data_8R17 # _entry.id 8R17 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.398 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 8R17 pdb_00008r17 10.2210/pdb8r17/pdb WWPDB D_1292134342 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2024-07-03 2 'Structure model' 1 1 2024-11-13 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_audit_revision_group.ordinal 1 _pdbx_audit_revision_group.revision_ordinal 2 _pdbx_audit_revision_group.data_content_type 'Structure model' _pdbx_audit_revision_group.group 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' pdbx_entry_details 2 2 'Structure model' pdbx_modification_feature # _pdbx_audit_revision_item.ordinal 1 _pdbx_audit_revision_item.revision_ordinal 2 _pdbx_audit_revision_item.data_content_type 'Structure model' _pdbx_audit_revision_item.item '_pdbx_entry_details.has_protein_modification' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 8R17 _pdbx_database_status.recvd_initial_deposition_date 2023-11-01 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_contact_author.id 2 _pdbx_contact_author.email Mathias.Ziegler@uib.no _pdbx_contact_author.name_first Mathias _pdbx_contact_author.name_last Ziegler _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0001-6961-2396 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Kallio, J.P.' 1 0000-0003-3092-4012 'Ferrario, E.' 2 0000-0001-6429-7980 'Ziegler, M.' 3 0000-0001-6961-2396 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Protein Sci.' _citation.journal_id_ASTM PRCIEI _citation.journal_id_CSD 0795 _citation.journal_id_ISSN 1469-896X _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 33 _citation.language ? _citation.page_first e5071 _citation.page_last e5071 _citation.title ;Evolution of fungal tuberculosis necrotizing toxin (TNT) domain-containing enzymes reveals divergent adaptations to enhance NAD cleavage. ; _citation.year 2024 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1002/pro.5071 _citation.pdbx_database_id_PubMed 38895984 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Ferrario, E.' 1 0000-0001-6429-7980 primary 'Kallio, J.P.' 2 0000-0003-3092-4012 primary 'Emdadi, M.' 3 0009-0007-6612-6019 primary 'Stromland, O.' 4 0000-0003-2841-4638 primary 'Rack, J.G.M.' 5 0000-0001-8341-6439 primary 'Ziegler, M.' 6 0000-0001-6961-2396 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man ;Conidial surface nicotinamide adenine dinucleotide glycohydrolase,Conidial surface nicotinamide adenine dinucleotide glycohydrolase nadA ; 28183.324 1 3.2.2.5,3.2.2.- '233-EDPQRLVPRNY-243 replaced by LDESEYDEKVEYSNPYTPGPNQ' ? ;MKFTLLSTAVALLTSTAVA = signal sequence DVLFQGPGHHHHHH = 3C proteace cleavage site and HIS-tag 233-DESEYDEKVEYSNPYTPGPNQ-254 = engineered modification, sequence from AfNADase C-terminus,MKFTLLSTAVALLTSTAVA = signal sequence DVLFQGPGHHHHHH = 3C proteace cleavage site and HIS-tag 233-DESEYDEKVEYSNPYTPGPNQ-254 = engineered modification, sequence from AfNADase C-terminus ; 2 branched man '2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose' 424.401 1 ? ? ? ? 3 non-polymer syn 2-acetamido-2-deoxy-beta-D-glucopyranose 221.208 2 ? ? ? ? 4 non-polymer syn GLYCEROL 92.094 2 ? ? ? ? 5 water nat water 18.015 23 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name ;NAD(P)ase,NADase,Diphosphopyridine nucleotidase,DPNase,NAD(+) hydrolase,NADP(+) hydrolase,NADase,NAD(+) hydrolase nadA,NADP(+) hydrolase nadA ; # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MKFTLLSTAVALLTSTAVALPTSSSSAGSLLNERSYVNASSTATTCPYSRRSPAYCAGTAQNRTLSATYICGDSRLGPVV LPQFFLPLDPILDIYDRFGGLCPGAFLEKWFNQTGSGWWDYPPQNGFSVDDEGNIIAANLTLQTGTFVDRFGSEYGSFLA PAAAPYLQRSLPPSNLNGDAKFPWNYHVYSVIKPFAVLAGPIAPWFGQPGQGVQYQTYENVATLIADGYLKALDESEYDE KVEYSNPYTPGPNQDVLFQ ; _entity_poly.pdbx_seq_one_letter_code_can ;MKFTLLSTAVALLTSTAVALPTSSSSAGSLLNERSYVNASSTATTCPYSRRSPAYCAGTAQNRTLSATYICGDSRLGPVV LPQFFLPLDPILDIYDRFGGLCPGAFLEKWFNQTGSGWWDYPPQNGFSVDDEGNIIAANLTLQTGTFVDRFGSEYGSFLA PAAAPYLQRSLPPSNLNGDAKFPWNYHVYSVIKPFAVLAGPIAPWFGQPGQGVQYQTYENVATLIADGYLKALDESEYDE KVEYSNPYTPGPNQDVLFQ ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 3 2-acetamido-2-deoxy-beta-D-glucopyranose NAG 4 GLYCEROL GOL 5 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 LYS n 1 3 PHE n 1 4 THR n 1 5 LEU n 1 6 LEU n 1 7 SER n 1 8 THR n 1 9 ALA n 1 10 VAL n 1 11 ALA n 1 12 LEU n 1 13 LEU n 1 14 THR n 1 15 SER n 1 16 THR n 1 17 ALA n 1 18 VAL n 1 19 ALA n 1 20 LEU n 1 21 PRO n 1 22 THR n 1 23 SER n 1 24 SER n 1 25 SER n 1 26 SER n 1 27 ALA n 1 28 GLY n 1 29 SER n 1 30 LEU n 1 31 LEU n 1 32 ASN n 1 33 GLU n 1 34 ARG n 1 35 SER n 1 36 TYR n 1 37 VAL n 1 38 ASN n 1 39 ALA n 1 40 SER n 1 41 SER n 1 42 THR n 1 43 ALA n 1 44 THR n 1 45 THR n 1 46 CYS n 1 47 PRO n 1 48 TYR n 1 49 SER n 1 50 ARG n 1 51 ARG n 1 52 SER n 1 53 PRO n 1 54 ALA n 1 55 TYR n 1 56 CYS n 1 57 ALA n 1 58 GLY n 1 59 THR n 1 60 ALA n 1 61 GLN n 1 62 ASN n 1 63 ARG n 1 64 THR n 1 65 LEU n 1 66 SER n 1 67 ALA n 1 68 THR n 1 69 TYR n 1 70 ILE n 1 71 CYS n 1 72 GLY n 1 73 ASP n 1 74 SER n 1 75 ARG n 1 76 LEU n 1 77 GLY n 1 78 PRO n 1 79 VAL n 1 80 VAL n 1 81 LEU n 1 82 PRO n 1 83 GLN n 1 84 PHE n 1 85 PHE n 1 86 LEU n 1 87 PRO n 1 88 LEU n 1 89 ASP n 1 90 PRO n 1 91 ILE n 1 92 LEU n 1 93 ASP n 1 94 ILE n 1 95 TYR n 1 96 ASP n 1 97 ARG n 1 98 PHE n 1 99 GLY n 1 100 GLY n 1 101 LEU n 1 102 CYS n 1 103 PRO n 1 104 GLY n 1 105 ALA n 1 106 PHE n 1 107 LEU n 1 108 GLU n 1 109 LYS n 1 110 TRP n 1 111 PHE n 1 112 ASN n 1 113 GLN n 1 114 THR n 1 115 GLY n 1 116 SER n 1 117 GLY n 1 118 TRP n 1 119 TRP n 1 120 ASP n 1 121 TYR n 1 122 PRO n 1 123 PRO n 1 124 GLN n 1 125 ASN n 1 126 GLY n 1 127 PHE n 1 128 SER n 1 129 VAL n 1 130 ASP n 1 131 ASP n 1 132 GLU n 1 133 GLY n 1 134 ASN n 1 135 ILE n 1 136 ILE n 1 137 ALA n 1 138 ALA n 1 139 ASN n 1 140 LEU n 1 141 THR n 1 142 LEU n 1 143 GLN n 1 144 THR n 1 145 GLY n 1 146 THR n 1 147 PHE n 1 148 VAL n 1 149 ASP n 1 150 ARG n 1 151 PHE n 1 152 GLY n 1 153 SER n 1 154 GLU n 1 155 TYR n 1 156 GLY n 1 157 SER n 1 158 PHE n 1 159 LEU n 1 160 ALA n 1 161 PRO n 1 162 ALA n 1 163 ALA n 1 164 ALA n 1 165 PRO n 1 166 TYR n 1 167 LEU n 1 168 GLN n 1 169 ARG n 1 170 SER n 1 171 LEU n 1 172 PRO n 1 173 PRO n 1 174 SER n 1 175 ASN n 1 176 LEU n 1 177 ASN n 1 178 GLY n 1 179 ASP n 1 180 ALA n 1 181 LYS n 1 182 PHE n 1 183 PRO n 1 184 TRP n 1 185 ASN n 1 186 TYR n 1 187 HIS n 1 188 VAL n 1 189 TYR n 1 190 SER n 1 191 VAL n 1 192 ILE n 1 193 LYS n 1 194 PRO n 1 195 PHE n 1 196 ALA n 1 197 VAL n 1 198 LEU n 1 199 ALA n 1 200 GLY n 1 201 PRO n 1 202 ILE n 1 203 ALA n 1 204 PRO n 1 205 TRP n 1 206 PHE n 1 207 GLY n 1 208 GLN n 1 209 PRO n 1 210 GLY n 1 211 GLN n 1 212 GLY n 1 213 VAL n 1 214 GLN n 1 215 TYR n 1 216 GLN n 1 217 THR n 1 218 TYR n 1 219 GLU n 1 220 ASN n 1 221 VAL n 1 222 ALA n 1 223 THR n 1 224 LEU n 1 225 ILE n 1 226 ALA n 1 227 ASP n 1 228 GLY n 1 229 TYR n 1 230 LEU n 1 231 LYS n 1 232 ALA n 1 233 LEU n 1 234 ASP n 1 235 GLU n 1 236 SER n 1 237 GLU n 1 238 TYR n 1 239 ASP n 1 240 GLU n 1 241 LYS n 1 242 VAL n 1 243 GLU n 1 244 TYR n 1 245 SER n 1 246 ASN n 1 247 PRO n 1 248 TYR n 1 249 THR n 1 250 PRO n 1 251 GLY n 1 252 PRO n 1 253 ASN n 1 254 GLN n 1 255 ASP n 1 256 VAL n 1 257 LEU n 1 258 PHE n 1 259 GLN n # loop_ _entity_src_gen.entity_id _entity_src_gen.pdbx_src_id _entity_src_gen.pdbx_alt_source_flag _entity_src_gen.pdbx_seq_type _entity_src_gen.pdbx_beg_seq_num _entity_src_gen.pdbx_end_seq_num _entity_src_gen.gene_src_common_name _entity_src_gen.gene_src_genus _entity_src_gen.pdbx_gene_src_gene _entity_src_gen.gene_src_species _entity_src_gen.gene_src_strain _entity_src_gen.gene_src_tissue _entity_src_gen.gene_src_tissue_fraction _entity_src_gen.gene_src_details _entity_src_gen.pdbx_gene_src_fragment _entity_src_gen.pdbx_gene_src_scientific_name _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id _entity_src_gen.pdbx_gene_src_variant _entity_src_gen.pdbx_gene_src_cell_line _entity_src_gen.pdbx_gene_src_atcc _entity_src_gen.pdbx_gene_src_organ _entity_src_gen.pdbx_gene_src_organelle _entity_src_gen.pdbx_gene_src_cell _entity_src_gen.pdbx_gene_src_cellular_location _entity_src_gen.host_org_common_name _entity_src_gen.pdbx_host_org_scientific_name _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id _entity_src_gen.host_org_genus _entity_src_gen.pdbx_host_org_gene _entity_src_gen.pdbx_host_org_organ _entity_src_gen.host_org_species _entity_src_gen.pdbx_host_org_tissue _entity_src_gen.pdbx_host_org_tissue_fraction _entity_src_gen.pdbx_host_org_strain _entity_src_gen.pdbx_host_org_variant _entity_src_gen.pdbx_host_org_cell_line _entity_src_gen.pdbx_host_org_atcc _entity_src_gen.pdbx_host_org_culture_collection _entity_src_gen.pdbx_host_org_cell _entity_src_gen.pdbx_host_org_organelle _entity_src_gen.pdbx_host_org_cellular_location _entity_src_gen.pdbx_host_org_vector_type _entity_src_gen.pdbx_host_org_vector _entity_src_gen.host_org_details _entity_src_gen.expression_system_id _entity_src_gen.plasmid_name _entity_src_gen.plasmid_details _entity_src_gen.pdbx_description 1 1 sample 'Biological sequence' 1 232 ? ? NCU07948 ? ? ? ? ? ? 'Neurospora crassa' 5141 ? ? ? ? ? ? ? ? 'Spodoptera frugiperda' 7108 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 1 2 sample 'Biological sequence' 233 259 'Neosartorya fumigata' ? 'nadA, AFUA_6G14470' ? 'ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293' ? ? ? ? 'Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293' 330879 ? ? ? ? ? ? ? ? 'Spodoptera frugiperda' 7108 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? # _pdbx_entity_branch.entity_id 2 _pdbx_entity_branch.type oligosaccharide # loop_ _pdbx_entity_branch_descriptor.ordinal _pdbx_entity_branch_descriptor.entity_id _pdbx_entity_branch_descriptor.descriptor _pdbx_entity_branch_descriptor.type _pdbx_entity_branch_descriptor.program _pdbx_entity_branch_descriptor.program_version 1 2 DGlcpNAcb1-4DGlcpNAcb1-ROH 'Glycam Condensed Sequence' GMML 1.0 2 2 'WURCS=2.0/1,2,1/[a2122h-1b_1-5_2*NCC/3=O]/1-1/a4-b1' WURCS PDB2Glycan 1.1.0 3 2 '[][D-1-deoxy-GlcpNAc]{[(4+1)][b-D-GlcpNAc]{}}' LINUCS PDB-CARE ? # _pdbx_entity_branch_link.link_id 1 _pdbx_entity_branch_link.entity_id 2 _pdbx_entity_branch_link.entity_branch_list_num_1 2 _pdbx_entity_branch_link.comp_id_1 NAG _pdbx_entity_branch_link.atom_id_1 C1 _pdbx_entity_branch_link.leaving_atom_id_1 O1 _pdbx_entity_branch_link.entity_branch_list_num_2 1 _pdbx_entity_branch_link.comp_id_2 NAG _pdbx_entity_branch_link.atom_id_2 O4 _pdbx_entity_branch_link.leaving_atom_id_2 HO4 _pdbx_entity_branch_link.value_order sing _pdbx_entity_branch_link.details ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 GOL non-polymer . GLYCEROL 'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3' 92.094 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 NAG 'D-saccharide, beta linking' . 2-acetamido-2-deoxy-beta-D-glucopyranose ;N-acetyl-beta-D-glucosamine; 2-acetamido-2-deoxy-beta-D-glucose; 2-acetamido-2-deoxy-D-glucose; 2-acetamido-2-deoxy-glucose; N-ACETYL-D-GLUCOSAMINE ; 'C8 H15 N O6' 221.208 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_chem_comp_identifier.comp_id _pdbx_chem_comp_identifier.type _pdbx_chem_comp_identifier.program _pdbx_chem_comp_identifier.program_version _pdbx_chem_comp_identifier.identifier NAG 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML 1.0 DGlcpNAcb NAG 'COMMON NAME' GMML 1.0 N-acetyl-b-D-glucopyranosamine NAG 'IUPAC CARBOHYDRATE SYMBOL' PDB-CARE 1.0 b-D-GlcpNAc NAG 'SNFG CARBOHYDRATE SYMBOL' GMML 1.0 GlcNAc # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 LYS 2 2 ? ? ? A . n A 1 3 PHE 3 3 ? ? ? A . n A 1 4 THR 4 4 ? ? ? A . n A 1 5 LEU 5 5 ? ? ? A . n A 1 6 LEU 6 6 ? ? ? A . n A 1 7 SER 7 7 ? ? ? A . n A 1 8 THR 8 8 ? ? ? A . n A 1 9 ALA 9 9 ? ? ? A . n A 1 10 VAL 10 10 ? ? ? A . n A 1 11 ALA 11 11 ? ? ? A . n A 1 12 LEU 12 12 ? ? ? A . n A 1 13 LEU 13 13 ? ? ? A . n A 1 14 THR 14 14 ? ? ? A . n A 1 15 SER 15 15 ? ? ? A . n A 1 16 THR 16 16 ? ? ? A . n A 1 17 ALA 17 17 ? ? ? A . n A 1 18 VAL 18 18 ? ? ? A . n A 1 19 ALA 19 19 ? ? ? A . n A 1 20 LEU 20 20 ? ? ? A . n A 1 21 PRO 21 21 ? ? ? A . n A 1 22 THR 22 22 ? ? ? A . n A 1 23 SER 23 23 ? ? ? A . n A 1 24 SER 24 24 ? ? ? A . n A 1 25 SER 25 25 ? ? ? A . n A 1 26 SER 26 26 ? ? ? A . n A 1 27 ALA 27 27 ? ? ? A . n A 1 28 GLY 28 28 ? ? ? A . n A 1 29 SER 29 29 ? ? ? A . n A 1 30 LEU 30 30 ? ? ? A . n A 1 31 LEU 31 31 ? ? ? A . n A 1 32 ASN 32 32 ? ? ? A . n A 1 33 GLU 33 33 ? ? ? A . n A 1 34 ARG 34 34 ? ? ? A . n A 1 35 SER 35 35 ? ? ? A . n A 1 36 TYR 36 36 ? ? ? A . n A 1 37 VAL 37 37 ? ? ? A . n A 1 38 ASN 38 38 ? ? ? A . n A 1 39 ALA 39 39 ? ? ? A . n A 1 40 SER 40 40 ? ? ? A . n A 1 41 SER 41 41 ? ? ? A . n A 1 42 THR 42 42 ? ? ? A . n A 1 43 ALA 43 43 ? ? ? A . n A 1 44 THR 44 44 44 THR THR A . n A 1 45 THR 45 45 45 THR THR A . n A 1 46 CYS 46 46 46 CYS CYS A . n A 1 47 PRO 47 47 47 PRO PRO A . n A 1 48 TYR 48 48 48 TYR TYR A . n A 1 49 SER 49 49 49 SER SER A . n A 1 50 ARG 50 50 50 ARG ARG A . n A 1 51 ARG 51 51 51 ARG ARG A . n A 1 52 SER 52 52 52 SER SER A . n A 1 53 PRO 53 53 53 PRO PRO A . n A 1 54 ALA 54 54 54 ALA ALA A . n A 1 55 TYR 55 55 55 TYR TYR A . n A 1 56 CYS 56 56 56 CYS CYS A . n A 1 57 ALA 57 57 57 ALA ALA A . n A 1 58 GLY 58 58 58 GLY GLY A . n A 1 59 THR 59 59 59 THR THR A . n A 1 60 ALA 60 60 60 ALA ALA A . n A 1 61 GLN 61 61 61 GLN GLN A . n A 1 62 ASN 62 62 62 ASN ASN A . n A 1 63 ARG 63 63 63 ARG ARG A . n A 1 64 THR 64 64 64 THR THR A . n A 1 65 LEU 65 65 65 LEU LEU A . n A 1 66 SER 66 66 66 SER SER A . n A 1 67 ALA 67 67 67 ALA ALA A . n A 1 68 THR 68 68 68 THR THR A . n A 1 69 TYR 69 69 69 TYR TYR A . n A 1 70 ILE 70 70 70 ILE ILE A . n A 1 71 CYS 71 71 71 CYS CYS A . n A 1 72 GLY 72 72 72 GLY GLY A . n A 1 73 ASP 73 73 73 ASP ASP A . n A 1 74 SER 74 74 74 SER SER A . n A 1 75 ARG 75 75 75 ARG ARG A . n A 1 76 LEU 76 76 76 LEU LEU A . n A 1 77 GLY 77 77 77 GLY GLY A . n A 1 78 PRO 78 78 78 PRO PRO A . n A 1 79 VAL 79 79 79 VAL VAL A . n A 1 80 VAL 80 80 80 VAL VAL A . n A 1 81 LEU 81 81 81 LEU LEU A . n A 1 82 PRO 82 82 82 PRO PRO A . n A 1 83 GLN 83 83 83 GLN GLN A . n A 1 84 PHE 84 84 84 PHE PHE A . n A 1 85 PHE 85 85 85 PHE PHE A . n A 1 86 LEU 86 86 ? ? ? A . n A 1 87 PRO 87 87 ? ? ? A . n A 1 88 LEU 88 88 ? ? ? A . n A 1 89 ASP 89 89 ? ? ? A . n A 1 90 PRO 90 90 90 PRO PRO A . n A 1 91 ILE 91 91 91 ILE ILE A . n A 1 92 LEU 92 92 92 LEU LEU A . n A 1 93 ASP 93 93 93 ASP ASP A . n A 1 94 ILE 94 94 94 ILE ILE A . n A 1 95 TYR 95 95 95 TYR TYR A . n A 1 96 ASP 96 96 96 ASP ASP A . n A 1 97 ARG 97 97 97 ARG ARG A . n A 1 98 PHE 98 98 98 PHE PHE A . n A 1 99 GLY 99 99 99 GLY GLY A . n A 1 100 GLY 100 100 100 GLY GLY A . n A 1 101 LEU 101 101 101 LEU LEU A . n A 1 102 CYS 102 102 102 CYS CYS A . n A 1 103 PRO 103 103 103 PRO PRO A . n A 1 104 GLY 104 104 104 GLY GLY A . n A 1 105 ALA 105 105 105 ALA ALA A . n A 1 106 PHE 106 106 106 PHE PHE A . n A 1 107 LEU 107 107 107 LEU LEU A . n A 1 108 GLU 108 108 108 GLU GLU A . n A 1 109 LYS 109 109 109 LYS LYS A . n A 1 110 TRP 110 110 110 TRP TRP A . n A 1 111 PHE 111 111 111 PHE PHE A . n A 1 112 ASN 112 112 112 ASN ASN A . n A 1 113 GLN 113 113 113 GLN GLN A . n A 1 114 THR 114 114 114 THR THR A . n A 1 115 GLY 115 115 115 GLY GLY A . n A 1 116 SER 116 116 116 SER SER A . n A 1 117 GLY 117 117 117 GLY GLY A . n A 1 118 TRP 118 118 118 TRP TRP A . n A 1 119 TRP 119 119 119 TRP TRP A . n A 1 120 ASP 120 120 120 ASP ASP A . n A 1 121 TYR 121 121 121 TYR TYR A . n A 1 122 PRO 122 122 122 PRO PRO A . n A 1 123 PRO 123 123 123 PRO PRO A . n A 1 124 GLN 124 124 124 GLN GLN A . n A 1 125 ASN 125 125 125 ASN ASN A . n A 1 126 GLY 126 126 126 GLY GLY A . n A 1 127 PHE 127 127 127 PHE PHE A . n A 1 128 SER 128 128 128 SER SER A . n A 1 129 VAL 129 129 129 VAL VAL A . n A 1 130 ASP 130 130 130 ASP ASP A . n A 1 131 ASP 131 131 131 ASP ASP A . n A 1 132 GLU 132 132 132 GLU GLU A . n A 1 133 GLY 133 133 133 GLY GLY A . n A 1 134 ASN 134 134 134 ASN ASN A . n A 1 135 ILE 135 135 135 ILE ILE A . n A 1 136 ILE 136 136 136 ILE ILE A . n A 1 137 ALA 137 137 137 ALA ALA A . n A 1 138 ALA 138 138 138 ALA ALA A . n A 1 139 ASN 139 139 139 ASN ASN A . n A 1 140 LEU 140 140 140 LEU LEU A . n A 1 141 THR 141 141 141 THR THR A . n A 1 142 LEU 142 142 142 LEU LEU A . n A 1 143 GLN 143 143 143 GLN GLN A . n A 1 144 THR 144 144 144 THR THR A . n A 1 145 GLY 145 145 145 GLY GLY A . n A 1 146 THR 146 146 146 THR THR A . n A 1 147 PHE 147 147 147 PHE PHE A . n A 1 148 VAL 148 148 148 VAL VAL A . n A 1 149 ASP 149 149 149 ASP ASP A . n A 1 150 ARG 150 150 150 ARG ARG A . n A 1 151 PHE 151 151 151 PHE PHE A . n A 1 152 GLY 152 152 152 GLY GLY A . n A 1 153 SER 153 153 153 SER SER A . n A 1 154 GLU 154 154 154 GLU GLU A . n A 1 155 TYR 155 155 155 TYR TYR A . n A 1 156 GLY 156 156 156 GLY GLY A . n A 1 157 SER 157 157 157 SER SER A . n A 1 158 PHE 158 158 158 PHE PHE A . n A 1 159 LEU 159 159 159 LEU LEU A . n A 1 160 ALA 160 160 160 ALA ALA A . n A 1 161 PRO 161 161 161 PRO PRO A . n A 1 162 ALA 162 162 162 ALA ALA A . n A 1 163 ALA 163 163 163 ALA ALA A . n A 1 164 ALA 164 164 164 ALA ALA A . n A 1 165 PRO 165 165 165 PRO PRO A . n A 1 166 TYR 166 166 166 TYR TYR A . n A 1 167 LEU 167 167 167 LEU LEU A . n A 1 168 GLN 168 168 168 GLN GLN A . n A 1 169 ARG 169 169 169 ARG ARG A . n A 1 170 SER 170 170 170 SER SER A . n A 1 171 LEU 171 171 171 LEU LEU A . n A 1 172 PRO 172 172 172 PRO PRO A . n A 1 173 PRO 173 173 173 PRO PRO A . n A 1 174 SER 174 174 174 SER SER A . n A 1 175 ASN 175 175 175 ASN ASN A . n A 1 176 LEU 176 176 176 LEU LEU A . n A 1 177 ASN 177 177 177 ASN ASN A . n A 1 178 GLY 178 178 178 GLY GLY A . n A 1 179 ASP 179 179 179 ASP ASP A . n A 1 180 ALA 180 180 180 ALA ALA A . n A 1 181 LYS 181 181 181 LYS LYS A . n A 1 182 PHE 182 182 182 PHE PHE A . n A 1 183 PRO 183 183 183 PRO PRO A . n A 1 184 TRP 184 184 184 TRP TRP A . n A 1 185 ASN 185 185 185 ASN ASN A . n A 1 186 TYR 186 186 186 TYR TYR A . n A 1 187 HIS 187 187 187 HIS HIS A . n A 1 188 VAL 188 188 188 VAL VAL A . n A 1 189 TYR 189 189 189 TYR TYR A . n A 1 190 SER 190 190 190 SER SER A . n A 1 191 VAL 191 191 191 VAL VAL A . n A 1 192 ILE 192 192 192 ILE ILE A . n A 1 193 LYS 193 193 193 LYS LYS A . n A 1 194 PRO 194 194 194 PRO PRO A . n A 1 195 PHE 195 195 195 PHE PHE A . n A 1 196 ALA 196 196 196 ALA ALA A . n A 1 197 VAL 197 197 197 VAL VAL A . n A 1 198 LEU 198 198 198 LEU LEU A . n A 1 199 ALA 199 199 199 ALA ALA A . n A 1 200 GLY 200 200 200 GLY GLY A . n A 1 201 PRO 201 201 201 PRO PRO A . n A 1 202 ILE 202 202 202 ILE ILE A . n A 1 203 ALA 203 203 203 ALA ALA A . n A 1 204 PRO 204 204 204 PRO PRO A . n A 1 205 TRP 205 205 205 TRP TRP A . n A 1 206 PHE 206 206 206 PHE PHE A . n A 1 207 GLY 207 207 207 GLY GLY A . n A 1 208 GLN 208 208 208 GLN GLN A . n A 1 209 PRO 209 209 209 PRO PRO A . n A 1 210 GLY 210 210 210 GLY GLY A . n A 1 211 GLN 211 211 211 GLN GLN A . n A 1 212 GLY 212 212 212 GLY GLY A . n A 1 213 VAL 213 213 213 VAL VAL A . n A 1 214 GLN 214 214 214 GLN GLN A . n A 1 215 TYR 215 215 215 TYR TYR A . n A 1 216 GLN 216 216 216 GLN GLN A . n A 1 217 THR 217 217 217 THR THR A . n A 1 218 TYR 218 218 218 TYR TYR A . n A 1 219 GLU 219 219 219 GLU GLU A . n A 1 220 ASN 220 220 220 ASN ASN A . n A 1 221 VAL 221 221 221 VAL VAL A . n A 1 222 ALA 222 222 222 ALA ALA A . n A 1 223 THR 223 223 223 THR THR A . n A 1 224 LEU 224 224 224 LEU LEU A . n A 1 225 ILE 225 225 225 ILE ILE A . n A 1 226 ALA 226 226 226 ALA ALA A . n A 1 227 ASP 227 227 227 ASP ASP A . n A 1 228 GLY 228 228 228 GLY GLY A . n A 1 229 TYR 229 229 229 TYR TYR A . n A 1 230 LEU 230 230 230 LEU LEU A . n A 1 231 LYS 231 231 231 LYS LYS A . n A 1 232 ALA 232 232 232 ALA ALA A . n A 1 233 LEU 233 233 233 LEU LEU A . n A 1 234 ASP 234 234 234 ASP ASP A . n A 1 235 GLU 235 235 235 GLU GLU A . n A 1 236 SER 236 236 ? ? ? A . n A 1 237 GLU 237 237 ? ? ? A . n A 1 238 TYR 238 238 ? ? ? A . n A 1 239 ASP 239 239 ? ? ? A . n A 1 240 GLU 240 240 ? ? ? A . n A 1 241 LYS 241 241 ? ? ? A . n A 1 242 VAL 242 242 ? ? ? A . n A 1 243 GLU 243 243 ? ? ? A . n A 1 244 TYR 244 244 ? ? ? A . n A 1 245 SER 245 245 ? ? ? A . n A 1 246 ASN 246 246 ? ? ? A . n A 1 247 PRO 247 247 ? ? ? A . n A 1 248 TYR 248 248 ? ? ? A . n A 1 249 THR 249 249 ? ? ? A . n A 1 250 PRO 250 250 ? ? ? A . n A 1 251 GLY 251 251 ? ? ? A . n A 1 252 PRO 252 252 ? ? ? A . n A 1 253 ASN 253 253 ? ? ? A . n A 1 254 GLN 254 254 ? ? ? A . n A 1 255 ASP 255 255 ? ? ? A . n A 1 256 VAL 256 256 ? ? ? A . n A 1 257 LEU 257 257 ? ? ? A . n A 1 258 PHE 258 258 ? ? ? A . n A 1 259 GLN 259 259 ? ? ? A . n # loop_ _pdbx_branch_scheme.asym_id _pdbx_branch_scheme.entity_id _pdbx_branch_scheme.mon_id _pdbx_branch_scheme.num _pdbx_branch_scheme.pdb_asym_id _pdbx_branch_scheme.pdb_mon_id _pdbx_branch_scheme.pdb_seq_num _pdbx_branch_scheme.auth_asym_id _pdbx_branch_scheme.auth_mon_id _pdbx_branch_scheme.auth_seq_num _pdbx_branch_scheme.hetero B 2 NAG 1 B NAG 1 A NAG 300 n B 2 NAG 2 B NAG 2 A NAG 301 n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 3 NAG 1 301 400 NAG NAG A . D 3 NAG 1 302 500 NAG NAG A . E 4 GOL 1 303 501 GOL GOL A . F 4 GOL 1 304 502 GOL GOL A . G 5 HOH 1 401 26 HOH HOH A . G 5 HOH 2 402 11 HOH HOH A . G 5 HOH 3 403 1 HOH HOH A . G 5 HOH 4 404 5 HOH HOH A . G 5 HOH 5 405 15 HOH HOH A . G 5 HOH 6 406 20 HOH HOH A . G 5 HOH 7 407 10 HOH HOH A . G 5 HOH 8 408 4 HOH HOH A . G 5 HOH 9 409 3 HOH HOH A . G 5 HOH 10 410 13 HOH HOH A . G 5 HOH 11 411 2 HOH HOH A . G 5 HOH 12 412 7 HOH HOH A . G 5 HOH 13 413 24 HOH HOH A . G 5 HOH 14 414 21 HOH HOH A . G 5 HOH 15 415 9 HOH HOH A . G 5 HOH 16 416 18 HOH HOH A . G 5 HOH 17 417 14 HOH HOH A . G 5 HOH 18 418 25 HOH HOH A . G 5 HOH 19 419 8 HOH HOH A . G 5 HOH 20 420 22 HOH HOH A . G 5 HOH 21 421 19 HOH HOH A . G 5 HOH 22 422 6 HOH HOH A . G 5 HOH 23 423 23 HOH HOH A . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.21rc1_5109 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 8R17 _cell.details ? _cell.formula_units_Z ? _cell.length_a 83.756 _cell.length_a_esd ? _cell.length_b 83.756 _cell.length_b_esd ? _cell.length_c 103.220 _cell.length_c_esd ? _cell.volume 724095.271 _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 8R17 _symmetry.cell_setting ? _symmetry.Int_Tables_number 96 _symmetry.space_group_name_Hall 'P 4nw 2abw' _symmetry.space_group_name_H-M 'P 43 21 2' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 8R17 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 3.10 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 60.29 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details 'Bis-Tris pH 5.5-6.5, NaCl' _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 293 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER2 X 16M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2023-06-12 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.033 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'PETRA III, DESY BEAMLINE P11' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.033 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline P11 _diffrn_source.pdbx_synchrotron_site 'PETRA III, DESY' # _reflns.B_iso_Wilson_estimate 75.3 _reflns.entry_id 8R17 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.3 _reflns.d_resolution_low 43.98 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 16949 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 100.0 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 8.6 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 20.1 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all 0.018 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.999 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs 0.048 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 2.3 _reflns_shell.d_res_low 2.38 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 1.3 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 1626 _reflns_shell.percent_possible_obs 99.9 _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all 0.666 _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.442 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.percent_possible_all ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 1.828 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 83.14 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 8R17 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.30 _refine.ls_d_res_low 43.94 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 16898 _refine.ls_number_reflns_R_free 867 _refine.ls_number_reflns_R_work 16031 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.92 _refine.ls_percent_reflns_R_free 5.13 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2349 _refine.ls_R_factor_R_free 0.2578 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2336 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.34 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values 'GeoStd + Monomer Library + CDL v1.2' _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1000 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 31.6736 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.3524 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 2.30 _refine_hist.d_res_low 43.94 _refine_hist.number_atoms_solvent 23 _refine_hist.number_atoms_total 1554 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 1463 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 68 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.0052 ? 1579 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.7576 ? 2157 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.0477 ? 233 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.0067 ? 277 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 14.0296 ? 530 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free _refine_ls_shell.R_factor_R_free 'X-RAY DIFFRACTION' 2.30 2.44 . . 146 2594 99.93 . . . . 0.3373 . . . . . . . . . . . 0.3628 'X-RAY DIFFRACTION' 2.44 2.63 . . 154 2615 100.00 . . . . 0.3488 . . . . . . . . . . . 0.3990 'X-RAY DIFFRACTION' 2.63 2.90 . . 145 2638 100.00 . . . . 0.3145 . . . . . . . . . . . 0.3699 'X-RAY DIFFRACTION' 2.90 3.32 . . 138 2655 99.96 . . . . 0.3101 . . . . . . . . . . . 0.3713 'X-RAY DIFFRACTION' 3.32 4.18 . . 138 2689 99.96 . . . . 0.2232 . . . . . . . . . . . 0.2397 'X-RAY DIFFRACTION' 4.18 43.94 . . 146 2840 99.70 . . . . 0.1974 . . . . . . . . . . . 0.2125 # _struct.entry_id 8R17 _struct.title 'Crystal structure of Neurospora crassa NADase with modified C-terminus' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 8R17 _struct_keywords.text 'NADase, NAD hydrolase, homodimer, glycoprotein, extracellular, TNT domain, HYDROLASE' _struct_keywords.pdbx_keywords HYDROLASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 3 ? E N N 4 ? F N N 4 ? G N N 5 ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP NADA_NEUCR Q7S936 ? 1 ;MKFTLLSTAVALLTSTAVALPTSSSSAGSLLNERSYVNASSTATTCPYSRRSPAYCAGTAQNRTLSATYICGDSRLGPVV LPQFFLPLDPILDIYDRFGGLCPGAFLEKWFNQTGSGWWDYPPQNGFSVDDEGNIIAANLTLQTGTFVDRFGSEYGSFLA PAAAPYLQRSLPPSNLNGDAKFPWNYHVYSVIKPFAVLAGPIAPWFGQPGQGVQYQTYENVATLIADGYLKA ; 1 2 UNP NADA_ASPFU Q4WL81 ? 1 LDESEYDEKVEYSNPYTPGPNQ 213 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 8R17 A 1 ? 232 ? Q7S936 1 ? 232 ? 1 232 2 2 8R17 A 233 ? 254 ? Q4WL81 213 ? 234 ? 233 254 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 2 8R17 ASP A 255 ? UNP Q4WL81 ? ? 'expression tag' 255 1 2 8R17 VAL A 256 ? UNP Q4WL81 ? ? 'expression tag' 256 2 2 8R17 LEU A 257 ? UNP Q4WL81 ? ? 'expression tag' 257 3 2 8R17 PHE A 258 ? UNP Q4WL81 ? ? 'expression tag' 258 4 2 8R17 GLN A 259 ? UNP Q4WL81 ? ? 'expression tag' 259 5 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 5590 ? 1 MORE -9 ? 1 'SSA (A^2)' 19950 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F,G # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 8_665 -y+1,-x+1,-z+1/2 0.0000000000 -1.0000000000 0.0000000000 83.7560000000 -1.0000000000 0.0000000000 0.0000000000 83.7560000000 0.0000000000 0.0000000000 -1.0000000000 51.6100000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 TYR A 69 ? GLY A 77 ? TYR A 69 GLY A 77 5 ? 9 HELX_P HELX_P2 AA2 PRO A 90 ? TYR A 95 ? PRO A 90 TYR A 95 5 ? 6 HELX_P HELX_P3 AA3 CYS A 102 ? PHE A 111 ? CYS A 102 PHE A 111 1 ? 10 HELX_P HELX_P4 AA4 PRO A 123 ? PHE A 127 ? PRO A 123 PHE A 127 5 ? 5 HELX_P HELX_P5 AA5 PRO A 165 ? ARG A 169 ? PRO A 165 ARG A 169 5 ? 5 HELX_P HELX_P6 AA6 PRO A 172 ? ASN A 177 ? PRO A 172 ASN A 177 5 ? 6 HELX_P HELX_P7 AA7 ASN A 220 ? ASP A 227 ? ASN A 220 ASP A 227 1 ? 8 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 46 SG ? ? ? 1_555 A CYS 102 SG ? ? A CYS 46 A CYS 102 1_555 ? ? ? ? ? ? ? 2.040 ? ? disulf2 disulf ? ? A CYS 56 SG ? ? ? 1_555 A CYS 71 SG ? ? A CYS 56 A CYS 71 1_555 ? ? ? ? ? ? ? 2.030 ? ? covale1 covale one ? A ASN 62 ND2 ? ? ? 1_555 B NAG . C1 ? ? A ASN 62 B NAG 1 1_555 ? ? ? ? ? ? ? 1.437 ? N-Glycosylation covale2 covale one ? A ASN 112 ND2 ? ? ? 1_555 C NAG . C1 ? ? A ASN 112 A NAG 301 1_555 ? ? ? ? ? ? ? 1.448 ? N-Glycosylation covale3 covale one ? A ASN 139 ND2 ? ? ? 1_555 D NAG . C1 ? ? A ASN 139 A NAG 302 1_555 ? ? ? ? ? ? ? 1.453 ? N-Glycosylation covale4 covale both ? B NAG . O4 ? ? ? 1_555 B NAG . C1 ? ? B NAG 1 B NAG 2 1_555 ? ? ? ? ? ? ? 1.439 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference disulf ? ? covale ? ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 NAG B . ? ASN A 62 ? NAG B 1 ? 1_555 ASN A 62 ? 1_555 C1 ND2 ASN 1 NAG N-Glycosylation Carbohydrate 2 NAG C . ? ASN A 112 ? NAG A 301 ? 1_555 ASN A 112 ? 1_555 C1 ND2 ASN 1 NAG N-Glycosylation Carbohydrate 3 NAG D . ? ASN A 139 ? NAG A 302 ? 1_555 ASN A 139 ? 1_555 C1 ND2 ASN 1 NAG N-Glycosylation Carbohydrate 4 CYS A 46 ? CYS A 102 ? CYS A 46 ? 1_555 CYS A 102 ? 1_555 SG SG . . . None 'Disulfide bridge' 5 CYS A 56 ? CYS A 71 ? CYS A 56 ? 1_555 CYS A 71 ? 1_555 SG SG . . . None 'Disulfide bridge' # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 7 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA1 5 6 ? anti-parallel AA1 6 7 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ALA A 138 ? LEU A 142 ? ALA A 138 LEU A 142 AA1 2 PHE A 195 ? PRO A 201 ? PHE A 195 PRO A 201 AA1 3 VAL A 213 ? GLN A 216 ? VAL A 213 GLN A 216 AA1 4 PHE A 158 ? PRO A 161 ? PHE A 158 PRO A 161 AA1 5 PHE A 147 ? PHE A 151 ? PHE A 147 PHE A 151 AA1 6 TYR A 186 ? VAL A 191 ? TYR A 186 VAL A 191 AA1 7 LEU A 230 ? ALA A 232 ? LEU A 230 ALA A 232 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N LEU A 140 ? N LEU A 140 O VAL A 197 ? O VAL A 197 AA1 2 3 N LEU A 198 ? N LEU A 198 O GLN A 216 ? O GLN A 216 AA1 3 4 O TYR A 215 ? O TYR A 215 N LEU A 159 ? N LEU A 159 AA1 4 5 O ALA A 160 ? O ALA A 160 N ASP A 149 ? N ASP A 149 AA1 5 6 N VAL A 148 ? N VAL A 148 O TYR A 189 ? O TYR A 189 AA1 6 7 N SER A 190 ? N SER A 190 O LYS A 231 ? O LYS A 231 # _pdbx_entry_details.entry_id 8R17 _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest N _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PRO A 82 ? ? -74.09 -113.15 2 1 LEU A 92 ? ? -49.11 -17.91 3 1 ASN A 112 ? ? 59.52 -98.37 4 1 GLN A 113 ? ? 59.62 -59.00 5 1 ALA A 137 ? ? -170.02 146.53 6 1 GLU A 154 ? ? -63.91 0.50 7 1 ASN A 177 ? ? -67.78 86.90 # _pdbx_struct_special_symmetry.id 1 _pdbx_struct_special_symmetry.PDB_model_num 1 _pdbx_struct_special_symmetry.auth_asym_id A _pdbx_struct_special_symmetry.auth_comp_id GOL _pdbx_struct_special_symmetry.auth_seq_id 303 _pdbx_struct_special_symmetry.PDB_ins_code ? _pdbx_struct_special_symmetry.label_asym_id E _pdbx_struct_special_symmetry.label_comp_id GOL _pdbx_struct_special_symmetry.label_seq_id . # loop_ _space_group_symop.id _space_group_symop.operation_xyz 1 x,y,z 2 -y+1/2,x+1/2,z+3/4 3 y+1/2,-x+1/2,z+1/4 4 x+1/2,-y+1/2,-z+1/4 5 -x+1/2,y+1/2,-z+3/4 6 -x,-y,z+1/2 7 y,x,-z 8 -y,-x,-z+1/2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A LYS 2 ? A LYS 2 3 1 Y 1 A PHE 3 ? A PHE 3 4 1 Y 1 A THR 4 ? A THR 4 5 1 Y 1 A LEU 5 ? A LEU 5 6 1 Y 1 A LEU 6 ? A LEU 6 7 1 Y 1 A SER 7 ? A SER 7 8 1 Y 1 A THR 8 ? A THR 8 9 1 Y 1 A ALA 9 ? A ALA 9 10 1 Y 1 A VAL 10 ? A VAL 10 11 1 Y 1 A ALA 11 ? A ALA 11 12 1 Y 1 A LEU 12 ? A LEU 12 13 1 Y 1 A LEU 13 ? A LEU 13 14 1 Y 1 A THR 14 ? A THR 14 15 1 Y 1 A SER 15 ? A SER 15 16 1 Y 1 A THR 16 ? A THR 16 17 1 Y 1 A ALA 17 ? A ALA 17 18 1 Y 1 A VAL 18 ? A VAL 18 19 1 Y 1 A ALA 19 ? A ALA 19 20 1 Y 1 A LEU 20 ? A LEU 20 21 1 Y 1 A PRO 21 ? A PRO 21 22 1 Y 1 A THR 22 ? A THR 22 23 1 Y 1 A SER 23 ? A SER 23 24 1 Y 1 A SER 24 ? A SER 24 25 1 Y 1 A SER 25 ? A SER 25 26 1 Y 1 A SER 26 ? A SER 26 27 1 Y 1 A ALA 27 ? A ALA 27 28 1 Y 1 A GLY 28 ? A GLY 28 29 1 Y 1 A SER 29 ? A SER 29 30 1 Y 1 A LEU 30 ? A LEU 30 31 1 Y 1 A LEU 31 ? A LEU 31 32 1 Y 1 A ASN 32 ? A ASN 32 33 1 Y 1 A GLU 33 ? A GLU 33 34 1 Y 1 A ARG 34 ? A ARG 34 35 1 Y 1 A SER 35 ? A SER 35 36 1 Y 1 A TYR 36 ? A TYR 36 37 1 Y 1 A VAL 37 ? A VAL 37 38 1 Y 1 A ASN 38 ? A ASN 38 39 1 Y 1 A ALA 39 ? A ALA 39 40 1 Y 1 A SER 40 ? A SER 40 41 1 Y 1 A SER 41 ? A SER 41 42 1 Y 1 A THR 42 ? A THR 42 43 1 Y 1 A ALA 43 ? A ALA 43 44 1 Y 1 A LEU 86 ? A LEU 86 45 1 Y 1 A PRO 87 ? A PRO 87 46 1 Y 1 A LEU 88 ? A LEU 88 47 1 Y 1 A ASP 89 ? A ASP 89 48 1 Y 1 A SER 236 ? A SER 236 49 1 Y 1 A GLU 237 ? A GLU 237 50 1 Y 1 A TYR 238 ? A TYR 238 51 1 Y 1 A ASP 239 ? A ASP 239 52 1 Y 1 A GLU 240 ? A GLU 240 53 1 Y 1 A LYS 241 ? A LYS 241 54 1 Y 1 A VAL 242 ? A VAL 242 55 1 Y 1 A GLU 243 ? A GLU 243 56 1 Y 1 A TYR 244 ? A TYR 244 57 1 Y 1 A SER 245 ? A SER 245 58 1 Y 1 A ASN 246 ? A ASN 246 59 1 Y 1 A PRO 247 ? A PRO 247 60 1 Y 1 A TYR 248 ? A TYR 248 61 1 Y 1 A THR 249 ? A THR 249 62 1 Y 1 A PRO 250 ? A PRO 250 63 1 Y 1 A GLY 251 ? A GLY 251 64 1 Y 1 A PRO 252 ? A PRO 252 65 1 Y 1 A ASN 253 ? A ASN 253 66 1 Y 1 A GLN 254 ? A GLN 254 67 1 Y 1 A ASP 255 ? A ASP 255 68 1 Y 1 A VAL 256 ? A VAL 256 69 1 Y 1 A LEU 257 ? A LEU 257 70 1 Y 1 A PHE 258 ? A PHE 258 71 1 Y 1 A GLN 259 ? A GLN 259 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 GOL C1 C N N 137 GOL O1 O N N 138 GOL C2 C N N 139 GOL O2 O N N 140 GOL C3 C N N 141 GOL O3 O N N 142 GOL H11 H N N 143 GOL H12 H N N 144 GOL HO1 H N N 145 GOL H2 H N N 146 GOL HO2 H N N 147 GOL H31 H N N 148 GOL H32 H N N 149 GOL HO3 H N N 150 HIS N N N N 151 HIS CA C N S 152 HIS C C N N 153 HIS O O N N 154 HIS CB C N N 155 HIS CG C Y N 156 HIS ND1 N Y N 157 HIS CD2 C Y N 158 HIS CE1 C Y N 159 HIS NE2 N Y N 160 HIS OXT O N N 161 HIS H H N N 162 HIS H2 H N N 163 HIS HA H N N 164 HIS HB2 H N N 165 HIS HB3 H N N 166 HIS HD1 H N N 167 HIS HD2 H N N 168 HIS HE1 H N N 169 HIS HE2 H N N 170 HIS HXT H N N 171 HOH O O N N 172 HOH H1 H N N 173 HOH H2 H N N 174 ILE N N N N 175 ILE CA C N S 176 ILE C C N N 177 ILE O O N N 178 ILE CB C N S 179 ILE CG1 C N N 180 ILE CG2 C N N 181 ILE CD1 C N N 182 ILE OXT O N N 183 ILE H H N N 184 ILE H2 H N N 185 ILE HA H N N 186 ILE HB H N N 187 ILE HG12 H N N 188 ILE HG13 H N N 189 ILE HG21 H N N 190 ILE HG22 H N N 191 ILE HG23 H N N 192 ILE HD11 H N N 193 ILE HD12 H N N 194 ILE HD13 H N N 195 ILE HXT H N N 196 LEU N N N N 197 LEU CA C N S 198 LEU C C N N 199 LEU O O N N 200 LEU CB C N N 201 LEU CG C N N 202 LEU CD1 C N N 203 LEU CD2 C N N 204 LEU OXT O N N 205 LEU H H N N 206 LEU H2 H N N 207 LEU HA H N N 208 LEU HB2 H N N 209 LEU HB3 H N N 210 LEU HG H N N 211 LEU HD11 H N N 212 LEU HD12 H N N 213 LEU HD13 H N N 214 LEU HD21 H N N 215 LEU HD22 H N N 216 LEU HD23 H N N 217 LEU HXT H N N 218 LYS N N N N 219 LYS CA C N S 220 LYS C C N N 221 LYS O O N N 222 LYS CB C N N 223 LYS CG C N N 224 LYS CD C N N 225 LYS CE C N N 226 LYS NZ N N N 227 LYS OXT O N N 228 LYS H H N N 229 LYS H2 H N N 230 LYS HA H N N 231 LYS HB2 H N N 232 LYS HB3 H N N 233 LYS HG2 H N N 234 LYS HG3 H N N 235 LYS HD2 H N N 236 LYS HD3 H N N 237 LYS HE2 H N N 238 LYS HE3 H N N 239 LYS HZ1 H N N 240 LYS HZ2 H N N 241 LYS HZ3 H N N 242 LYS HXT H N N 243 MET N N N N 244 MET CA C N S 245 MET C C N N 246 MET O O N N 247 MET CB C N N 248 MET CG C N N 249 MET SD S N N 250 MET CE C N N 251 MET OXT O N N 252 MET H H N N 253 MET H2 H N N 254 MET HA H N N 255 MET HB2 H N N 256 MET HB3 H N N 257 MET HG2 H N N 258 MET HG3 H N N 259 MET HE1 H N N 260 MET HE2 H N N 261 MET HE3 H N N 262 MET HXT H N N 263 NAG C1 C N R 264 NAG C2 C N R 265 NAG C3 C N R 266 NAG C4 C N S 267 NAG C5 C N R 268 NAG C6 C N N 269 NAG C7 C N N 270 NAG C8 C N N 271 NAG N2 N N N 272 NAG O1 O N N 273 NAG O3 O N N 274 NAG O4 O N N 275 NAG O5 O N N 276 NAG O6 O N N 277 NAG O7 O N N 278 NAG H1 H N N 279 NAG H2 H N N 280 NAG H3 H N N 281 NAG H4 H N N 282 NAG H5 H N N 283 NAG H61 H N N 284 NAG H62 H N N 285 NAG H81 H N N 286 NAG H82 H N N 287 NAG H83 H N N 288 NAG HN2 H N N 289 NAG HO1 H N N 290 NAG HO3 H N N 291 NAG HO4 H N N 292 NAG HO6 H N N 293 PHE N N N N 294 PHE CA C N S 295 PHE C C N N 296 PHE O O N N 297 PHE CB C N N 298 PHE CG C Y N 299 PHE CD1 C Y N 300 PHE CD2 C Y N 301 PHE CE1 C Y N 302 PHE CE2 C Y N 303 PHE CZ C Y N 304 PHE OXT O N N 305 PHE H H N N 306 PHE H2 H N N 307 PHE HA H N N 308 PHE HB2 H N N 309 PHE HB3 H N N 310 PHE HD1 H N N 311 PHE HD2 H N N 312 PHE HE1 H N N 313 PHE HE2 H N N 314 PHE HZ H N N 315 PHE HXT H N N 316 PRO N N N N 317 PRO CA C N S 318 PRO C C N N 319 PRO O O N N 320 PRO CB C N N 321 PRO CG C N N 322 PRO CD C N N 323 PRO OXT O N N 324 PRO H H N N 325 PRO HA H N N 326 PRO HB2 H N N 327 PRO HB3 H N N 328 PRO HG2 H N N 329 PRO HG3 H N N 330 PRO HD2 H N N 331 PRO HD3 H N N 332 PRO HXT H N N 333 SER N N N N 334 SER CA C N S 335 SER C C N N 336 SER O O N N 337 SER CB C N N 338 SER OG O N N 339 SER OXT O N N 340 SER H H N N 341 SER H2 H N N 342 SER HA H N N 343 SER HB2 H N N 344 SER HB3 H N N 345 SER HG H N N 346 SER HXT H N N 347 THR N N N N 348 THR CA C N S 349 THR C C N N 350 THR O O N N 351 THR CB C N R 352 THR OG1 O N N 353 THR CG2 C N N 354 THR OXT O N N 355 THR H H N N 356 THR H2 H N N 357 THR HA H N N 358 THR HB H N N 359 THR HG1 H N N 360 THR HG21 H N N 361 THR HG22 H N N 362 THR HG23 H N N 363 THR HXT H N N 364 TRP N N N N 365 TRP CA C N S 366 TRP C C N N 367 TRP O O N N 368 TRP CB C N N 369 TRP CG C Y N 370 TRP CD1 C Y N 371 TRP CD2 C Y N 372 TRP NE1 N Y N 373 TRP CE2 C Y N 374 TRP CE3 C Y N 375 TRP CZ2 C Y N 376 TRP CZ3 C Y N 377 TRP CH2 C Y N 378 TRP OXT O N N 379 TRP H H N N 380 TRP H2 H N N 381 TRP HA H N N 382 TRP HB2 H N N 383 TRP HB3 H N N 384 TRP HD1 H N N 385 TRP HE1 H N N 386 TRP HE3 H N N 387 TRP HZ2 H N N 388 TRP HZ3 H N N 389 TRP HH2 H N N 390 TRP HXT H N N 391 TYR N N N N 392 TYR CA C N S 393 TYR C C N N 394 TYR O O N N 395 TYR CB C N N 396 TYR CG C Y N 397 TYR CD1 C Y N 398 TYR CD2 C Y N 399 TYR CE1 C Y N 400 TYR CE2 C Y N 401 TYR CZ C Y N 402 TYR OH O N N 403 TYR OXT O N N 404 TYR H H N N 405 TYR H2 H N N 406 TYR HA H N N 407 TYR HB2 H N N 408 TYR HB3 H N N 409 TYR HD1 H N N 410 TYR HD2 H N N 411 TYR HE1 H N N 412 TYR HE2 H N N 413 TYR HH H N N 414 TYR HXT H N N 415 VAL N N N N 416 VAL CA C N S 417 VAL C C N N 418 VAL O O N N 419 VAL CB C N N 420 VAL CG1 C N N 421 VAL CG2 C N N 422 VAL OXT O N N 423 VAL H H N N 424 VAL H2 H N N 425 VAL HA H N N 426 VAL HB H N N 427 VAL HG11 H N N 428 VAL HG12 H N N 429 VAL HG13 H N N 430 VAL HG21 H N N 431 VAL HG22 H N N 432 VAL HG23 H N N 433 VAL HXT H N N 434 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 GOL C1 O1 sing N N 129 GOL C1 C2 sing N N 130 GOL C1 H11 sing N N 131 GOL C1 H12 sing N N 132 GOL O1 HO1 sing N N 133 GOL C2 O2 sing N N 134 GOL C2 C3 sing N N 135 GOL C2 H2 sing N N 136 GOL O2 HO2 sing N N 137 GOL C3 O3 sing N N 138 GOL C3 H31 sing N N 139 GOL C3 H32 sing N N 140 GOL O3 HO3 sing N N 141 HIS N CA sing N N 142 HIS N H sing N N 143 HIS N H2 sing N N 144 HIS CA C sing N N 145 HIS CA CB sing N N 146 HIS CA HA sing N N 147 HIS C O doub N N 148 HIS C OXT sing N N 149 HIS CB CG sing N N 150 HIS CB HB2 sing N N 151 HIS CB HB3 sing N N 152 HIS CG ND1 sing Y N 153 HIS CG CD2 doub Y N 154 HIS ND1 CE1 doub Y N 155 HIS ND1 HD1 sing N N 156 HIS CD2 NE2 sing Y N 157 HIS CD2 HD2 sing N N 158 HIS CE1 NE2 sing Y N 159 HIS CE1 HE1 sing N N 160 HIS NE2 HE2 sing N N 161 HIS OXT HXT sing N N 162 HOH O H1 sing N N 163 HOH O H2 sing N N 164 ILE N CA sing N N 165 ILE N H sing N N 166 ILE N H2 sing N N 167 ILE CA C sing N N 168 ILE CA CB sing N N 169 ILE CA HA sing N N 170 ILE C O doub N N 171 ILE C OXT sing N N 172 ILE CB CG1 sing N N 173 ILE CB CG2 sing N N 174 ILE CB HB sing N N 175 ILE CG1 CD1 sing N N 176 ILE CG1 HG12 sing N N 177 ILE CG1 HG13 sing N N 178 ILE CG2 HG21 sing N N 179 ILE CG2 HG22 sing N N 180 ILE CG2 HG23 sing N N 181 ILE CD1 HD11 sing N N 182 ILE CD1 HD12 sing N N 183 ILE CD1 HD13 sing N N 184 ILE OXT HXT sing N N 185 LEU N CA sing N N 186 LEU N H sing N N 187 LEU N H2 sing N N 188 LEU CA C sing N N 189 LEU CA CB sing N N 190 LEU CA HA sing N N 191 LEU C O doub N N 192 LEU C OXT sing N N 193 LEU CB CG sing N N 194 LEU CB HB2 sing N N 195 LEU CB HB3 sing N N 196 LEU CG CD1 sing N N 197 LEU CG CD2 sing N N 198 LEU CG HG sing N N 199 LEU CD1 HD11 sing N N 200 LEU CD1 HD12 sing N N 201 LEU CD1 HD13 sing N N 202 LEU CD2 HD21 sing N N 203 LEU CD2 HD22 sing N N 204 LEU CD2 HD23 sing N N 205 LEU OXT HXT sing N N 206 LYS N CA sing N N 207 LYS N H sing N N 208 LYS N H2 sing N N 209 LYS CA C sing N N 210 LYS CA CB sing N N 211 LYS CA HA sing N N 212 LYS C O doub N N 213 LYS C OXT sing N N 214 LYS CB CG sing N N 215 LYS CB HB2 sing N N 216 LYS CB HB3 sing N N 217 LYS CG CD sing N N 218 LYS CG HG2 sing N N 219 LYS CG HG3 sing N N 220 LYS CD CE sing N N 221 LYS CD HD2 sing N N 222 LYS CD HD3 sing N N 223 LYS CE NZ sing N N 224 LYS CE HE2 sing N N 225 LYS CE HE3 sing N N 226 LYS NZ HZ1 sing N N 227 LYS NZ HZ2 sing N N 228 LYS NZ HZ3 sing N N 229 LYS OXT HXT sing N N 230 MET N CA sing N N 231 MET N H sing N N 232 MET N H2 sing N N 233 MET CA C sing N N 234 MET CA CB sing N N 235 MET CA HA sing N N 236 MET C O doub N N 237 MET C OXT sing N N 238 MET CB CG sing N N 239 MET CB HB2 sing N N 240 MET CB HB3 sing N N 241 MET CG SD sing N N 242 MET CG HG2 sing N N 243 MET CG HG3 sing N N 244 MET SD CE sing N N 245 MET CE HE1 sing N N 246 MET CE HE2 sing N N 247 MET CE HE3 sing N N 248 MET OXT HXT sing N N 249 NAG C1 C2 sing N N 250 NAG C1 O1 sing N N 251 NAG C1 O5 sing N N 252 NAG C1 H1 sing N N 253 NAG C2 C3 sing N N 254 NAG C2 N2 sing N N 255 NAG C2 H2 sing N N 256 NAG C3 C4 sing N N 257 NAG C3 O3 sing N N 258 NAG C3 H3 sing N N 259 NAG C4 C5 sing N N 260 NAG C4 O4 sing N N 261 NAG C4 H4 sing N N 262 NAG C5 C6 sing N N 263 NAG C5 O5 sing N N 264 NAG C5 H5 sing N N 265 NAG C6 O6 sing N N 266 NAG C6 H61 sing N N 267 NAG C6 H62 sing N N 268 NAG C7 C8 sing N N 269 NAG C7 N2 sing N N 270 NAG C7 O7 doub N N 271 NAG C8 H81 sing N N 272 NAG C8 H82 sing N N 273 NAG C8 H83 sing N N 274 NAG N2 HN2 sing N N 275 NAG O1 HO1 sing N N 276 NAG O3 HO3 sing N N 277 NAG O4 HO4 sing N N 278 NAG O6 HO6 sing N N 279 PHE N CA sing N N 280 PHE N H sing N N 281 PHE N H2 sing N N 282 PHE CA C sing N N 283 PHE CA CB sing N N 284 PHE CA HA sing N N 285 PHE C O doub N N 286 PHE C OXT sing N N 287 PHE CB CG sing N N 288 PHE CB HB2 sing N N 289 PHE CB HB3 sing N N 290 PHE CG CD1 doub Y N 291 PHE CG CD2 sing Y N 292 PHE CD1 CE1 sing Y N 293 PHE CD1 HD1 sing N N 294 PHE CD2 CE2 doub Y N 295 PHE CD2 HD2 sing N N 296 PHE CE1 CZ doub Y N 297 PHE CE1 HE1 sing N N 298 PHE CE2 CZ sing Y N 299 PHE CE2 HE2 sing N N 300 PHE CZ HZ sing N N 301 PHE OXT HXT sing N N 302 PRO N CA sing N N 303 PRO N CD sing N N 304 PRO N H sing N N 305 PRO CA C sing N N 306 PRO CA CB sing N N 307 PRO CA HA sing N N 308 PRO C O doub N N 309 PRO C OXT sing N N 310 PRO CB CG sing N N 311 PRO CB HB2 sing N N 312 PRO CB HB3 sing N N 313 PRO CG CD sing N N 314 PRO CG HG2 sing N N 315 PRO CG HG3 sing N N 316 PRO CD HD2 sing N N 317 PRO CD HD3 sing N N 318 PRO OXT HXT sing N N 319 SER N CA sing N N 320 SER N H sing N N 321 SER N H2 sing N N 322 SER CA C sing N N 323 SER CA CB sing N N 324 SER CA HA sing N N 325 SER C O doub N N 326 SER C OXT sing N N 327 SER CB OG sing N N 328 SER CB HB2 sing N N 329 SER CB HB3 sing N N 330 SER OG HG sing N N 331 SER OXT HXT sing N N 332 THR N CA sing N N 333 THR N H sing N N 334 THR N H2 sing N N 335 THR CA C sing N N 336 THR CA CB sing N N 337 THR CA HA sing N N 338 THR C O doub N N 339 THR C OXT sing N N 340 THR CB OG1 sing N N 341 THR CB CG2 sing N N 342 THR CB HB sing N N 343 THR OG1 HG1 sing N N 344 THR CG2 HG21 sing N N 345 THR CG2 HG22 sing N N 346 THR CG2 HG23 sing N N 347 THR OXT HXT sing N N 348 TRP N CA sing N N 349 TRP N H sing N N 350 TRP N H2 sing N N 351 TRP CA C sing N N 352 TRP CA CB sing N N 353 TRP CA HA sing N N 354 TRP C O doub N N 355 TRP C OXT sing N N 356 TRP CB CG sing N N 357 TRP CB HB2 sing N N 358 TRP CB HB3 sing N N 359 TRP CG CD1 doub Y N 360 TRP CG CD2 sing Y N 361 TRP CD1 NE1 sing Y N 362 TRP CD1 HD1 sing N N 363 TRP CD2 CE2 doub Y N 364 TRP CD2 CE3 sing Y N 365 TRP NE1 CE2 sing Y N 366 TRP NE1 HE1 sing N N 367 TRP CE2 CZ2 sing Y N 368 TRP CE3 CZ3 doub Y N 369 TRP CE3 HE3 sing N N 370 TRP CZ2 CH2 doub Y N 371 TRP CZ2 HZ2 sing N N 372 TRP CZ3 CH2 sing Y N 373 TRP CZ3 HZ3 sing N N 374 TRP CH2 HH2 sing N N 375 TRP OXT HXT sing N N 376 TYR N CA sing N N 377 TYR N H sing N N 378 TYR N H2 sing N N 379 TYR CA C sing N N 380 TYR CA CB sing N N 381 TYR CA HA sing N N 382 TYR C O doub N N 383 TYR C OXT sing N N 384 TYR CB CG sing N N 385 TYR CB HB2 sing N N 386 TYR CB HB3 sing N N 387 TYR CG CD1 doub Y N 388 TYR CG CD2 sing Y N 389 TYR CD1 CE1 sing Y N 390 TYR CD1 HD1 sing N N 391 TYR CD2 CE2 doub Y N 392 TYR CD2 HD2 sing N N 393 TYR CE1 CZ doub Y N 394 TYR CE1 HE1 sing N N 395 TYR CE2 CZ sing Y N 396 TYR CE2 HE2 sing N N 397 TYR CZ OH sing N N 398 TYR OH HH sing N N 399 TYR OXT HXT sing N N 400 VAL N CA sing N N 401 VAL N H sing N N 402 VAL N H2 sing N N 403 VAL CA C sing N N 404 VAL CA CB sing N N 405 VAL CA HA sing N N 406 VAL C O doub N N 407 VAL C OXT sing N N 408 VAL CB CG1 sing N N 409 VAL CB CG2 sing N N 410 VAL CB HB sing N N 411 VAL CG1 HG11 sing N N 412 VAL CG1 HG12 sing N N 413 VAL CG1 HG13 sing N N 414 VAL CG2 HG21 sing N N 415 VAL CG2 HG22 sing N N 416 VAL CG2 HG23 sing N N 417 VAL OXT HXT sing N N 418 # _pdbx_audit_support.funding_organization 'Norwegian Research Council' _pdbx_audit_support.country Norway _pdbx_audit_support.grant_number 302314 _pdbx_audit_support.ordinal 1 # loop_ _pdbx_entity_branch_list.entity_id _pdbx_entity_branch_list.comp_id _pdbx_entity_branch_list.num _pdbx_entity_branch_list.hetero 2 NAG 1 n 2 NAG 2 n # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list 1 _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 8R15 _pdbx_initial_refinement_model.details ? # _space_group.name_H-M_alt 'P 43 21 2' _space_group.name_Hall 'P 4nw 2abw' _space_group.IT_number 96 _space_group.crystal_system tetragonal _space_group.id 1 # _atom_sites.entry_id 8R17 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 0.011939 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.011939 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.009688 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.scat_dispersion_real _atom_type.scat_dispersion_imag _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c _atom_type.scat_source _atom_type.scat_dispersion_source C ? ? 3.54356 2.42580 ? ? 25.62398 1.50364 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? H ? ? 0.51345 0.48472 ? ? 24.73122 6.32584 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? N ? ? 4.01032 2.96436 ? ? 19.97189 1.75589 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O ? ? 4.49882 3.47563 ? ? 15.80542 1.70748 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? S ? ? 9.55732 6.39887 ? ? 1.23737 29.19336 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? # loop_