation_author.identifier_ORCID' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 8QY9 _pdbx_database_status.recvd_initial_deposition_date 2023-10-25 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _pdbx_database_related.db_name _pdbx_database_related.details _pdbx_database_related.db_id _pdbx_database_related.content_type PDB 'J22.9-ISY, fully humanized and CDR optimized Fab Fragment based on chimeric J22.9-xi IgG against BCMA' 8QYB unspecified PDB 'J22.9-FNY, fully humanized, CDR optimized Fab Fragment based on chimeric J22.9-xi IgG against BCMA; with VH CDR2 glycosylation' 8QYA unspecified PDB 'FAB fragment from chimeric J22.9-xi IgG against BCMA' 4ZFO unspecified # _pdbx_contact_author.id 2 _pdbx_contact_author.email Stephen-Francis.Marino@bfr.bund.de _pdbx_contact_author.name_first Stephen _pdbx_contact_author.name_last Marino _pdbx_contact_author.name_mi F. _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0001-5696-9679 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Marino, S.F.' 1 0000-0001-5696-9679 'Daumke, O.' 2 0000-0002-6190-1414 # loop_ _citation.abstract _citation.abstract_id_CAS _citation.book_id_ISBN _citation.book_publisher _citation.book_publisher_city _citation.book_title _citation.coordinate_linkage _citation.country _citation.database_id_Medline _citation.details _citation.id _citation.journal_abbrev _citation.journal_id_ASTM _citation.journal_id_CSD _citation.journal_id_ISSN _citation.journal_full _citation.journal_issue _citation.journal_volume _citation.language _citation.page_first _citation.page_last _citation.title _citation.year _citation.database_id_CSD _citation.pdbx_database_id_DOI _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_patent _citation.unpublished_flag ? ? ? ? ? ? ? DE ? ? primary J.Mol.Med. ? ? 1432-1440 ? ? 102 ? 1151 1161 'Structure-based humanization of a therapeutic antibody for multiple myeloma.' 2024 ? 10.1007/s00109-024-02470-4 39052065 ? ? ? ? ? ? ? ? ? ? ? ? 1 'Mol Oncol' ? ? 1878-0261 ? ? 9 ? 1348 1358 'Potent anti-tumor response by targeting B cell maturation antigen (BCMA) in a mouse model of multiple myeloma.' 2015 ? 10.1038/ni.2527 25953704 ? ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Marino, S.F.' 1 ? primary 'Daumke, O.' 2 ? 1 'Marino, S.F.' 3 0000-0001-5696-9679 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Fab light chain of J22.9-H' 23034.570 1 ? ? ? ? 2 polymer man 'Fab heavy chain of J22.9-H' 23572.344 1 ? ? ? ? 3 polymer man 'Tumor necrosis factor receptor superfamily member 17' 3741.257 1 ? ? ? 'Extracellular domain of BCMA (B-cell maturation antigen, CD269)' 4 non-polymer syn 'COPPER (II) ION' 63.546 2 ? ? ? ? # _entity_name_com.entity_id 3 _entity_name_com.name 'B-cell maturation protein' # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no ;EIVMTQSPATLSVSPGERATLSCKASQSVDSNVAWYQQKPGQAPRALIYSASLRFSGIPARFSGSGSGTEFTLTISSLQS EDFAVYYCQQYNNYPLTFGAGTKLELKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQ ESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNR ; ;EIVMTQSPATLSVSPGERATLSCKASQSVDSNVAWYQQKPGQAPRALIYSASLRFSGIPARFSGSGSGTEFTLTISSLQS EDFAVYYCQQYNNYPLTFGAGTKLELKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQ ESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNR ; L ? 2 'polypeptide(L)' no no ;EVQLVESGGGLVQPGGSLRLSCAASGFTFSRYWMSWVRQAPGKGLVWVGEINPDSSTINYAPSLKDKFTISRDNAKNTLY LQMNSLRAEDTAVYYCASLYYDYGDAMDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVS WNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPA ; ;EVQLVESGGGLVQPGGSLRLSCAASGFTFSRYWMSWVRQAPGKGLVWVGEINPDSSTINYAPSLKDKFTISRDNAKNTLY LQMNSLRAEDTAVYYCASLYYDYGDAMDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVS WNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPA ; H ? 3 'polypeptide(L)' no no QCSANEYFDSLLHACIPCQLRCSSATPPATCAAYC QCSANEYFDSLLHACIPCQLRCSSATPPATCAAYC A ? # _pdbx_entity_nonpoly.entity_id 4 _pdbx_entity_nonpoly.name 'COPPER (II) ION' _pdbx_entity_nonpoly.comp_id CU # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLU n 1 2 ILE n 1 3 VAL n 1 4 MET n 1 5 THR n 1 6 GLN n 1 7 SER n 1 8 PRO n 1 9 ALA n 1 10 THR n 1 11 LEU n 1 12 SER n 1 13 VAL n 1 14 SER n 1 15 PRO n 1 16 GLY n 1 17 GLU n 1 18 ARG n 1 19 ALA n 1 20 THR n 1 21 LEU n 1 22 SER n 1 23 CYS n 1 24 LYS n 1 25 ALA n 1 26 SER n 1 27 GLN n 1 28 SER n 1 29 VAL n 1 30 ASP n 1 31 SER n 1 32 ASN n 1 33 VAL n 1 34 ALA n 1 35 TRP n 1 36 TYR n 1 37 GLN n 1 38 GLN n 1 39 LYS n 1 40 PRO n 1 41 GLY n 1 42 GLN n 1 43 ALA n 1 44 PRO n 1 45 ARG n 1 46 ALA n 1 47 LEU n 1 48 ILE n 1 49 TYR n 1 50 SER n 1 51 ALA n 1 52 SER n 1 53 LEU n 1 54 ARG n 1 55 PHE n 1 56 SER n 1 57 GLY n 1 58 ILE n 1 59 PRO n 1 60 ALA n 1 61 ARG n 1 62 PHE n 1 63 SER n 1 64 GLY n 1 65 SER n 1 66 GLY n 1 67 SER n 1 68 GLY n 1 69 THR n 1 70 GLU n 1 71 PHE n 1 72 THR n 1 73 LEU n 1 74 THR n 1 75 ILE n 1 76 SER n 1 77 SER n 1 78 LEU n 1 79 GLN n 1 80 SER n 1 81 GLU n 1 82 ASP n 1 83 PHE n 1 84 ALA n 1 85 VAL n 1 86 TYR n 1 87 TYR n 1 88 CYS n 1 89 GLN n 1 90 GLN n 1 91 TYR n 1 92 ASN n 1 93 ASN n 1 94 TYR n 1 95 PRO n 1 96 LEU n 1 97 THR n 1 98 PHE n 1 99 GLY n 1 100 ALA n 1 101 GLY n 1 102 THR n 1 103 LYS n 1 104 LEU n 1 105 GLU n 1 106 LEU n 1 107 LYS n 1 108 ARG n 1 109 THR n 1 110 VAL n 1 111 ALA n 1 112 ALA n 1 113 PRO n 1 114 SER n 1 115 VAL n 1 116 PHE n 1 117 ILE n 1 118 PHE n 1 119 PRO n 1 120 PRO n 1 121 SER n 1 122 ASP n 1 123 GLU n 1 124 GLN n 1 125 LEU n 1 126 LYS n 1 127 SER n 1 128 GLY n 1 129 THR n 1 130 ALA n 1 131 SER n 1 132 VAL n 1 133 VAL n 1 134 CYS n 1 135 LEU n 1 136 LEU n 1 137 ASN n 1 138 ASN n 1 139 PHE n 1 140 TYR n 1 141 PRO n 1 142 ARG n 1 143 GLU n 1 144 ALA n 1 145 LYS n 1 146 VAL n 1 147 GLN n 1 148 TRP n 1 149 LYS n 1 150 VAL n 1 151 ASP n 1 152 ASN n 1 153 ALA n 1 154 LEU n 1 155 GLN n 1 156 SER n 1 157 GLY n 1 158 ASN n 1 159 SER n 1 160 GLN n 1 161 GLU n 1 162 SER n 1 163 VAL n 1 164 THR n 1 165 GLU n 1 166 GLN n 1 167 ASP n 1 168 SER n 1 169 LYS n 1 170 ASP n 1 171 SER n 1 172 THR n 1 173 TYR n 1 174 SER n 1 175 LEU n 1 176 SER n 1 177 SER n 1 178 THR n 1 179 LEU n 1 180 THR n 1 181 LEU n 1 182 SER n 1 183 LYS n 1 184 ALA n 1 185 ASP n 1 186 TYR n 1 187 GLU n 1 188 LYS n 1 189 HIS n 1 190 LYS n 1 191 VAL n 1 192 TYR n 1 193 ALA n 1 194 CYS n 1 195 GLU n 1 196 VAL n 1 197 THR n 1 198 HIS n 1 199 GLN n 1 200 GLY n 1 201 LEU n 1 202 SER n 1 203 SER n 1 204 PRO n 1 205 VAL n 1 206 THR n 1 207 LYS n 1 208 SER n 1 209 PHE n 1 210 ASN n 1 211 ARG n 2 1 GLU n 2 2 VAL n 2 3 GLN n 2 4 LEU n 2 5 VAL n 2 6 GLU n 2 7 SER n 2 8 GLY n 2 9 GLY n 2 10 GLY n 2 11 LEU n 2 12 VAL n 2 13 GLN n 2 14 PRO n 2 15 GLY n 2 16 GLY n 2 17 SER n 2 18 LEU n 2 19 ARG n 2 20 LEU n 2 21 SER n 2 22 CYS n 2 23 ALA n 2 24 ALA n 2 25 SER n 2 26 GLY n 2 27 PHE n 2 28 THR n 2 29 PHE n 2 30 SER n 2 31 ARG n 2 32 TYR n 2 33 TRP n 2 34 MET n 2 35 SER n 2 36 TRP n 2 37 VAL n 2 38 ARG n 2 39 GLN n 2 40 ALA n 2 41 PRO n 2 42 GLY n 2 43 LYS n 2 44 GLY n 2 45 LEU n 2 46 VAL n 2 47 TRP n 2 48 VAL n 2 49 GLY n 2 50 GLU n 2 51 ILE n 2 52 ASN n 2 53 PRO n 2 54 ASP n 2 55 SER n 2 56 SER n 2 57 THR n 2 58 ILE n 2 59 ASN n 2 60 TYR n 2 61 ALA n 2 62 PRO n 2 63 SER n 2 64 LEU n 2 65 LYS n 2 66 ASP n 2 67 LYS n 2 68 PHE n 2 69 THR n 2 70 ILE n 2 71 SER n 2 72 ARG n 2 73 ASP n 2 74 ASN n 2 75 ALA n 2 76 LYS n 2 77 ASN n 2 78 THR n 2 79 LEU n 2 80 TYR n 2 81 LEU n 2 82 GLN n 2 83 MET n 2 84 ASN n 2 85 SER n 2 86 LEU n 2 87 ARG n 2 88 ALA n 2 89 GLU n 2 90 ASP n 2 91 THR n 2 92 ALA n 2 93 VAL n 2 94 TYR n 2 95 TYR n 2 96 CYS n 2 97 ALA n 2 98 SER n 2 99 LEU n 2 100 TYR n 2 101 TYR n 2 102 ASP n 2 103 TYR n 2 104 GLY n 2 105 ASP n 2 106 ALA n 2 107 MET n 2 108 ASP n 2 109 TYR n 2 110 TRP n 2 111 GLY n 2 112 GLN n 2 113 GLY n 2 114 THR n 2 115 LEU n 2 116 VAL n 2 117 THR n 2 118 VAL n 2 119 SER n 2 120 SER n 2 121 ALA n 2 122 SER n 2 123 THR n 2 124 LYS n 2 125 GLY n 2 126 PRO n 2 127 SER n 2 128 VAL n 2 129 PHE n 2 130 PRO n 2 131 LEU n 2 132 ALA n 2 133 PRO n 2 134 SER n 2 135 SER n 2 136 LYS n 2 137 SER n 2 138 THR n 2 139 SER n 2 140 GLY n 2 141 GLY n 2 142 THR n 2 143 ALA n 2 144 ALA n 2 145 LEU n 2 146 GLY n 2 147 CYS n 2 148 LEU n 2 149 VAL n 2 150 LYS n 2 151 ASP n 2 152 TYR n 2 153 PHE n 2 154 PRO n 2 155 GLU n 2 156 PRO n 2 157 VAL n 2 158 THR n 2 159 VAL n 2 160 SER n 2 161 TRP n 2 162 ASN n 2 163 SER n 2 164 GLY n 2 165 ALA n 2 166 LEU n 2 167 THR n 2 168 SER n 2 169 GLY n 2 170 VAL n 2 171 HIS n 2 172 THR n 2 173 PHE n 2 174 PRO n 2 175 ALA n 2 176 VAL n 2 177 LEU n 2 178 GLN n 2 179 SER n 2 180 SER n 2 181 GLY n 2 182 LEU n 2 183 TYR n 2 184 SER n 2 185 LEU n 2 186 SER n 2 187 SER n 2 188 VAL n 2 189 VAL n 2 190 THR n 2 191 VAL n 2 192 PRO n 2 193 SER n 2 194 SER n 2 195 SER n 2 196 LEU n 2 197 GLY n 2 198 THR n 2 199 GLN n 2 200 THR n 2 201 TYR n 2 202 ILE n 2 203 CYS n 2 204 ASN n 2 205 VAL n 2 206 ASN n 2 207 HIS n 2 208 LYS n 2 209 PRO n 2 210 SER n 2 211 ASN n 2 212 THR n 2 213 LYS n 2 214 VAL n 2 215 ASP n 2 216 LYS n 2 217 ARG n 2 218 VAL n 2 219 GLU n 2 220 PRO n 2 221 ALA n 3 1 GLN n 3 2 CYS n 3 3 SER n 3 4 ALA n 3 5 ASN n 3 6 GLU n 3 7 TYR n 3 8 PHE n 3 9 ASP n 3 10 SER n 3 11 LEU n 3 12 LEU n 3 13 HIS n 3 14 ALA n 3 15 CYS n 3 16 ILE n 3 17 PRO n 3 18 CYS n 3 19 GLN n 3 20 LEU n 3 21 ARG n 3 22 CYS n 3 23 SER n 3 24 SER n 3 25 ALA n 3 26 THR n 3 27 PRO n 3 28 PRO n 3 29 ALA n 3 30 THR n 3 31 CYS n 3 32 ALA n 3 33 ALA n 3 34 TYR n 3 35 CYS n # loop_ _entity_src_gen.entity_id _entity_src_gen.pdbx_src_id _entity_src_gen.pdbx_alt_source_flag _entity_src_gen.pdbx_seq_type _entity_src_gen.pdbx_beg_seq_num _entity_src_gen.pdbx_end_seq_num _entity_src_gen.gene_src_common_name _entity_src_gen.gene_src_genus _entity_src_gen.pdbx_gene_src_gene _entity_src_gen.gene_src_species _entity_src_gen.gene_src_strain _entity_src_gen.gene_src_tissue _entity_src_gen.gene_src_tissue_fraction _entity_src_gen.gene_src_details _entity_src_gen.pdbx_gene_src_fragment _entity_src_gen.pdbx_gene_src_scientific_name _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id _entity_src_gen.pdbx_gene_src_variant _entity_src_gen.pdbx_gene_src_cell_line _entity_src_gen.pdbx_gene_src_atcc _entity_src_gen.pdbx_gene_src_organ _entity_src_gen.pdbx_gene_src_organelle _entity_src_gen.pdbx_gene_src_cell _entity_src_gen.pdbx_gene_src_cellular_location _entity_src_gen.host_org_common_name _entity_src_gen.pdbx_host_org_scientific_name _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id _entity_src_gen.host_org_genus _entity_src_gen.pdbx_host_org_gene _entity_src_gen.pdbx_host_org_organ _entity_src_gen.host_org_species _entity_src_gen.pdbx_host_org_tissue _entity_src_gen.pdbx_host_org_tissue_fraction _entity_src_gen.pdbx_host_org_strain _entity_src_gen.pdbx_host_org_variant _entity_src_gen.pdbx_host_org_cell_line _entity_src_gen.pdbx_host_org_atcc _entity_src_gen.pdbx_host_org_culture_collection _entity_src_gen.pdbx_host_org_cell _entity_src_gen.pdbx_host_org_organelle _entity_src_gen.pdbx_host_org_cellular_location _entity_src_gen.pdbx_host_org_vector_type _entity_src_gen.pdbx_host_org_vector _entity_src_gen.host_org_details _entity_src_gen.expression_system_id _entity_src_gen.plasmid_name _entity_src_gen.plasmid_details _entity_src_gen.pdbx_description 1 1 sample 'Biological sequence' 1 211 ? ? ? ? ? ? ? ? ? 'Mus musculus' 10090 ? ? ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 293_6E ? ? ? ? ? ? ? ? ? ? ? ? 2 1 sample 'Biological sequence' 1 221 ? ? ? ? ? ? ? ? ? 'Mus musculus' 10090 ? ? ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 293_6E ? ? ? ? ? ? ? ? ? ? ? ? 3 1 sample 'Biological sequence' 1 35 human ? 'TNFRSF17, BCM, BCMA' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli BL21(DE3)' 469008 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CU non-polymer . 'COPPER (II) ION' ? 'Cu 2' 63.546 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLU 1 1 1 GLU GLU L . n A 1 2 ILE 2 2 2 ILE ILE L . n A 1 3 VAL 3 3 3 VAL VAL L . n A 1 4 MET 4 4 4 MET MET L . n A 1 5 THR 5 5 5 THR THR L . n A 1 6 GLN 6 6 6 GLN GLN L . n A 1 7 SER 7 7 7 SER SER L . n A 1 8 PRO 8 8 8 PRO PRO L . n A 1 9 ALA 9 9 9 ALA ALA L . n A 1 10 THR 10 10 10 THR THR L . n A 1 11 LEU 11 11 11 LEU LEU L . n A 1 12 SER 12 12 12 SER SER L . n A 1 13 VAL 13 13 13 VAL VAL L . n A 1 14 SER 14 14 14 SER SER L . n A 1 15 PRO 15 15 15 PRO PRO L . n A 1 16 GLY 16 16 16 GLY GLY L . n A 1 17 GLU 17 17 17 GLU GLU L . n A 1 18 ARG 18 18 18 ARG ARG L . n A 1 19 ALA 19 19 19 ALA ALA L . n A 1 20 THR 20 20 20 THR THR L . n A 1 21 LEU 21 21 21 LEU LEU L . n A 1 22 SER 22 22 22 SER SER L . n A 1 23 CYS 23 23 23 CYS CYS L . n A 1 24 LYS 24 24 24 LYS LYS L . n A 1 25 ALA 25 25 25 ALA ALA L . n A 1 26 SER 26 26 26 SER SER L . n A 1 27 GLN 27 27 27 GLN GLN L . n A 1 28 SER 28 28 28 SER SER L . n A 1 29 VAL 29 29 29 VAL VAL L . n A 1 30 ASP 30 30 30 ASP ASP L . n A 1 31 SER 31 31 31 SER SER L . n A 1 32 ASN 32 32 32 ASN ASN L . n A 1 33 VAL 33 33 33 VAL VAL L . n A 1 34 ALA 34 34 34 ALA ALA L . n A 1 35 TRP 35 35 35 TRP TRP L . n A 1 36 TYR 36 36 36 TYR TYR L . n A 1 37 GLN 37 37 37 GLN GLN L . n A 1 38 GLN 38 38 38 GLN GLN L . n A 1 39 LYS 39 39 39 LYS LYS L . n A 1 40 PRO 40 40 40 PRO PRO L . n A 1 41 GLY 41 41 41 GLY GLY L . n A 1 42 GLN 42 42 42 GLN GLN L . n A 1 43 ALA 43 43 43 ALA ALA L . n A 1 44 PRO 44 44 44 PRO PRO L . n A 1 45 ARG 45 45 45 ARG ARG L . n A 1 46 ALA 46 46 46 ALA ALA L . n A 1 47 LEU 47 47 47 LEU LEU L . n A 1 48 ILE 48 48 48 ILE ILE L . n A 1 49 TYR 49 49 49 TYR TYR L . n A 1 50 SER 50 50 50 SER SER L . n A 1 51 ALA 51 51 51 ALA ALA L . n A 1 52 SER 52 52 52 SER SER L . n A 1 53 LEU 53 53 53 LEU LEU L . n A 1 54 ARG 54 54 54 ARG ARG L . n A 1 55 PHE 55 55 55 PHE PHE L . n A 1 56 SER 56 56 56 SER SER L . n A 1 57 GLY 57 57 57 GLY GLY L . n A 1 58 ILE 58 58 58 ILE ILE L . n A 1 59 PRO 59 59 59 PRO PRO L . n A 1 60 ALA 60 60 60 ALA ALA L . n A 1 61 ARG 61 61 61 ARG ARG L . n A 1 62 PHE 62 62 62 PHE PHE L . n A 1 63 SER 63 63 63 SER SER L . n A 1 64 GLY 64 64 64 GLY GLY L . n A 1 65 SER 65 65 65 SER SER L . n A 1 66 GLY 66 66 66 GLY GLY L . n A 1 67 SER 67 67 67 SER SER L . n A 1 68 GLY 68 68 68 GLY GLY L . n A 1 69 THR 69 69 69 THR THR L . n A 1 70 GLU 70 70 70 GLU GLU L . n A 1 71 PHE 71 71 71 PHE PHE L . n A 1 72 THR 72 72 72 THR THR L . n A 1 73 LEU 73 73 73 LEU LEU L . n A 1 74 THR 74 74 74 THR THR L . n A 1 75 ILE 75 75 75 ILE ILE L . n A 1 76 SER 76 76 76 SER SER L . n A 1 77 SER 77 77 77 SER SER L . n A 1 78 LEU 78 78 78 LEU LEU L . n A 1 79 GLN 79 79 79 GLN GLN L . n A 1 80 SER 80 80 80 SER SER L . n A 1 81 GLU 81 81 81 GLU GLU L . n A 1 82 ASP 82 82 82 ASP ASP L . n A 1 83 PHE 83 83 83 PHE PHE L . n A 1 84 ALA 84 84 84 ALA ALA L . n A 1 85 VAL 85 85 85 VAL VAL L . n A 1 86 TYR 86 86 86 TYR TYR L . n A 1 87 TYR 87 87 87 TYR TYR L . n A 1 88 CYS 88 88 88 CYS CYS L . n A 1 89 GLN 89 89 89 GLN GLN L . n A 1 90 GLN 90 90 90 GLN GLN L . n A 1 91 TYR 91 91 91 TYR TYR L . n A 1 92 ASN 92 92 92 ASN ASN L . n A 1 93 ASN 93 93 93 ASN ASN L . n A 1 94 TYR 94 94 94 TYR TYR L . n A 1 95 PRO 95 95 95 PRO PRO L . n A 1 96 LEU 96 96 96 LEU LEU L . n A 1 97 THR 97 97 97 THR THR L . n A 1 98 PHE 98 98 98 PHE PHE L . n A 1 99 GLY 99 99 99 GLY GLY L . n A 1 100 ALA 100 100 100 ALA ALA L . n A 1 101 GLY 101 101 101 GLY GLY L . n A 1 102 THR 102 102 102 THR THR L . n A 1 103 LYS 103 103 103 LYS LYS L . n A 1 104 LEU 104 104 104 LEU LEU L . n A 1 105 GLU 105 105 105 GLU GLU L . n A 1 106 LEU 106 106 106 LEU LEU L . n A 1 107 LYS 107 107 107 LYS LYS L . n A 1 108 ARG 108 108 108 ARG ARG L . n A 1 109 THR 109 109 109 THR THR L . n A 1 110 VAL 110 110 110 VAL VAL L . n A 1 111 ALA 111 111 111 ALA ALA L . n A 1 112 ALA 112 112 112 ALA ALA L . n A 1 113 PRO 113 113 113 PRO PRO L . n A 1 114 SER 114 114 114 SER SER L . n A 1 115 VAL 115 115 115 VAL VAL L . n A 1 116 PHE 116 116 116 PHE PHE L . n A 1 117 ILE 117 117 117 ILE ILE L . n A 1 118 PHE 118 118 118 PHE PHE L . n A 1 119 PRO 119 119 119 PRO PRO L . n A 1 120 PRO 120 120 120 PRO PRO L . n A 1 121 SER 121 121 121 SER SER L . n A 1 122 ASP 122 122 122 ASP ASP L . n A 1 123 GLU 123 123 123 GLU GLU L . n A 1 124 GLN 124 124 124 GLN GLN L . n A 1 125 LEU 125 125 125 LEU LEU L . n A 1 126 LYS 126 126 126 LYS LYS L . n A 1 127 SER 127 127 127 SER SER L . n A 1 128 GLY 128 128 128 GLY GLY L . n A 1 129 THR 129 129 129 THR THR L . n A 1 130 ALA 130 130 130 ALA ALA L . n A 1 131 SER 131 131 131 SER SER L . n A 1 132 VAL 132 132 132 VAL VAL L . n A 1 133 VAL 133 133 133 VAL VAL L . n A 1 134 CYS 134 134 134 CYS CYS L . n A 1 135 LEU 135 135 135 LEU LEU L . n A 1 136 LEU 136 136 136 LEU LEU L . n A 1 137 ASN 137 137 137 ASN ASN L . n A 1 138 ASN 138 138 138 ASN ASN L . n A 1 139 PHE 139 139 139 PHE PHE L . n A 1 140 TYR 140 140 140 TYR TYR L . n A 1 141 PRO 141 141 141 PRO PRO L . n A 1 142 ARG 142 142 142 ARG ARG L . n A 1 143 GLU 143 143 143 GLU GLU L . n A 1 144 ALA 144 144 144 ALA ALA L . n A 1 145 LYS 145 145 145 LYS LYS L . n A 1 146 VAL 146 146 146 VAL VAL L . n A 1 147 GLN 147 147 147 GLN GLN L . n A 1 148 TRP 148 148 148 TRP TRP L . n A 1 149 LYS 149 149 149 LYS LYS L . n A 1 150 VAL 150 150 150 VAL VAL L . n A 1 151 ASP 151 151 151 ASP ASP L . n A 1 152 ASN 152 152 152 ASN ASN L . n A 1 153 ALA 153 153 153 ALA ALA L . n A 1 154 LEU 154 154 154 LEU LEU L . n A 1 155 GLN 155 155 155 GLN GLN L . n A 1 156 SER 156 156 156 SER SER L . n A 1 157 GLY 157 157 157 GLY GLY L . n A 1 158 ASN 158 158 158 ASN ASN L . n A 1 159 SER 159 159 159 SER SER L . n A 1 160 GLN 160 160 160 GLN GLN L . n A 1 161 GLU 161 161 161 GLU GLU L . n A 1 162 SER 162 162 162 SER SER L . n A 1 163 VAL 163 163 163 VAL VAL L . n A 1 164 THR 164 164 164 THR THR L . n A 1 165 GLU 165 165 165 GLU GLU L . n A 1 166 GLN 166 166 166 GLN GLN L . n A 1 167 ASP 167 167 167 ASP ASP L . n A 1 168 SER 168 168 168 SER SER L . n A 1 169 LYS 169 169 169 LYS LYS L . n A 1 170 ASP 170 170 170 ASP ASP L . n A 1 171 SER 171 171 171 SER SER L . n A 1 172 THR 172 172 172 THR THR L . n A 1 173 TYR 173 173 173 TYR TYR L . n A 1 174 SER 174 174 174 SER SER L . n A 1 175 LEU 175 175 175 LEU LEU L . n A 1 176 SER 176 176 176 SER SER L . n A 1 177 SER 177 177 177 SER SER L . n A 1 178 THR 178 178 178 THR THR L . n A 1 179 LEU 179 179 179 LEU LEU L . n A 1 180 THR 180 180 180 THR THR L . n A 1 181 LEU 181 181 181 LEU LEU L . n A 1 182 SER 182 182 182 SER SER L . n A 1 183 LYS 183 183 183 LYS LYS L . n A 1 184 ALA 184 184 184 ALA ALA L . n A 1 185 ASP 185 185 185 ASP ASP L . n A 1 186 TYR 186 186 186 TYR TYR L . n A 1 187 GLU 187 187 187 GLU GLU L . n A 1 188 LYS 188 188 188 LYS LYS L . n A 1 189 HIS 189 189 189 HIS HIS L . n A 1 190 LYS 190 190 190 LYS LYS L . n A 1 191 VAL 191 191 191 VAL VAL L . n A 1 192 TYR 192 192 192 TYR TYR L . n A 1 193 ALA 193 193 193 ALA ALA L . n A 1 194 CYS 194 194 194 CYS CYS L . n A 1 195 GLU 195 195 195 GLU GLU L . n A 1 196 VAL 196 196 196 VAL VAL L . n A 1 197 THR 197 197 197 THR THR L . n A 1 198 HIS 198 198 198 HIS HIS L . n A 1 199 GLN 199 199 199 GLN GLN L . n A 1 200 GLY 200 200 200 GLY GLY L . n A 1 201 LEU 201 201 201 LEU LEU L . n A 1 202 SER 202 202 202 SER SER L . n A 1 203 SER 203 203 203 SER SER L . n A 1 204 PRO 204 204 204 PRO PRO L . n A 1 205 VAL 205 205 205 VAL VAL L . n A 1 206 THR 206 206 206 THR THR L . n A 1 207 LYS 207 207 207 LYS LYS L . n A 1 208 SER 208 208 208 SER SER L . n A 1 209 PHE 209 209 209 PHE PHE L . n A 1 210 ASN 210 210 210 ASN ASN L . n A 1 211 ARG 211 211 211 ARG ARG L . n B 2 1 GLU 1 1 1 GLU GLU H . n B 2 2 VAL 2 2 2 VAL VAL H . n B 2 3 GLN 3 3 3 GLN GLN H . n B 2 4 LEU 4 4 4 LEU LEU H . n B 2 5 VAL 5 5 5 VAL VAL H . n B 2 6 GLU 6 6 6 GLU GLU H . n B 2 7 SER 7 7 7 SER SER H . n B 2 8 GLY 8 8 8 GLY GLY H . n B 2 9 GLY 9 9 9 GLY GLY H . n B 2 10 GLY 10 10 10 GLY GLY H . n B 2 11 LEU 11 11 11 LEU LEU H . n B 2 12 VAL 12 12 12 VAL VAL H . n B 2 13 GLN 13 13 13 GLN GLN H . n B 2 14 PRO 14 14 14 PRO PRO H . n B 2 15 GLY 15 15 15 GLY GLY H . n B 2 16 GLY 16 16 16 GLY GLY H . n B 2 17 SER 17 17 17 SER SER H . n B 2 18 LEU 18 18 18 LEU LEU H . n B 2 19 ARG 19 19 19 ARG ARG H . n B 2 20 LEU 20 20 20 LEU LEU H . n B 2 21 SER 21 21 21 SER SER H . n B 2 22 CYS 22 22 22 CYS CYS H . n B 2 23 ALA 23 23 23 ALA ALA H . n B 2 24 ALA 24 24 24 ALA ALA H . n B 2 25 SER 25 25 25 SER SER H . n B 2 26 GLY 26 26 26 GLY GLY H . n B 2 27 PHE 27 27 27 PHE PHE H . n B 2 28 THR 28 28 28 THR THR H . n B 2 29 PHE 29 29 29 PHE PHE H . n B 2 30 SER 30 30 30 SER SER H . n B 2 31 ARG 31 31 31 ARG ARG H . n B 2 32 TYR 32 32 32 TYR TYR H . n B 2 33 TRP 33 33 33 TRP TRP H . n B 2 34 MET 34 34 34 MET MET H . n B 2 35 SER 35 35 35 SER SER H . n B 2 36 TRP 36 36 36 TRP TRP H . n B 2 37 VAL 37 37 37 VAL VAL H . n B 2 38 ARG 38 38 38 ARG ARG H . n B 2 39 GLN 39 39 39 GLN GLN H . n B 2 40 ALA 40 40 40 ALA ALA H . n B 2 41 PRO 41 41 41 PRO PRO H . n B 2 42 GLY 42 42 42 GLY GLY H . n B 2 43 LYS 43 43 43 LYS LYS H . n B 2 44 GLY 44 44 44 GLY GLY H . n B 2 45 LEU 45 45 45 LEU LEU H . n B 2 46 VAL 46 46 46 VAL VAL H . n B 2 47 TRP 47 47 47 TRP TRP H . n B 2 48 VAL 48 48 48 VAL VAL H . n B 2 49 GLY 49 49 49 GLY GLY H . n B 2 50 GLU 50 50 50 GLU GLU H . n B 2 51 ILE 51 51 51 ILE ILE H . n B 2 52 ASN 52 52 52 ASN ASN H . n B 2 53 PRO 53 53 53 PRO PRO H . n B 2 54 ASP 54 54 54 ASP ASP H . n B 2 55 SER 55 55 55 SER SER H . n B 2 56 SER 56 56 56 SER SER H . n B 2 57 THR 57 57 57 THR THR H . n B 2 58 ILE 58 58 58 ILE ILE H . n B 2 59 ASN 59 59 59 ASN ASN H . n B 2 60 TYR 60 60 60 TYR TYR H . n B 2 61 ALA 61 61 61 ALA ALA H . n B 2 62 PRO 62 62 62 PRO PRO H . n B 2 63 SER 63 63 63 SER SER H . n B 2 64 LEU 64 64 64 LEU LEU H . n B 2 65 LYS 65 65 65 LYS LYS H . n B 2 66 ASP 66 66 66 ASP ASP H . n B 2 67 LYS 67 67 67 LYS LYS H . n B 2 68 PHE 68 68 68 PHE PHE H . n B 2 69 THR 69 69 69 THR THR H . n B 2 70 ILE 70 70 70 ILE ILE H . n B 2 71 SER 71 71 71 SER SER H . n B 2 72 ARG 72 72 72 ARG ARG H . n B 2 73 ASP 73 73 73 ASP ASP H . n B 2 74 ASN 74 74 74 ASN ASN H . n B 2 75 ALA 75 75 75 ALA ALA H . n B 2 76 LYS 76 76 76 LYS LYS H . n B 2 77 ASN 77 77 77 ASN ASN H . n B 2 78 THR 78 78 78 THR THR H . n B 2 79 LEU 79 79 79 LEU LEU H . n B 2 80 TYR 80 80 80 TYR TYR H . n B 2 81 LEU 81 81 81 LEU LEU H . n B 2 82 GLN 82 82 82 GLN GLN H . n B 2 83 MET 83 83 83 MET MET H . n B 2 84 ASN 84 84 84 ASN ASN H . n B 2 85 SER 85 85 85 SER SER H . n B 2 86 LEU 86 86 86 LEU LEU H . n B 2 87 ARG 87 87 87 ARG ARG H . n B 2 88 ALA 88 88 88 ALA ALA H . n B 2 89 GLU 89 89 89 GLU GLU H . n B 2 90 ASP 90 90 90 ASP ASP H . n B 2 91 THR 91 91 91 THR THR H . n B 2 92 ALA 92 92 92 ALA ALA H . n B 2 93 VAL 93 93 93 VAL VAL H . n B 2 94 TYR 94 94 94 TYR TYR H . n B 2 95 TYR 95 95 95 TYR TYR H . n B 2 96 CYS 96 96 96 CYS CYS H . n B 2 97 ALA 97 97 97 ALA ALA H . n B 2 98 SER 98 98 98 SER SER H . n B 2 99 LEU 99 99 99 LEU LEU H . n B 2 100 TYR 100 100 100 TYR TYR H . n B 2 101 TYR 101 101 101 TYR TYR H . n B 2 102 ASP 102 102 102 ASP ASP H . n B 2 103 TYR 103 103 103 TYR TYR H . n B 2 104 GLY 104 104 104 GLY GLY H . n B 2 105 ASP 105 105 105 ASP ASP H . n B 2 106 ALA 106 106 106 ALA ALA H . n B 2 107 MET 107 107 107 MET MET H . n B 2 108 ASP 108 108 108 ASP ASP H . n B 2 109 TYR 109 109 109 TYR TYR H . n B 2 110 TRP 110 110 110 TRP TRP H . n B 2 111 GLY 111 111 111 GLY GLY H . n B 2 112 GLN 112 112 112 GLN GLN H . n B 2 113 GLY 113 113 113 GLY GLY H . n B 2 114 THR 114 114 114 THR THR H . n B 2 115 LEU 115 115 115 LEU LEU H . n B 2 116 VAL 116 116 116 VAL VAL H . n B 2 117 THR 117 117 117 THR THR H . n B 2 118 VAL 118 118 118 VAL VAL H . n B 2 119 SER 119 119 119 SER SER H . n B 2 120 SER 120 120 120 SER SER H . n B 2 121 ALA 121 121 121 ALA ALA H . n B 2 122 SER 122 122 122 SER SER H . n B 2 123 THR 123 123 123 THR THR H . n B 2 124 LYS 124 124 124 LYS LYS H . n B 2 125 GLY 125 125 125 GLY GLY H . n B 2 126 PRO 126 126 126 PRO PRO H . n B 2 127 SER 127 127 127 SER SER H . n B 2 128 VAL 128 128 128 VAL VAL H . n B 2 129 PHE 129 129 129 PHE PHE H . n B 2 130 PRO 130 130 130 PRO PRO H . n B 2 131 LEU 131 131 131 LEU LEU H . n B 2 132 ALA 132 132 132 ALA ALA H . n B 2 133 PRO 133 133 133 PRO PRO H . n B 2 134 SER 134 134 134 SER SER H . n B 2 135 SER 135 135 ? ? ? H . n B 2 136 LYS 136 136 ? ? ? H . n B 2 137 SER 137 137 ? ? ? H . n B 2 138 THR 138 138 ? ? ? H . n B 2 139 SER 139 139 ? ? ? H . n B 2 140 GLY 140 140 ? ? ? H . n B 2 141 GLY 141 141 141 GLY GLY H . n B 2 142 THR 142 142 142 THR THR H . n B 2 143 ALA 143 143 143 ALA ALA H . n B 2 144 ALA 144 144 144 ALA ALA H . n B 2 145 LEU 145 145 145 LEU LEU H . n B 2 146 GLY 146 146 146 GLY GLY H . n B 2 147 CYS 147 147 147 CYS CYS H . n B 2 148 LEU 148 148 148 LEU LEU H . n B 2 149 VAL 149 149 149 VAL VAL H . n B 2 150 LYS 150 150 150 LYS LYS H . n B 2 151 ASP 151 151 151 ASP ASP H . n B 2 152 TYR 152 152 152 TYR TYR H . n B 2 153 PHE 153 153 153 PHE PHE H . n B 2 154 PRO 154 154 154 PRO PRO H . n B 2 155 GLU 155 155 155 GLU GLU H . n B 2 156 PRO 156 156 156 PRO PRO H . n B 2 157 VAL 157 157 157 VAL VAL H . n B 2 158 THR 158 158 158 THR THR H . n B 2 159 VAL 159 159 159 VAL VAL H . n B 2 160 SER 160 160 160 SER SER H . n B 2 161 TRP 161 161 161 TRP TRP H . n B 2 162 ASN 162 162 162 ASN ASN H . n B 2 163 SER 163 163 163 SER SER H . n B 2 164 GLY 164 164 164 GLY GLY H . n B 2 165 ALA 165 165 165 ALA ALA H . n B 2 166 LEU 166 166 166 LEU LEU H . n B 2 167 THR 167 167 167 THR THR H . n B 2 168 SER 168 168 168 SER SER H . n B 2 169 GLY 169 169 169 GLY GLY H . n B 2 170 VAL 170 170 170 VAL VAL H . n B 2 171 HIS 171 171 171 HIS HIS H . n B 2 172 THR 172 172 172 THR THR H . n B 2 173 PHE 173 173 173 PHE PHE H . n B 2 174 PRO 174 174 174 PRO PRO H . n B 2 175 ALA 175 175 175 ALA ALA H . n B 2 176 VAL 176 176 176 VAL VAL H . n B 2 177 LEU 177 177 177 LEU LEU H . n B 2 178 GLN 178 178 178 GLN GLN H . n B 2 179 SER 179 179 179 SER SER H . n B 2 180 SER 180 180 180 SER SER H . n B 2 181 GLY 181 181 181 GLY GLY H . n B 2 182 LEU 182 182 182 LEU LEU H . n B 2 183 TYR 183 183 183 TYR TYR H . n B 2 184 SER 184 184 184 SER SER H . n B 2 185 LEU 185 185 185 LEU LEU H . n B 2 186 SER 186 186 186 SER SER H . n B 2 187 SER 187 187 187 SER SER H . n B 2 188 VAL 188 188 188 VAL VAL H . n B 2 189 VAL 189 189 189 VAL VAL H . n B 2 190 THR 190 190 190 THR THR H . n B 2 191 VAL 191 191 191 VAL VAL H . n B 2 192 PRO 192 192 192 PRO PRO H . n B 2 193 SER 193 193 193 SER SER H . n B 2 194 SER 194 194 194 SER SER H . n B 2 195 SER 195 195 195 SER SER H . n B 2 196 LEU 196 196 196 LEU LEU H . n B 2 197 GLY 197 197 197 GLY GLY H . n B 2 198 THR 198 198 198 THR THR H . n B 2 199 GLN 199 199 199 GLN GLN H . n B 2 200 THR 200 200 200 THR THR H . n B 2 201 TYR 201 201 201 TYR TYR H . n B 2 202 ILE 202 202 202 ILE ILE H . n B 2 203 CYS 203 203 203 CYS CYS H . n B 2 204 ASN 204 204 204 ASN ASN H . n B 2 205 VAL 205 205 205 VAL VAL H . n B 2 206 ASN 206 206 206 ASN ASN H . n B 2 207 HIS 207 207 207 HIS HIS H . n B 2 208 LYS 208 208 208 LYS LYS H . n B 2 209 PRO 209 209 209 PRO PRO H . n B 2 210 SER 210 210 210 SER SER H . n B 2 211 ASN 211 211 211 ASN ASN H . n B 2 212 THR 212 212 212 THR THR H . n B 2 213 LYS 213 213 213 LYS LYS H . n B 2 214 VAL 214 214 214 VAL VAL H . n B 2 215 ASP 215 215 215 ASP ASP H . n B 2 216 LYS 216 216 216 LYS LYS H . n B 2 217 ARG 217 217 217 ARG ARG H . n B 2 218 VAL 218 218 218 VAL VAL H . n B 2 219 GLU 219 219 219 GLU GLU H . n B 2 220 PRO 220 220 220 PRO PRO H . n B 2 221 ALA 221 221 221 ALA ALA H . n C 3 1 GLN 1 7 7 GLN GLN A . n C 3 2 CYS 2 8 8 CYS CYS A . n C 3 3 SER 3 9 9 SER SER A . n C 3 4 ALA 4 10 10 ALA ALA A . n C 3 5 ASN 5 11 11 ASN ASN A . n C 3 6 GLU 6 12 12 GLU GLU A . n C 3 7 TYR 7 13 13 TYR TYR A . n C 3 8 PHE 8 14 14 PHE PHE A . n C 3 9 ASP 9 15 15 ASP ASP A . n C 3 10 SER 10 16 16 SER SER A . n C 3 11 LEU 11 17 17 LEU LEU A . n C 3 12 LEU 12 18 18 LEU LEU A . n C 3 13 HIS 13 19 19 HIS HIS A . n C 3 14 ALA 14 20 20 ALA ALA A . n C 3 15 CYS 15 21 21 CYS CYS A . n C 3 16 ILE 16 22 22 ILE ILE A . n C 3 17 PRO 17 23 23 PRO PRO A . n C 3 18 CYS 18 24 24 CYS CYS A . n C 3 19 GLN 19 25 25 GLN GLN A . n C 3 20 LEU 20 26 26 LEU LEU A . n C 3 21 ARG 21 27 27 ARG ARG A . n C 3 22 CYS 22 28 28 CYS CYS A . n C 3 23 SER 23 29 29 SER SER A . n C 3 24 SER 24 30 30 SER SER A . n C 3 25 ALA 25 31 31 ALA ALA A . n C 3 26 THR 26 32 32 THR THR A . n C 3 27 PRO 27 33 33 PRO PRO A . n C 3 28 PRO 28 34 34 PRO PRO A . n C 3 29 ALA 29 35 35 ALA ALA A . n C 3 30 THR 30 36 36 THR THR A . n C 3 31 CYS 31 37 37 CYS CYS A . n C 3 32 ALA 32 38 38 ALA ALA A . n C 3 33 ALA 33 39 39 ALA ALA A . n C 3 34 TYR 34 40 40 TYR TYR A . n C 3 35 CYS 35 41 41 CYS CYS A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code D 4 CU 1 301 2 CU CU L . E 4 CU 1 301 3 CU CU H . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.21.1-5286 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 121.023 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 8QY9 _cell.details ? _cell.formula_units_Z ? _cell.length_a 137.360 _cell.length_a_esd ? _cell.length_b 55.180 _cell.length_b_esd ? _cell.length_c 81.160 _cell.length_c_esd ? _cell.volume 527162.868 _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 8QY9 _symmetry.cell_setting ? _symmetry.Int_Tables_number 5 _symmetry.space_group_name_Hall 'C 2y' _symmetry.space_group_name_H-M 'C 1 2 1' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 8QY9 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.65 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 53.52 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 6.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details ;14% PEG 3350 100 mM BisTris 7.5 mM Cu(II) ; _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 293.15 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2014-11-21 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9184 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'BESSY BEAMLINE 14.2' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9184 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 14.2 _diffrn_source.pdbx_synchrotron_site BESSY # _reflns.B_iso_Wilson_estimate 68.29 _reflns.entry_id 8QY9 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 3.1 _reflns.d_resolution_low 34.78 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 9584 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.19 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 4.14 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 6.54 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.985 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 3.1 _reflns_shell.d_res_low 3.211 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 942 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.611 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.percent_possible_all 99.37 _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 67.15 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 8QY9 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 3.10 _refine.ls_d_res_low 34.78 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 9580 _refine.ls_number_reflns_R_free 480 _refine.ls_number_reflns_R_work 9100 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.28 _refine.ls_percent_reflns_R_free 5.01 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2560 _refine.ls_R_factor_R_free 0.3011 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2535 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.35 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values 'GeoStd + Monomer Library + CDL v1.2' _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1000 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 34.9704 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.4842 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 3.10 _refine_hist.d_res_low 34.78 _refine_hist.number_atoms_solvent 0 _refine_hist.number_atoms_total 3498 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 3496 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 2 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.0019 ? 3585 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.4452 ? 4885 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.0412 ? 551 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.0045 ? 628 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 11.7145 ? 1275 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free _refine_ls_shell.R_factor_R_free 'X-RAY DIFFRACTION' 3.10 3.55 . . 157 2984 99.52 . . . . 0.3344 . . . . . . . . . . . 0.3776 'X-RAY DIFFRACTION' 3.55 4.47 . . 159 3010 98.69 . . . . 0.2924 . . . . . . . . . . . 0.3350 'X-RAY DIFFRACTION' 4.47 34.78 . . 164 3106 99.66 . . . . 0.1992 . . . . . . . . . . . 0.2509 # _struct.entry_id 8QY9 _struct.title 'J22.9-H, fully humanized Fab Fragment based on chimeric J22.9-xi IgG against BCMA' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 8QY9 _struct_keywords.text 'Fab fragment, humanized, BCMA binding, IMMUNE SYSTEM' _struct_keywords.pdbx_keywords 'IMMUNE SYSTEM' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? E N N 4 ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 PDB 8QY9 8QY9 ? 1 ? 1 2 PDB 8QY9 8QY9 ? 2 ? 1 3 UNP TNR17_HUMAN Q02223 ? 3 QCSQNEYFDSLLHACIPCQLRCSSNTPPLTCQRYC 7 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 8QY9 L 1 ? 211 ? 8QY9 1 ? 211 ? 1 211 2 2 8QY9 H 1 ? 221 ? 8QY9 1 ? 221 ? 1 221 3 3 8QY9 A 1 ? 35 ? Q02223 7 ? 41 ? 7 41 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 3 8QY9 ALA A 4 ? UNP Q02223 GLN 10 'engineered mutation' 10 1 3 8QY9 ALA A 25 ? UNP Q02223 ASN 31 'engineered mutation' 31 2 3 8QY9 ALA A 29 ? UNP Q02223 LEU 35 'engineered mutation' 35 3 3 8QY9 ALA A 32 ? UNP Q02223 GLN 38 'engineered mutation' 38 4 3 8QY9 ALA A 33 ? UNP Q02223 ARG 39 'engineered mutation' 39 5 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details trimeric _pdbx_struct_assembly.oligomeric_count 3 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 4880 ? 1 MORE -48 ? 1 'SSA (A^2)' 20590 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'surface plasmon resonance' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 GLN A 79 ? PHE A 83 ? GLN L 79 PHE L 83 5 ? 5 HELX_P HELX_P2 AA2 SER A 121 ? GLY A 128 ? SER L 121 GLY L 128 1 ? 8 HELX_P HELX_P3 AA3 LYS A 183 ? LYS A 188 ? LYS L 183 LYS L 188 1 ? 6 HELX_P HELX_P4 AA4 THR B 28 ? TYR B 32 ? THR H 28 TYR H 32 5 ? 5 HELX_P HELX_P5 AA5 ASN B 74 ? LYS B 76 ? ASN H 74 LYS H 76 5 ? 3 HELX_P HELX_P6 AA6 ARG B 87 ? THR B 91 ? ARG H 87 THR H 91 5 ? 5 HELX_P HELX_P7 AA7 TRP B 161 ? ALA B 165 ? TRP H 161 ALA H 165 5 ? 5 HELX_P HELX_P8 AA8 CYS C 18 ? SER C 23 ? CYS A 24 SER A 29 1 ? 6 HELX_P HELX_P9 AA9 ALA C 29 ? ALA C 33 ? ALA A 35 ALA A 39 5 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 23 SG ? ? ? 1_555 A CYS 88 SG ? ? L CYS 23 L CYS 88 1_555 ? ? ? ? ? ? ? 2.034 ? ? disulf2 disulf ? ? A CYS 134 SG ? ? ? 1_555 A CYS 194 SG ? ? L CYS 134 L CYS 194 1_555 ? ? ? ? ? ? ? 2.031 ? ? disulf3 disulf ? ? B CYS 22 SG ? ? ? 1_555 B CYS 96 SG ? ? H CYS 22 H CYS 96 1_555 ? ? ? ? ? ? ? 2.031 ? ? disulf4 disulf ? ? B CYS 147 SG ? ? ? 1_555 B CYS 203 SG ? ? H CYS 147 H CYS 203 1_555 ? ? ? ? ? ? ? 2.035 ? ? disulf5 disulf ? ? C CYS 2 SG ? ? ? 1_555 C CYS 15 SG ? ? A CYS 8 A CYS 21 1_555 ? ? ? ? ? ? ? 2.033 ? ? disulf6 disulf ? ? C CYS 18 SG ? ? ? 1_555 C CYS 31 SG ? ? A CYS 24 A CYS 37 1_555 ? ? ? ? ? ? ? 2.031 ? ? disulf7 disulf ? ? C CYS 22 SG ? ? ? 1_555 C CYS 35 SG ? ? A CYS 28 A CYS 41 1_555 ? ? ? ? ? ? ? 2.034 ? ? metalc1 metalc ? ? A GLU 1 N ? ? ? 1_555 D CU . CU ? ? L GLU 1 L CU 301 1_555 ? ? ? ? ? ? ? 2.062 ? ? metalc2 metalc ? ? A GLU 1 O ? ? ? 1_555 D CU . CU ? ? L GLU 1 L CU 301 1_555 ? ? ? ? ? ? ? 2.662 ? ? metalc3 metalc ? ? A ASN 137 OD1 ? ? ? 1_555 E CU . CU ? ? L ASN 137 H CU 301 1_555 ? ? ? ? ? ? ? 2.507 ? ? metalc4 metalc ? ? A ASN 137 ND2 ? ? ? 1_555 E CU . CU ? ? L ASN 137 H CU 301 1_555 ? ? ? ? ? ? ? 2.519 ? ? metalc5 metalc ? ? A HIS 189 NE2 ? ? ? 1_555 D CU . CU ? ? L HIS 189 L CU 301 4_546 ? ? ? ? ? ? ? 2.058 ? ? metalc6 metalc ? ? B GLU 1 OE2 ? ? ? 1_555 E CU . CU ? ? H GLU 1 H CU 301 2_556 ? ? ? ? ? ? ? 1.870 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference disulf ? ? metalc ? ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 N ? A GLU 1 ? L GLU 1 ? 1_555 CU ? D CU . ? L CU 301 ? 1_555 O ? A GLU 1 ? L GLU 1 ? 1_555 68.8 ? 2 N ? A GLU 1 ? L GLU 1 ? 1_555 CU ? D CU . ? L CU 301 ? 1_555 NE2 ? A HIS 189 ? L HIS 189 ? 1_555 37.7 ? 3 O ? A GLU 1 ? L GLU 1 ? 1_555 CU ? D CU . ? L CU 301 ? 1_555 NE2 ? A HIS 189 ? L HIS 189 ? 1_555 48.6 ? 4 OD1 ? A ASN 137 ? L ASN 137 ? 1_555 CU ? E CU . ? H CU 301 ? 1_555 ND2 ? A ASN 137 ? L ASN 137 ? 1_555 53.1 ? 5 OD1 ? A ASN 137 ? L ASN 137 ? 1_555 CU ? E CU . ? H CU 301 ? 1_555 OE2 ? B GLU 1 ? H GLU 1 ? 1_555 122.3 ? 6 ND2 ? A ASN 137 ? L ASN 137 ? 1_555 CU ? E CU . ? H CU 301 ? 1_555 OE2 ? B GLU 1 ? H GLU 1 ? 1_555 170.5 ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 SER 7 A . ? SER 7 L PRO 8 A ? PRO 8 L 1 -1.20 2 TYR 94 A . ? TYR 94 L PRO 95 A ? PRO 95 L 1 0.57 3 TYR 140 A . ? TYR 140 L PRO 141 A ? PRO 141 L 1 -0.55 4 PHE 153 B . ? PHE 153 H PRO 154 B ? PRO 154 H 1 -1.80 5 GLU 155 B . ? GLU 155 H PRO 156 B ? PRO 156 H 1 -4.84 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 4 ? AA2 ? 5 ? AA3 ? 4 ? AA4 ? 3 ? AA5 ? 4 ? AA6 ? 6 ? AA7 ? 2 ? AA8 ? 4 ? AA9 ? 3 ? AB1 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA2 1 2 ? parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel AA2 4 5 ? anti-parallel AA3 1 2 ? anti-parallel AA3 2 3 ? anti-parallel AA3 3 4 ? anti-parallel AA4 1 2 ? anti-parallel AA4 2 3 ? anti-parallel AA5 1 2 ? anti-parallel AA5 2 3 ? anti-parallel AA5 3 4 ? anti-parallel AA6 1 2 ? parallel AA6 2 3 ? anti-parallel AA6 3 4 ? anti-parallel AA6 4 5 ? anti-parallel AA6 5 6 ? anti-parallel AA7 1 2 ? anti-parallel AA8 1 2 ? anti-parallel AA8 2 3 ? anti-parallel AA8 3 4 ? anti-parallel AA9 1 2 ? anti-parallel AA9 2 3 ? anti-parallel AB1 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 MET A 4 ? SER A 7 ? MET L 4 SER L 7 AA1 2 ALA A 19 ? ALA A 25 ? ALA L 19 ALA L 25 AA1 3 GLU A 70 ? ILE A 75 ? GLU L 70 ILE L 75 AA1 4 PHE A 62 ? SER A 67 ? PHE L 62 SER L 67 AA2 1 THR A 10 ? VAL A 13 ? THR L 10 VAL L 13 AA2 2 THR A 102 ? LEU A 106 ? THR L 102 LEU L 106 AA2 3 VAL A 85 ? GLN A 90 ? VAL L 85 GLN L 90 AA2 4 VAL A 33 ? GLN A 38 ? VAL L 33 GLN L 38 AA2 5 ARG A 45 ? ILE A 48 ? ARG L 45 ILE L 48 AA3 1 SER A 114 ? PHE A 118 ? SER L 114 PHE L 118 AA3 2 THR A 129 ? PHE A 139 ? THR L 129 PHE L 139 AA3 3 TYR A 173 ? SER A 182 ? TYR L 173 SER L 182 AA3 4 SER A 159 ? VAL A 163 ? SER L 159 VAL L 163 AA4 1 LYS A 145 ? TRP A 148 ? LYS L 145 TRP L 148 AA4 2 TYR A 192 ? THR A 197 ? TYR L 192 THR L 197 AA4 3 VAL A 205 ? PHE A 209 ? VAL L 205 PHE L 209 AA5 1 GLN B 3 ? SER B 7 ? GLN H 3 SER H 7 AA5 2 LEU B 18 ? SER B 25 ? LEU H 18 SER H 25 AA5 3 THR B 78 ? MET B 83 ? THR H 78 MET H 83 AA5 4 PHE B 68 ? ASP B 73 ? PHE H 68 ASP H 73 AA6 1 LEU B 11 ? VAL B 12 ? LEU H 11 VAL H 12 AA6 2 THR B 114 ? VAL B 118 ? THR H 114 VAL H 118 AA6 3 ALA B 92 ? ALA B 97 ? ALA H 92 ALA H 97 AA6 4 MET B 34 ? GLN B 39 ? MET H 34 GLN H 39 AA6 5 LEU B 45 ? ILE B 51 ? LEU H 45 ILE H 51 AA6 6 ILE B 58 ? ASN B 59 ? ILE H 58 ASN H 59 AA7 1 TYR B 101 ? ASP B 102 ? TYR H 101 ASP H 102 AA7 2 ASP B 105 ? ALA B 106 ? ASP H 105 ALA H 106 AA8 1 SER B 127 ? LEU B 131 ? SER H 127 LEU H 131 AA8 2 THR B 142 ? TYR B 152 ? THR H 142 TYR H 152 AA8 3 TYR B 183 ? PRO B 192 ? TYR H 183 PRO H 192 AA8 4 VAL B 170 ? THR B 172 ? VAL H 170 THR H 172 AA9 1 THR B 158 ? VAL B 159 ? THR H 158 VAL H 159 AA9 2 TYR B 201 ? HIS B 207 ? TYR H 201 HIS H 207 AA9 3 THR B 212 ? VAL B 218 ? THR H 212 VAL H 218 AB1 1 GLU C 6 ? ASP C 9 ? GLU A 12 ASP A 15 AB1 2 ALA C 14 ? PRO C 17 ? ALA A 20 PRO A 23 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N THR A 5 ? N THR L 5 O LYS A 24 ? O LYS L 24 AA1 2 3 N CYS A 23 ? N CYS L 23 O PHE A 71 ? O PHE L 71 AA1 3 4 O THR A 74 ? O THR L 74 N SER A 63 ? N SER L 63 AA2 1 2 N VAL A 13 ? N VAL L 13 O GLU A 105 ? O GLU L 105 AA2 2 3 O THR A 102 ? O THR L 102 N TYR A 86 ? N TYR L 86 AA2 3 4 O TYR A 87 ? O TYR L 87 N TYR A 36 ? N TYR L 36 AA2 4 5 N GLN A 37 ? N GLN L 37 O ARG A 45 ? O ARG L 45 AA3 1 2 N PHE A 118 ? N PHE L 118 O VAL A 133 ? O VAL L 133 AA3 2 3 N ALA A 130 ? N ALA L 130 O LEU A 181 ? O LEU L 181 AA3 3 4 O SER A 176 ? O SER L 176 N SER A 162 ? N SER L 162 AA4 1 2 N GLN A 147 ? N GLN L 147 O GLU A 195 ? O GLU L 195 AA4 2 3 N VAL A 196 ? N VAL L 196 O VAL A 205 ? O VAL L 205 AA5 1 2 N VAL B 5 ? N VAL H 5 O ALA B 23 ? O ALA H 23 AA5 2 3 N LEU B 18 ? N LEU H 18 O MET B 83 ? O MET H 83 AA5 3 4 O GLN B 82 ? O GLN H 82 N THR B 69 ? N THR H 69 AA6 1 2 N VAL B 12 ? N VAL H 12 O THR B 117 ? O THR H 117 AA6 2 3 O THR B 114 ? O THR H 114 N TYR B 94 ? N TYR H 94 AA6 3 4 O TYR B 95 ? O TYR H 95 N VAL B 37 ? N VAL H 37 AA6 4 5 N ARG B 38 ? N ARG H 38 O VAL B 46 ? O VAL H 46 AA6 5 6 N GLU B 50 ? N GLU H 50 O ASN B 59 ? O ASN H 59 AA7 1 2 N ASP B 102 ? N ASP H 102 O ASP B 105 ? O ASP H 105 AA8 1 2 N PHE B 129 ? N PHE H 129 O LEU B 148 ? O LEU H 148 AA8 2 3 N TYR B 152 ? N TYR H 152 O TYR B 183 ? O TYR H 183 AA8 3 4 O VAL B 188 ? O VAL H 188 N HIS B 171 ? N HIS H 171 AA9 1 2 N THR B 158 ? N THR H 158 O ASN B 206 ? O ASN H 206 AA9 2 3 N VAL B 205 ? N VAL H 205 O VAL B 214 ? O VAL H 214 AB1 1 2 N TYR C 7 ? N TYR A 13 O ILE C 16 ? O ILE A 22 # _pdbx_entry_details.entry_id 8QY9 _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest N _pdbx_entry_details.has_protein_modification ? # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 O _pdbx_validate_close_contact.auth_asym_id_1 L _pdbx_validate_close_contact.auth_comp_id_1 TYR _pdbx_validate_close_contact.auth_seq_id_1 49 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 OH _pdbx_validate_close_contact.auth_asym_id_2 L _pdbx_validate_close_contact.auth_comp_id_2 TYR _pdbx_validate_close_contact.auth_seq_id_2 91 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 1.98 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP L 30 ? ? 58.32 -166.67 2 1 SER L 50 ? ? -107.00 47.19 3 1 ALA L 51 ? ? 78.92 -44.31 4 1 TYR L 91 ? ? -140.13 49.35 5 1 ASN L 93 ? ? -166.44 116.72 6 1 ALA L 111 ? ? -164.19 118.22 7 1 ASN L 138 ? ? 45.00 77.07 8 1 PRO L 141 ? ? -68.45 -174.10 9 1 LYS L 169 ? ? -103.89 -60.37 10 1 PHE L 209 ? ? -178.32 146.57 11 1 THR H 28 ? ? -68.38 85.36 12 1 VAL H 48 ? ? -128.09 -69.95 13 1 THR H 57 ? ? -166.89 96.48 14 1 ASP H 66 ? ? 71.49 -6.87 15 1 ASN H 77 ? ? 41.27 70.65 16 1 SER H 85 ? ? 46.46 72.30 17 1 ALA H 92 ? ? 178.53 168.93 18 1 SER H 98 ? ? -165.54 115.27 19 1 ASP H 108 ? ? -172.75 130.52 20 1 LEU H 145 ? ? -108.80 -169.41 21 1 CYS H 147 ? ? -173.09 102.90 22 1 ASP H 151 ? ? 61.74 84.32 23 1 SER H 163 ? ? 57.50 18.77 24 1 LEU H 196 ? ? -145.72 -67.46 25 1 PRO A 34 ? ? -59.67 -179.12 # loop_ _space_group_symop.id _space_group_symop.operation_xyz 1 x,y,z 2 -x,y,-z 3 x+1/2,y+1/2,z 4 -x+1/2,y+1/2,-z # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 H SER 135 ? B SER 135 2 1 Y 1 H LYS 136 ? B LYS 136 3 1 Y 1 H SER 137 ? B SER 137 4 1 Y 1 H THR 138 ? B THR 138 5 1 Y 1 H SER 139 ? B SER 139 6 1 Y 1 H GLY 140 ? B GLY 140 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CU CU CU N N 74 CYS N N N N 75 CYS CA C N R 76 CYS C C N N 77 CYS O O N N 78 CYS CB C N N 79 CYS SG S N N 80 CYS OXT O N N 81 CYS H H N N 82 CYS H2 H N N 83 CYS HA H N N 84 CYS HB2 H N N 85 CYS HB3 H N N 86 CYS HG H N N 87 CYS HXT H N N 88 GLN N N N N 89 GLN CA C N S 90 GLN C C N N 91 GLN O O N N 92 GLN CB C N N 93 GLN CG C N N 94 GLN CD C N N 95 GLN OE1 O N N 96 GLN NE2 N N N 97 GLN OXT O N N 98 GLN H H N N 99 GLN H2 H N N 100 GLN HA H N N 101 GLN HB2 H N N 102 GLN HB3 H N N 103 GLN HG2 H N N 104 GLN HG3 H N N 105 GLN HE21 H N N 106 GLN HE22 H N N 107 GLN HXT H N N 108 GLU N N N N 109 GLU CA C N S 110 GLU C C N N 111 GLU O O N N 112 GLU CB C N N 113 GLU CG C N N 114 GLU CD C N N 115 GLU OE1 O N N 116 GLU OE2 O N N 117 GLU OXT O N N 118 GLU H H N N 119 GLU H2 H N N 120 GLU HA H N N 121 GLU HB2 H N N 122 GLU HB3 H N N 123 GLU HG2 H N N 124 GLU HG3 H N N 125 GLU HE2 H N N 126 GLU HXT H N N 127 GLY N N N N 128 GLY CA C N N 129 GLY C C N N 130 GLY O O N N 131 GLY OXT O N N 132 GLY H H N N 133 GLY H2 H N N 134 GLY HA2 H N N 135 GLY HA3 H N N 136 GLY HXT H N N 137 HIS N N N N 138 HIS CA C N S 139 HIS C C N N 140 HIS O O N N 141 HIS CB C N N 142 HIS CG C Y N 143 HIS ND1 N Y N 144 HIS CD2 C Y N 145 HIS CE1 C Y N 146 HIS NE2 N Y N 147 HIS OXT O N N 148 HIS H H N N 149 HIS H2 H N N 150 HIS HA H N N 151 HIS HB2 H N N 152 HIS HB3 H N N 153 HIS HD1 H N N 154 HIS HD2 H N N 155 HIS HE1 H N N 156 HIS HE2 H N N 157 HIS HXT H N N 158 ILE N N N N 159 ILE CA C N S 160 ILE C C N N 161 ILE O O N N 162 ILE CB C N S 163 ILE CG1 C N N 164 ILE CG2 C N N 165 ILE CD1 C N N 166 ILE OXT O N N 167 ILE H H N N 168 ILE H2 H N N 169 ILE HA H N N 170 ILE HB H N N 171 ILE HG12 H N N 172 ILE HG13 H N N 173 ILE HG21 H N N 174 ILE HG22 H N N 175 ILE HG23 H N N 176 ILE HD11 H N N 177 ILE HD12 H N N 178 ILE HD13 H N N 179 ILE HXT H N N 180 LEU N N N N 181 LEU CA C N S 182 LEU C C N N 183 LEU O O N N 184 LEU CB C N N 185 LEU CG C N N 186 LEU CD1 C N N 187 LEU CD2 C N N 188 LEU OXT O N N 189 LEU H H N N 190 LEU H2 H N N 191 LEU HA H N N 192 LEU HB2 H N N 193 LEU HB3 H N N 194 LEU HG H N N 195 LEU HD11 H N N 196 LEU HD12 H N N 197 LEU HD13 H N N 198 LEU HD21 H N N 199 LEU HD22 H N N 200 LEU HD23 H N N 201 LEU HXT H N N 202 LYS N N N N 203 LYS CA C N S 204 LYS C C N N 205 LYS O O N N 206 LYS CB C N N 207 LYS CG C N N 208 LYS CD C N N 209 LYS CE C N N 210 LYS NZ N N N 211 LYS OXT O N N 212 LYS H H N N 213 LYS H2 H N N 214 LYS HA H N N 215 LYS HB2 H N N 216 LYS HB3 H N N 217 LYS HG2 H N N 218 LYS HG3 H N N 219 LYS HD2 H N N 220 LYS HD3 H N N 221 LYS HE2 H N N 222 LYS HE3 H N N 223 LYS HZ1 H N N 224 LYS HZ2 H N N 225 LYS HZ3 H N N 226 LYS HXT H N N 227 MET N N N N 228 MET CA C N S 229 MET C C N N 230 MET O O N N 231 MET CB C N N 232 MET CG C N N 233 MET SD S N N 234 MET CE C N N 235 MET OXT O N N 236 MET H H N N 237 MET H2 H N N 238 MET HA H N N 239 MET HB2 H N N 240 MET HB3 H N N 241 MET HG2 H N N 242 MET HG3 H N N 243 MET HE1 H N N 244 MET HE2 H N N 245 MET HE3 H N N 246 MET HXT H N N 247 PHE N N N N 248 PHE CA C N S 249 PHE C C N N 250 PHE O O N N 251 PHE CB C N N 252 PHE CG C Y N 253 PHE CD1 C Y N 254 PHE CD2 C Y N 255 PHE CE1 C Y N 256 PHE CE2 C Y N 257 PHE CZ C Y N 258 PHE OXT O N N 259 PHE H H N N 260 PHE H2 H N N 261 PHE HA H N N 262 PHE HB2 H N N 263 PHE HB3 H N N 264 PHE HD1 H N N 265 PHE HD2 H N N 266 PHE HE1 H N N 267 PHE HE2 H N N 268 PHE HZ H N N 269 PHE HXT H N N 270 PRO N N N N 271 PRO CA C N S 272 PRO C C N N 273 PRO O O N N 274 PRO CB C N N 275 PRO CG C N N 276 PRO CD C N N 277 PRO OXT O N N 278 PRO H H N N 279 PRO HA H N N 280 PRO HB2 H N N 281 PRO HB3 H N N 282 PRO HG2 H N N 283 PRO HG3 H N N 284 PRO HD2 H N N 285 PRO HD3 H N N 286 PRO HXT H N N 287 SER N N N N 288 SER CA C N S 289 SER C C N N 290 SER O O N N 291 SER CB C N N 292 SER OG O N N 293 SER OXT O N N 294 SER H H N N 295 SER H2 H N N 296 SER HA H N N 297 SER HB2 H N N 298 SER HB3 H N N 299 SER HG H N N 300 SER HXT H N N 301 THR N N N N 302 THR CA C N S 303 THR C C N N 304 THR O O N N 305 THR CB C N R 306 THR OG1 O N N 307 THR CG2 C N N 308 THR OXT O N N 309 THR H H N N 310 THR H2 H N N 311 THR HA H N N 312 THR HB H N N 313 THR HG1 H N N 314 THR HG21 H N N 315 THR HG22 H N N 316 THR HG23 H N N 317 THR HXT H N N 318 TRP N N N N 319 TRP CA C N S 320 TRP C C N N 321 TRP O O N N 322 TRP CB C N N 323 TRP CG C Y N 324 TRP CD1 C Y N 325 TRP CD2 C Y N 326 TRP NE1 N Y N 327 TRP CE2 C Y N 328 TRP CE3 C Y N 329 TRP CZ2 C Y N 330 TRP CZ3 C Y N 331 TRP CH2 C Y N 332 TRP OXT O N N 333 TRP H H N N 334 TRP H2 H N N 335 TRP HA H N N 336 TRP HB2 H N N 337 TRP HB3 H N N 338 TRP HD1 H N N 339 TRP HE1 H N N 340 TRP HE3 H N N 341 TRP HZ2 H N N 342 TRP HZ3 H N N 343 TRP HH2 H N N 344 TRP HXT H N N 345 TYR N N N N 346 TYR CA C N S 347 TYR C C N N 348 TYR O O N N 349 TYR CB C N N 350 TYR CG C Y N 351 TYR CD1 C Y N 352 TYR CD2 C Y N 353 TYR CE1 C Y N 354 TYR CE2 C Y N 355 TYR CZ C Y N 356 TYR OH O N N 357 TYR OXT O N N 358 TYR H H N N 359 TYR H2 H N N 360 TYR HA H N N 361 TYR HB2 H N N 362 TYR HB3 H N N 363 TYR HD1 H N N 364 TYR HD2 H N N 365 TYR HE1 H N N 366 TYR HE2 H N N 367 TYR HH H N N 368 TYR HXT H N N 369 VAL N N N N 370 VAL CA C N S 371 VAL C C N N 372 VAL O O N N 373 VAL CB C N N 374 VAL CG1 C N N 375 VAL CG2 C N N 376 VAL OXT O N N 377 VAL H H N N 378 VAL H2 H N N 379 VAL HA H N N 380 VAL HB H N N 381 VAL HG11 H N N 382 VAL HG12 H N N 383 VAL HG13 H N N 384 VAL HG21 H N N 385 VAL HG22 H N N 386 VAL HG23 H N N 387 VAL HXT H N N 388 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 ILE N CA sing N N 150 ILE N H sing N N 151 ILE N H2 sing N N 152 ILE CA C sing N N 153 ILE CA CB sing N N 154 ILE CA HA sing N N 155 ILE C O doub N N 156 ILE C OXT sing N N 157 ILE CB CG1 sing N N 158 ILE CB CG2 sing N N 159 ILE CB HB sing N N 160 ILE CG1 CD1 sing N N 161 ILE CG1 HG12 sing N N 162 ILE CG1 HG13 sing N N 163 ILE CG2 HG21 sing N N 164 ILE CG2 HG22 sing N N 165 ILE CG2 HG23 sing N N 166 ILE CD1 HD11 sing N N 167 ILE CD1 HD12 sing N N 168 ILE CD1 HD13 sing N N 169 ILE OXT HXT sing N N 170 LEU N CA sing N N 171 LEU N H sing N N 172 LEU N H2 sing N N 173 LEU CA C sing N N 174 LEU CA CB sing N N 175 LEU CA HA sing N N 176 LEU C O doub N N 177 LEU C OXT sing N N 178 LEU CB CG sing N N 179 LEU CB HB2 sing N N 180 LEU CB HB3 sing N N 181 LEU CG CD1 sing N N 182 LEU CG CD2 sing N N 183 LEU CG HG sing N N 184 LEU CD1 HD11 sing N N 185 LEU CD1 HD12 sing N N 186 LEU CD1 HD13 sing N N 187 LEU CD2 HD21 sing N N 188 LEU CD2 HD22 sing N N 189 LEU CD2 HD23 sing N N 190 LEU OXT HXT sing N N 191 LYS N CA sing N N 192 LYS N H sing N N 193 LYS N H2 sing N N 194 LYS CA C sing N N 195 LYS CA CB sing N N 196 LYS CA HA sing N N 197 LYS C O doub N N 198 LYS C OXT sing N N 199 LYS CB CG sing N N 200 LYS CB HB2 sing N N 201 LYS CB HB3 sing N N 202 LYS CG CD sing N N 203 LYS CG HG2 sing N N 204 LYS CG HG3 sing N N 205 LYS CD CE sing N N 206 LYS CD HD2 sing N N 207 LYS CD HD3 sing N N 208 LYS CE NZ sing N N 209 LYS CE HE2 sing N N 210 LYS CE HE3 sing N N 211 LYS NZ HZ1 sing N N 212 LYS NZ HZ2 sing N N 213 LYS NZ HZ3 sing N N 214 LYS OXT HXT sing N N 215 MET N CA sing N N 216 MET N H sing N N 217 MET N H2 sing N N 218 MET CA C sing N N 219 MET CA CB sing N N 220 MET CA HA sing N N 221 MET C O doub N N 222 MET C OXT sing N N 223 MET CB CG sing N N 224 MET CB HB2 sing N N 225 MET CB HB3 sing N N 226 MET CG SD sing N N 227 MET CG HG2 sing N N 228 MET CG HG3 sing N N 229 MET SD CE sing N N 230 MET CE HE1 sing N N 231 MET CE HE2 sing N N 232 MET CE HE3 sing N N 233 MET OXT HXT sing N N 234 PHE N CA sing N N 235 PHE N H sing N N 236 PHE N H2 sing N N 237 PHE CA C sing N N 238 PHE CA CB sing N N 239 PHE CA HA sing N N 240 PHE C O doub N N 241 PHE C OXT sing N N 242 PHE CB CG sing N N 243 PHE CB HB2 sing N N 244 PHE CB HB3 sing N N 245 PHE CG CD1 doub Y N 246 PHE CG CD2 sing Y N 247 PHE CD1 CE1 sing Y N 248 PHE CD1 HD1 sing N N 249 PHE CD2 CE2 doub Y N 250 PHE CD2 HD2 sing N N 251 PHE CE1 CZ doub Y N 252 PHE CE1 HE1 sing N N 253 PHE CE2 CZ sing Y N 254 PHE CE2 HE2 sing N N 255 PHE CZ HZ sing N N 256 PHE OXT HXT sing N N 257 PRO N CA sing N N 258 PRO N CD sing N N 259 PRO N H sing N N 260 PRO CA C sing N N 261 PRO CA CB sing N N 262 PRO CA HA sing N N 263 PRO C O doub N N 264 PRO C OXT sing N N 265 PRO CB CG sing N N 266 PRO CB HB2 sing N N 267 PRO CB HB3 sing N N 268 PRO CG CD sing N N 269 PRO CG HG2 sing N N 270 PRO CG HG3 sing N N 271 PRO CD HD2 sing N N 272 PRO CD HD3 sing N N 273 PRO OXT HXT sing N N 274 SER N CA sing N N 275 SER N H sing N N 276 SER N H2 sing N N 277 SER CA C sing N N 278 SER CA CB sing N N 279 SER CA HA sing N N 280 SER C O doub N N 281 SER C OXT sing N N 282 SER CB OG sing N N 283 SER CB HB2 sing N N 284 SER CB HB3 sing N N 285 SER OG HG sing N N 286 SER OXT HXT sing N N 287 THR N CA sing N N 288 THR N H sing N N 289 THR N H2 sing N N 290 THR CA C sing N N 291 THR CA CB sing N N 292 THR CA HA sing N N 293 THR C O doub N N 294 THR C OXT sing N N 295 THR CB OG1 sing N N 296 THR CB CG2 sing N N 297 THR CB HB sing N N 298 THR OG1 HG1 sing N N 299 THR CG2 HG21 sing N N 300 THR CG2 HG22 sing N N 301 THR CG2 HG23 sing N N 302 THR OXT HXT sing N N 303 TRP N CA sing N N 304 TRP N H sing N N 305 TRP N H2 sing N N 306 TRP CA C sing N N 307 TRP CA CB sing N N 308 TRP CA HA sing N N 309 TRP C O doub N N 310 TRP C OXT sing N N 311 TRP CB CG sing N N 312 TRP CB HB2 sing N N 313 TRP CB HB3 sing N N 314 TRP CG CD1 doub Y N 315 TRP CG CD2 sing Y N 316 TRP CD1 NE1 sing Y N 317 TRP CD1 HD1 sing N N 318 TRP CD2 CE2 doub Y N 319 TRP CD2 CE3 sing Y N 320 TRP NE1 CE2 sing Y N 321 TRP NE1 HE1 sing N N 322 TRP CE2 CZ2 sing Y N 323 TRP CE3 CZ3 doub Y N 324 TRP CE3 HE3 sing N N 325 TRP CZ2 CH2 doub Y N 326 TRP CZ2 HZ2 sing N N 327 TRP CZ3 CH2 sing Y N 328 TRP CZ3 HZ3 sing N N 329 TRP CH2 HH2 sing N N 330 TRP OXT HXT sing N N 331 TYR N CA sing N N 332 TYR N H sing N N 333 TYR N H2 sing N N 334 TYR CA C sing N N 335 TYR CA CB sing N N 336 TYR CA HA sing N N 337 TYR C O doub N N 338 TYR C OXT sing N N 339 TYR CB CG sing N N 340 TYR CB HB2 sing N N 341 TYR CB HB3 sing N N 342 TYR CG CD1 doub Y N 343 TYR CG CD2 sing Y N 344 TYR CD1 CE1 sing Y N 345 TYR CD1 HD1 sing N N 346 TYR CD2 CE2 doub Y N 347 TYR CD2 HD2 sing N N 348 TYR CE1 CZ doub Y N 349 TYR CE1 HE1 sing N N 350 TYR CE2 CZ sing Y N 351 TYR CE2 HE2 sing N N 352 TYR CZ OH sing N N 353 TYR OH HH sing N N 354 TYR OXT HXT sing N N 355 VAL N CA sing N N 356 VAL N H sing N N 357 VAL N H2 sing N N 358 VAL CA C sing N N 359 VAL CA CB sing N N 360 VAL CA HA sing N N 361 VAL C O doub N N 362 VAL C OXT sing N N 363 VAL CB CG1 sing N N 364 VAL CB CG2 sing N N 365 VAL CB HB sing N N 366 VAL CG1 HG11 sing N N 367 VAL CG1 HG12 sing N N 368 VAL CG1 HG13 sing N N 369 VAL CG2 HG21 sing N N 370 VAL CG2 HG22 sing N N 371 VAL CG2 HG23 sing N N 372 VAL OXT HXT sing N N 373 # _pdbx_audit_support.funding_organization 'Not funded' _pdbx_audit_support.country ? _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 4zfo _pdbx_initial_refinement_model.details ? # _space_group.name_H-M_alt 'C 1 2 1' _space_group.name_Hall 'C 2y' _space_group.IT_number 5 _space_group.crystal_system monoclinic _space_group.id 1 # _atom_sites.entry_id 8QY9 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 0.007280 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.004378 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.018123 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.014378 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.scat_dispersion_real _atom_type.scat_dispersion_imag _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c _atom_type.scat_source _atom_type.scat_dispersion_source C ? ? 3.54356 2.42580 ? ? 25.62398 1.50364 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? CU ? ? 28.82124 ? ? ? 5.57287 ? ? ? 0.0 ;1-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? H ? ? 0.99627 ? ? ? 14.84254 ? ? ? 0.0 ;1-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? N ? ? 6.96715 ? ? ? 11.43723 ? ? ? 0.0 ;1-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O ? ? 7.96527 ? ? ? 9.05267 ? ? ? 0.0 ;1-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? S ? ? 9.55732 6.39887 ? ? 1.23737 29.19336 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? # loop_