data_8R8A
#
_entry.id 8R8A
#
_audit_conform.dict_name mmcif_pdbx.dic
_audit_conform.dict_version 5.398
_audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic
#
loop_
_database_2.database_id
_database_2.database_code
_database_2.pdbx_database_accession
_database_2.pdbx_DOI
PDB 8R8A pdb_00008r8a 10.2210/pdb8r8a/pdb
WWPDB D_1292134826 ? ?
#
loop_
_pdbx_audit_revision_history.ordinal
_pdbx_audit_revision_history.data_content_type
_pdbx_audit_revision_history.major_revision
_pdbx_audit_revision_history.minor_revision
_pdbx_audit_revision_history.revision_date
1 'Structure model' 1 0 2023-12-27
2 'Structure model' 1 1 2024-03-06
3 'Structure model' 1 2 2024-11-13
#
_pdbx_audit_revision_details.ordinal 1
_pdbx_audit_revision_details.revision_ordinal 1
_pdbx_audit_revision_details.data_content_type 'Structure model'
_pdbx_audit_revision_details.provider repository
_pdbx_audit_revision_details.type 'Initial release'
_pdbx_audit_revision_details.description ?
_pdbx_audit_revision_details.details ?
#
loop_
_pdbx_audit_revision_group.ordinal
_pdbx_audit_revision_group.revision_ordinal
_pdbx_audit_revision_group.data_content_type
_pdbx_audit_revision_group.group
1 2 'Structure model' 'Database references'
2 3 'Structure model' 'Structure summary'
#
loop_
_pdbx_audit_revision_category.ordinal
_pdbx_audit_revision_category.revision_ordinal
_pdbx_audit_revision_category.data_content_type
_pdbx_audit_revision_category.category
1 2 'Structure model' citation
2 2 'Structure model' citation_author
3 3 'Structure model' pdbx_entry_details
4 3 'Structure model' pdbx_modification_feature
#
loop_
_pdbx_audit_revision_item.ordinal
_pdbx_audit_revision_item.revision_ordinal
_pdbx_audit_revision_item.data_content_type
_pdbx_audit_revision_item.item
1 2 'Structure model' '_citation.journal_abbrev'
2 2 'Structure model' '_citation.journal_id_CSD'
3 2 'Structure model' '_citation.journal_id_ISSN'
4 2 'Structure model' '_citation.journal_volume'
5 2 'Structure model' '_citation.page_first'
6 2 'Structure model' '_citation.page_last'
7 2 'Structure model' '_citation.pdbx_database_id_DOI'
8 2 'Structure model' '_citation.pdbx_database_id_PubMed'
9 2 'Structure model' '_citation.title'
10 2 'Structure model' '_citation.year'
11 2 'Structure model' '_citation_author.identifier_ORCID'
12 2 'Structure model' '_citation_author.name'
13 3 'Structure model' '_pdbx_entry_details.has_protein_modification'
#
_pdbx_database_status.status_code REL
_pdbx_database_status.status_code_sf REL
_pdbx_database_status.status_code_mr ?
_pdbx_database_status.entry_id 8R8A
_pdbx_database_status.recvd_initial_deposition_date 2023-11-28
_pdbx_database_status.SG_entry N
_pdbx_database_status.deposit_site PDBE
_pdbx_database_status.process_site PDBE
_pdbx_database_status.status_code_cs ?
_pdbx_database_status.status_code_nmr_data ?
_pdbx_database_status.methods_development_category ?
_pdbx_database_status.pdb_format_compatible Y
#
_pdbx_contact_author.id 2
_pdbx_contact_author.email daniel.bojar@gu.se
_pdbx_contact_author.name_first Daniel
_pdbx_contact_author.name_last Bojar
_pdbx_contact_author.name_mi ?
_pdbx_contact_author.role 'principal investigator/group leader'
_pdbx_contact_author.identifier_ORCID 0000-0002-3008-7851
#
loop_
_audit_author.name
_audit_author.pdbx_ordinal
_audit_author.identifier_ORCID
'Lundstrom, J.' 1 0000-0003-2733-7124
'Varrot, A.' 2 0000-0001-6667-8162
#
_citation.abstract ?
_citation.abstract_id_CAS ?
_citation.book_id_ISBN ?
_citation.book_publisher ?
_citation.book_publisher_city ?
_citation.book_title ?
_citation.coordinate_linkage ?
_citation.country ?
_citation.database_id_Medline ?
_citation.details ?
_citation.id primary
_citation.journal_abbrev 'Beilstein J Org Chem'
_citation.journal_id_ASTM ?
_citation.journal_id_CSD ?
_citation.journal_id_ISSN 1860-5397
_citation.journal_full ?
_citation.journal_issue ?
_citation.journal_volume 20
_citation.language ?
_citation.page_first 306
_citation.page_last 320
_citation.title
'Elucidating the glycan-binding specificity and structure of Cucumis melo agglutinin, a new R-type lectin.'
_citation.year 2024
_citation.database_id_CSD ?
_citation.pdbx_database_id_DOI 10.3762/bjoc.20.31
_citation.pdbx_database_id_PubMed 38410776
_citation.pdbx_database_id_patent ?
_citation.unpublished_flag ?
#
loop_
_citation_author.citation_id
_citation_author.name
_citation_author.ordinal
_citation_author.identifier_ORCID
primary 'Lundstrom, J.' 1 ?
primary 'Gillon, E.' 2 ?
primary 'Chazalet, V.' 3 ?
primary 'Kerekes, N.' 4 0000-0001-7065-8092
primary 'Di Maio, A.' 5 0000-0002-2740-9098
primary 'Feizi, T.' 6 0000-0001-6495-0329
primary 'Liu, Y.' 7 ?
primary 'Varrot, A.' 8 0000-0001-6667-8162
primary 'Bojar, D.' 9 0000-0002-3008-7851
#
loop_
_entity.id
_entity.type
_entity.src_method
_entity.pdbx_description
_entity.formula_weight
_entity.pdbx_number_of_molecules
_entity.pdbx_ec
_entity.pdbx_mutation
_entity.pdbx_fragment
_entity.details
1 polymer man 'Nigrin b-like' 13933.389 1 ? ? ?
;Residue 6-132 of the mature protein preceded by residues left from TEV cleavage site. We used the numbering such as we kept the one of the mature protein
;
2 branched man 'beta-D-galactopyranose-(1-4)-2-acetamido-2-deoxy-alpha-D-glucopyranose' 383.349 1 ? ? ? ?
3 non-polymer syn 'CADMIUM ION' 112.411 3 ? ? ? ?
4 water nat water 18.015 241 ? ? ? ?
#
_entity_poly.entity_id 1
_entity_poly.type 'polypeptide(L)'
_entity_poly.nstd_linkage no
_entity_poly.nstd_monomer no
_entity_poly.pdbx_seq_one_letter_code
;GAMVSRSTHLVGQDGLCLDVIGGYSDNHVPTQLWPCGPQNNQLWTIQADGTIRTMGKCLVPNGHDPGSYTMIDDCNKADP
NDKTWKLYPDGTLTHVRSSLVLTSQGTGAYAITTIETNTSAPTQSWGTAD
;
_entity_poly.pdbx_seq_one_letter_code_can
;GAMVSRSTHLVGQDGLCLDVIGGYSDNHVPTQLWPCGPQNNQLWTIQADGTIRTMGKCLVPNGHDPGSYTMIDDCNKADP
NDKTWKLYPDGTLTHVRSSLVLTSQGTGAYAITTIETNTSAPTQSWGTAD
;
_entity_poly.pdbx_strand_id A
_entity_poly.pdbx_target_identifier ?
#
loop_
_pdbx_entity_nonpoly.entity_id
_pdbx_entity_nonpoly.name
_pdbx_entity_nonpoly.comp_id
3 'CADMIUM ION' CD
4 water HOH
#
loop_
_entity_poly_seq.entity_id
_entity_poly_seq.num
_entity_poly_seq.mon_id
_entity_poly_seq.hetero
1 1 GLY n
1 2 ALA n
1 3 MET n
1 4 VAL n
1 5 SER n
1 6 ARG n
1 7 SER n
1 8 THR n
1 9 HIS n
1 10 LEU n
1 11 VAL n
1 12 GLY n
1 13 GLN n
1 14 ASP n
1 15 GLY n
1 16 LEU n
1 17 CYS n
1 18 LEU n
1 19 ASP n
1 20 VAL n
1 21 ILE n
1 22 GLY n
1 23 GLY n
1 24 TYR n
1 25 SER n
1 26 ASP n
1 27 ASN n
1 28 HIS n
1 29 VAL n
1 30 PRO n
1 31 THR n
1 32 GLN n
1 33 LEU n
1 34 TRP n
1 35 PRO n
1 36 CYS n
1 37 GLY n
1 38 PRO n
1 39 GLN n
1 40 ASN n
1 41 ASN n
1 42 GLN n
1 43 LEU n
1 44 TRP n
1 45 THR n
1 46 ILE n
1 47 GLN n
1 48 ALA n
1 49 ASP n
1 50 GLY n
1 51 THR n
1 52 ILE n
1 53 ARG n
1 54 THR n
1 55 MET n
1 56 GLY n
1 57 LYS n
1 58 CYS n
1 59 LEU n
1 60 VAL n
1 61 PRO n
1 62 ASN n
1 63 GLY n
1 64 HIS n
1 65 ASP n
1 66 PRO n
1 67 GLY n
1 68 SER n
1 69 TYR n
1 70 THR n
1 71 MET n
1 72 ILE n
1 73 ASP n
1 74 ASP n
1 75 CYS n
1 76 ASN n
1 77 LYS n
1 78 ALA n
1 79 ASP n
1 80 PRO n
1 81 ASN n
1 82 ASP n
1 83 LYS n
1 84 THR n
1 85 TRP n
1 86 LYS n
1 87 LEU n
1 88 TYR n
1 89 PRO n
1 90 ASP n
1 91 GLY n
1 92 THR n
1 93 LEU n
1 94 THR n
1 95 HIS n
1 96 VAL n
1 97 ARG n
1 98 SER n
1 99 SER n
1 100 LEU n
1 101 VAL n
1 102 LEU n
1 103 THR n
1 104 SER n
1 105 GLN n
1 106 GLY n
1 107 THR n
1 108 GLY n
1 109 ALA n
1 110 TYR n
1 111 ALA n
1 112 ILE n
1 113 THR n
1 114 THR n
1 115 ILE n
1 116 GLU n
1 117 THR n
1 118 ASN n
1 119 THR n
1 120 SER n
1 121 ALA n
1 122 PRO n
1 123 THR n
1 124 GLN n
1 125 SER n
1 126 TRP n
1 127 GLY n
1 128 THR n
1 129 ALA n
1 130 ASP n
#
_entity_src_gen.entity_id 1
_entity_src_gen.pdbx_src_id 1
_entity_src_gen.pdbx_alt_source_flag sample
_entity_src_gen.pdbx_seq_type 'Biological sequence'
_entity_src_gen.pdbx_beg_seq_num 1
_entity_src_gen.pdbx_end_seq_num 130
_entity_src_gen.gene_src_common_name muskmelon
_entity_src_gen.gene_src_genus ?
_entity_src_gen.pdbx_gene_src_gene 'LOC107992255, 107992255'
_entity_src_gen.gene_src_species ?
_entity_src_gen.gene_src_strain ?
_entity_src_gen.gene_src_tissue ?
_entity_src_gen.gene_src_tissue_fraction ?
_entity_src_gen.gene_src_details ?
_entity_src_gen.pdbx_gene_src_fragment ?
_entity_src_gen.pdbx_gene_src_scientific_name 'Cucumis melo'
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 3656
_entity_src_gen.pdbx_gene_src_variant ?
_entity_src_gen.pdbx_gene_src_cell_line ?
_entity_src_gen.pdbx_gene_src_atcc ?
_entity_src_gen.pdbx_gene_src_organ ?
_entity_src_gen.pdbx_gene_src_organelle ?
_entity_src_gen.pdbx_gene_src_cell ?
_entity_src_gen.pdbx_gene_src_cellular_location ?
_entity_src_gen.host_org_common_name ?
_entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli'
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562
_entity_src_gen.host_org_genus ?
_entity_src_gen.pdbx_host_org_gene ?
_entity_src_gen.pdbx_host_org_organ ?
_entity_src_gen.host_org_species ?
_entity_src_gen.pdbx_host_org_tissue ?
_entity_src_gen.pdbx_host_org_tissue_fraction ?
_entity_src_gen.pdbx_host_org_strain 'Tuner (DE3)'
_entity_src_gen.pdbx_host_org_variant ?
_entity_src_gen.pdbx_host_org_cell_line ?
_entity_src_gen.pdbx_host_org_atcc ?
_entity_src_gen.pdbx_host_org_culture_collection ?
_entity_src_gen.pdbx_host_org_cell ?
_entity_src_gen.pdbx_host_org_organelle ?
_entity_src_gen.pdbx_host_org_cellular_location ?
_entity_src_gen.pdbx_host_org_vector_type Pet40b-tev
_entity_src_gen.pdbx_host_org_vector ?
_entity_src_gen.host_org_details ?
_entity_src_gen.expression_system_id ?
_entity_src_gen.plasmid_name ?
_entity_src_gen.plasmid_details ?
_entity_src_gen.pdbx_description ?
#
_pdbx_entity_branch.entity_id 2
_pdbx_entity_branch.type oligosaccharide
#
loop_
_pdbx_entity_branch_descriptor.ordinal
_pdbx_entity_branch_descriptor.entity_id
_pdbx_entity_branch_descriptor.descriptor
_pdbx_entity_branch_descriptor.type
_pdbx_entity_branch_descriptor.program
_pdbx_entity_branch_descriptor.program_version
1 2 DGalpb1-4DGlcpNAca1-ROH 'Glycam Condensed Sequence' GMML 1.0
2 2 'WURCS=2.0/2,2,1/[a2122h-1a_1-5_2*NCC/3=O][a2112h-1b_1-5]/1-2/a4-b1' WURCS PDB2Glycan 1.1.0
3 2 '[][a-D-GlcpNAc]{[(4+1)][b-D-Galp]{}}' LINUCS PDB-CARE ?
#
_pdbx_entity_branch_link.link_id 1
_pdbx_entity_branch_link.entity_id 2
_pdbx_entity_branch_link.entity_branch_list_num_1 2
_pdbx_entity_branch_link.comp_id_1 GAL
_pdbx_entity_branch_link.atom_id_1 C1
_pdbx_entity_branch_link.leaving_atom_id_1 O1
_pdbx_entity_branch_link.entity_branch_list_num_2 1
_pdbx_entity_branch_link.comp_id_2 NDG
_pdbx_entity_branch_link.atom_id_2 O4
_pdbx_entity_branch_link.leaving_atom_id_2 HO4
_pdbx_entity_branch_link.value_order sing
_pdbx_entity_branch_link.details ?
#
loop_
_chem_comp.id
_chem_comp.type
_chem_comp.mon_nstd_flag
_chem_comp.name
_chem_comp.pdbx_synonyms
_chem_comp.formula
_chem_comp.formula_weight
ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093
ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209
ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103
CD non-polymer . 'CADMIUM ION' ? 'Cd 2' 112.411
CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158
GAL 'D-saccharide, beta linking' . beta-D-galactopyranose 'beta-D-galactose; D-galactose; galactose'
'C6 H12 O6' 180.156
GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129
GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067
HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162
HOH non-polymer . WATER ? 'H2 O' 18.015
ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173
LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173
LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195
MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211
NDG 'D-saccharide, alpha linking' . 2-acetamido-2-deoxy-alpha-D-glucopyranose
;N-acetyl-alpha-D-glucosamine; 2-acetamido-2-deoxy-alpha-D-glucose; 2-acetamido-2-deoxy-D-glucose; 2-acetamido-2-deoxy-glucose; 2-(ACETYLAMINO)-2-DEOXY-A-D-GLUCOPYRANOSE
;
'C8 H15 N O6' 221.208
PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130
SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093
THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119
TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225
TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189
VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146
#
loop_
_pdbx_chem_comp_identifier.comp_id
_pdbx_chem_comp_identifier.type
_pdbx_chem_comp_identifier.program
_pdbx_chem_comp_identifier.program_version
_pdbx_chem_comp_identifier.identifier
GAL 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML 1.0 DGalpb
GAL 'COMMON NAME' GMML 1.0 b-D-galactopyranose
GAL 'IUPAC CARBOHYDRATE SYMBOL' PDB-CARE 1.0 b-D-Galp
GAL 'SNFG CARBOHYDRATE SYMBOL' GMML 1.0 Gal
NDG 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML 1.0 DGlcpNAca
NDG 'COMMON NAME' GMML 1.0 N-acetyl-a-D-glucopyranosamine
NDG 'IUPAC CARBOHYDRATE SYMBOL' PDB-CARE 1.0 a-D-GlcpNAc
NDG 'SNFG CARBOHYDRATE SYMBOL' GMML 1.0 GlcNAc
#
loop_
_pdbx_poly_seq_scheme.asym_id
_pdbx_poly_seq_scheme.entity_id
_pdbx_poly_seq_scheme.seq_id
_pdbx_poly_seq_scheme.mon_id
_pdbx_poly_seq_scheme.ndb_seq_num
_pdbx_poly_seq_scheme.pdb_seq_num
_pdbx_poly_seq_scheme.auth_seq_num
_pdbx_poly_seq_scheme.pdb_mon_id
_pdbx_poly_seq_scheme.auth_mon_id
_pdbx_poly_seq_scheme.pdb_strand_id
_pdbx_poly_seq_scheme.pdb_ins_code
_pdbx_poly_seq_scheme.hetero
A 1 1 GLY 1 3 ? ? ? A . n
A 1 2 ALA 2 4 ? ? ? A . n
A 1 3 MET 3 5 ? ? ? A . n
A 1 4 VAL 4 6 6 VAL VAL A . n
A 1 5 SER 5 7 7 SER SER A . n
A 1 6 ARG 6 8 8 ARG ARG A . n
A 1 7 SER 7 9 9 SER SER A . n
A 1 8 THR 8 10 10 THR THR A . n
A 1 9 HIS 9 11 11 HIS HIS A . n
A 1 10 LEU 10 12 12 LEU LEU A . n
A 1 11 VAL 11 13 13 VAL VAL A . n
A 1 12 GLY 12 14 14 GLY GLY A . n
A 1 13 GLN 13 15 15 GLN GLN A . n
A 1 14 ASP 14 16 16 ASP ASP A . n
A 1 15 GLY 15 17 17 GLY GLY A . n
A 1 16 LEU 16 18 18 LEU LEU A . n
A 1 17 CYS 17 19 19 CYS CYS A . n
A 1 18 LEU 18 20 20 LEU LEU A . n
A 1 19 ASP 19 21 21 ASP ASP A . n
A 1 20 VAL 20 22 22 VAL VAL A . n
A 1 21 ILE 21 23 23 ILE ILE A . n
A 1 22 GLY 22 24 24 GLY GLY A . n
A 1 23 GLY 23 25 25 GLY GLY A . n
A 1 24 TYR 24 26 26 TYR TYR A . n
A 1 25 SER 25 27 27 SER SER A . n
A 1 26 ASP 26 28 28 ASP ASP A . n
A 1 27 ASN 27 29 29 ASN ASN A . n
A 1 28 HIS 28 30 30 HIS HIS A . n
A 1 29 VAL 29 31 31 VAL VAL A . n
A 1 30 PRO 30 32 32 PRO PRO A . n
A 1 31 THR 31 33 33 THR THR A . n
A 1 32 GLN 32 34 34 GLN GLN A . n
A 1 33 LEU 33 35 35 LEU LEU A . n
A 1 34 TRP 34 36 36 TRP TRP A . n
A 1 35 PRO 35 37 37 PRO PRO A . n
A 1 36 CYS 36 38 38 CYS CYS A . n
A 1 37 GLY 37 39 39 GLY GLY A . n
A 1 38 PRO 38 40 40 PRO PRO A . n
A 1 39 GLN 39 41 41 GLN GLN A . n
A 1 40 ASN 40 42 42 ASN ASN A . n
A 1 41 ASN 41 43 43 ASN ASN A . n
A 1 42 GLN 42 44 44 GLN GLN A . n
A 1 43 LEU 43 45 45 LEU LEU A . n
A 1 44 TRP 44 46 46 TRP TRP A . n
A 1 45 THR 45 47 47 THR THR A . n
A 1 46 ILE 46 48 48 ILE ILE A . n
A 1 47 GLN 47 49 49 GLN GLN A . n
A 1 48 ALA 48 50 50 ALA ALA A . n
A 1 49 ASP 49 51 51 ASP ASP A . n
A 1 50 GLY 50 52 52 GLY GLY A . n
A 1 51 THR 51 53 53 THR THR A . n
A 1 52 ILE 52 54 54 ILE ILE A . n
A 1 53 ARG 53 55 55 ARG ARG A . n
A 1 54 THR 54 56 56 THR THR A . n
A 1 55 MET 55 57 57 MET MET A . n
A 1 56 GLY 56 58 58 GLY GLY A . n
A 1 57 LYS 57 59 59 LYS LYS A . n
A 1 58 CYS 58 60 60 CYS CYS A . n
A 1 59 LEU 59 61 61 LEU LEU A . n
A 1 60 VAL 60 62 62 VAL VAL A . n
A 1 61 PRO 61 63 63 PRO PRO A . n
A 1 62 ASN 62 64 64 ASN ASN A . n
A 1 63 GLY 63 65 65 GLY GLY A . n
A 1 64 HIS 64 66 66 HIS HIS A . n
A 1 65 ASP 65 67 67 ASP ASP A . n
A 1 66 PRO 66 68 68 PRO PRO A . n
A 1 67 GLY 67 69 69 GLY GLY A . n
A 1 68 SER 68 70 70 SER SER A . n
A 1 69 TYR 69 71 71 TYR TYR A . n
A 1 70 THR 70 72 72 THR THR A . n
A 1 71 MET 71 73 73 MET MET A . n
A 1 72 ILE 72 74 74 ILE ILE A . n
A 1 73 ASP 73 75 75 ASP ASP A . n
A 1 74 ASP 74 76 76 ASP ASP A . n
A 1 75 CYS 75 77 77 CYS CYS A . n
A 1 76 ASN 76 78 78 ASN ASN A . n
A 1 77 LYS 77 79 79 LYS LYS A . n
A 1 78 ALA 78 80 80 ALA ALA A . n
A 1 79 ASP 79 81 81 ASP ASP A . n
A 1 80 PRO 80 82 82 PRO PRO A . n
A 1 81 ASN 81 83 83 ASN ASN A . n
A 1 82 ASP 82 84 84 ASP ASP A . n
A 1 83 LYS 83 85 85 LYS LYS A . n
A 1 84 THR 84 86 86 THR THR A . n
A 1 85 TRP 85 87 87 TRP TRP A . n
A 1 86 LYS 86 88 88 LYS LYS A . n
A 1 87 LEU 87 89 89 LEU LEU A . n
A 1 88 TYR 88 90 90 TYR TYR A . n
A 1 89 PRO 89 91 91 PRO PRO A . n
A 1 90 ASP 90 92 92 ASP ASP A . n
A 1 91 GLY 91 93 93 GLY GLY A . n
A 1 92 THR 92 94 94 THR THR A . n
A 1 93 LEU 93 95 95 LEU LEU A . n
A 1 94 THR 94 96 96 THR THR A . n
A 1 95 HIS 95 97 97 HIS HIS A . n
A 1 96 VAL 96 98 98 VAL VAL A . n
A 1 97 ARG 97 99 99 ARG ARG A . n
A 1 98 SER 98 100 100 SER SER A . n
A 1 99 SER 99 101 101 SER SER A . n
A 1 100 LEU 100 102 102 LEU LEU A . n
A 1 101 VAL 101 103 103 VAL VAL A . n
A 1 102 LEU 102 104 104 LEU LEU A . n
A 1 103 THR 103 105 105 THR THR A . n
A 1 104 SER 104 106 106 SER SER A . n
A 1 105 GLN 105 107 107 GLN GLN A . n
A 1 106 GLY 106 108 108 GLY GLY A . n
A 1 107 THR 107 109 109 THR THR A . n
A 1 108 GLY 108 110 110 GLY GLY A . n
A 1 109 ALA 109 111 111 ALA ALA A . n
A 1 110 TYR 110 112 112 TYR TYR A . n
A 1 111 ALA 111 113 113 ALA ALA A . n
A 1 112 ILE 112 114 114 ILE ILE A . n
A 1 113 THR 113 115 115 THR THR A . n
A 1 114 THR 114 116 116 THR THR A . n
A 1 115 ILE 115 117 117 ILE ILE A . n
A 1 116 GLU 116 118 118 GLU GLU A . n
A 1 117 THR 117 119 119 THR THR A . n
A 1 118 ASN 118 120 120 ASN ASN A . n
A 1 119 THR 119 121 121 THR THR A . n
A 1 120 SER 120 122 122 SER SER A . n
A 1 121 ALA 121 123 123 ALA ALA A . n
A 1 122 PRO 122 124 124 PRO PRO A . n
A 1 123 THR 123 125 125 THR THR A . n
A 1 124 GLN 124 126 126 GLN GLN A . n
A 1 125 SER 125 127 127 SER SER A . n
A 1 126 TRP 126 128 128 TRP TRP A . n
A 1 127 GLY 127 129 129 GLY GLY A . n
A 1 128 THR 128 130 130 THR THR A . n
A 1 129 ALA 129 131 131 ALA ALA A . n
A 1 130 ASP 130 132 132 ASP ASP A . n
#
loop_
_pdbx_branch_scheme.asym_id
_pdbx_branch_scheme.entity_id
_pdbx_branch_scheme.mon_id
_pdbx_branch_scheme.num
_pdbx_branch_scheme.pdb_asym_id
_pdbx_branch_scheme.pdb_mon_id
_pdbx_branch_scheme.pdb_seq_num
_pdbx_branch_scheme.auth_asym_id
_pdbx_branch_scheme.auth_mon_id
_pdbx_branch_scheme.auth_seq_num
_pdbx_branch_scheme.hetero
B 2 NDG 1 C NDG 1 C NDG 2 n
B 2 GAL 2 C GAL 2 C GAL 1 n
#
loop_
_pdbx_entity_instance_feature.ordinal
_pdbx_entity_instance_feature.comp_id
_pdbx_entity_instance_feature.asym_id
_pdbx_entity_instance_feature.seq_num
_pdbx_entity_instance_feature.auth_comp_id
_pdbx_entity_instance_feature.auth_asym_id
_pdbx_entity_instance_feature.auth_seq_num
_pdbx_entity_instance_feature.feature_type
_pdbx_entity_instance_feature.details
1 NDG ? ? NDG ? ? 'SUBJECT OF INVESTIGATION' ?
2 GAL ? ? GAL ? ? 'SUBJECT OF INVESTIGATION' ?
3 CD ? ? CD ? ? 'SUBJECT OF INVESTIGATION' ?
#
loop_
_pdbx_nonpoly_scheme.asym_id
_pdbx_nonpoly_scheme.entity_id
_pdbx_nonpoly_scheme.mon_id
_pdbx_nonpoly_scheme.ndb_seq_num
_pdbx_nonpoly_scheme.pdb_seq_num
_pdbx_nonpoly_scheme.auth_seq_num
_pdbx_nonpoly_scheme.pdb_mon_id
_pdbx_nonpoly_scheme.auth_mon_id
_pdbx_nonpoly_scheme.pdb_strand_id
_pdbx_nonpoly_scheme.pdb_ins_code
C 3 CD 1 201 201 CD CD A .
D 3 CD 1 202 202 CD CD A .
E 3 CD 1 203 203 CD CD A .
F 4 HOH 1 301 107 HOH HOH A .
F 4 HOH 2 302 126 HOH HOH A .
F 4 HOH 3 303 213 HOH HOH A .
F 4 HOH 4 304 157 HOH HOH A .
F 4 HOH 5 305 31 HOH HOH A .
F 4 HOH 6 306 160 HOH HOH A .
F 4 HOH 7 307 72 HOH HOH A .
F 4 HOH 8 308 41 HOH HOH A .
F 4 HOH 9 309 124 HOH HOH A .
F 4 HOH 10 310 93 HOH HOH A .
F 4 HOH 11 311 131 HOH HOH A .
F 4 HOH 12 312 150 HOH HOH A .
F 4 HOH 13 313 122 HOH HOH A .
F 4 HOH 14 314 73 HOH HOH A .
F 4 HOH 15 315 81 HOH HOH A .
F 4 HOH 16 316 28 HOH HOH A .
F 4 HOH 17 317 134 HOH HOH A .
F 4 HOH 18 318 57 HOH HOH A .
F 4 HOH 19 319 39 HOH HOH A .
F 4 HOH 20 320 20 HOH HOH A .
F 4 HOH 21 321 99 HOH HOH A .
F 4 HOH 22 322 45 HOH HOH A .
F 4 HOH 23 323 219 HOH HOH A .
F 4 HOH 24 324 79 HOH HOH A .
F 4 HOH 25 325 238 HOH HOH A .
F 4 HOH 26 326 2 HOH HOH A .
F 4 HOH 27 327 151 HOH HOH A .
F 4 HOH 28 328 21 HOH HOH A .
F 4 HOH 29 329 148 HOH HOH A .
F 4 HOH 30 330 184 HOH HOH A .
F 4 HOH 31 331 76 HOH HOH A .
F 4 HOH 32 332 25 HOH HOH A .
F 4 HOH 33 333 11 HOH HOH A .
F 4 HOH 34 334 65 HOH HOH A .
F 4 HOH 35 335 19 HOH HOH A .
F 4 HOH 36 336 3 HOH HOH A .
F 4 HOH 37 337 205 HOH HOH A .
F 4 HOH 38 338 53 HOH HOH A .
F 4 HOH 39 339 14 HOH HOH A .
F 4 HOH 40 340 198 HOH HOH A .
F 4 HOH 41 341 242 HOH HOH A .
F 4 HOH 42 342 141 HOH HOH A .
F 4 HOH 43 343 15 HOH HOH A .
F 4 HOH 44 344 132 HOH HOH A .
F 4 HOH 45 345 103 HOH HOH A .
F 4 HOH 46 346 12 HOH HOH A .
F 4 HOH 47 347 163 HOH HOH A .
F 4 HOH 48 348 127 HOH HOH A .
F 4 HOH 49 349 110 HOH HOH A .
F 4 HOH 50 350 105 HOH HOH A .
F 4 HOH 51 351 154 HOH HOH A .
F 4 HOH 52 352 6 HOH HOH A .
F 4 HOH 53 353 112 HOH HOH A .
F 4 HOH 54 354 144 HOH HOH A .
F 4 HOH 55 355 10 HOH HOH A .
F 4 HOH 56 356 97 HOH HOH A .
F 4 HOH 57 357 117 HOH HOH A .
F 4 HOH 58 358 17 HOH HOH A .
F 4 HOH 59 359 13 HOH HOH A .
F 4 HOH 60 360 33 HOH HOH A .
F 4 HOH 61 361 118 HOH HOH A .
F 4 HOH 62 362 218 HOH HOH A .
F 4 HOH 63 363 1 HOH HOH A .
F 4 HOH 64 364 34 HOH HOH A .
F 4 HOH 65 365 91 HOH HOH A .
F 4 HOH 66 366 18 HOH HOH A .
F 4 HOH 67 367 146 HOH HOH A .
F 4 HOH 68 368 59 HOH HOH A .
F 4 HOH 69 369 5 HOH HOH A .
F 4 HOH 70 370 4 HOH HOH A .
F 4 HOH 71 371 78 HOH HOH A .
F 4 HOH 72 372 70 HOH HOH A .
F 4 HOH 73 373 32 HOH HOH A .
F 4 HOH 74 374 193 HOH HOH A .
F 4 HOH 75 375 153 HOH HOH A .
F 4 HOH 76 376 40 HOH HOH A .
F 4 HOH 77 377 74 HOH HOH A .
F 4 HOH 78 378 8 HOH HOH A .
F 4 HOH 79 379 9 HOH HOH A .
F 4 HOH 80 380 42 HOH HOH A .
F 4 HOH 81 381 35 HOH HOH A .
F 4 HOH 82 382 98 HOH HOH A .
F 4 HOH 83 383 123 HOH HOH A .
F 4 HOH 84 384 155 HOH HOH A .
F 4 HOH 85 385 51 HOH HOH A .
F 4 HOH 86 386 80 HOH HOH A .
F 4 HOH 87 387 43 HOH HOH A .
F 4 HOH 88 388 204 HOH HOH A .
F 4 HOH 89 389 240 HOH HOH A .
F 4 HOH 90 390 143 HOH HOH A .
F 4 HOH 91 391 140 HOH HOH A .
F 4 HOH 92 392 101 HOH HOH A .
F 4 HOH 93 393 87 HOH HOH A .
F 4 HOH 94 394 26 HOH HOH A .
F 4 HOH 95 395 119 HOH HOH A .
F 4 HOH 96 396 194 HOH HOH A .
F 4 HOH 97 397 246 HOH HOH A .
F 4 HOH 98 398 135 HOH HOH A .
F 4 HOH 99 399 52 HOH HOH A .
F 4 HOH 100 400 16 HOH HOH A .
F 4 HOH 101 401 149 HOH HOH A .
F 4 HOH 102 402 46 HOH HOH A .
F 4 HOH 103 403 66 HOH HOH A .
F 4 HOH 104 404 69 HOH HOH A .
F 4 HOH 105 405 106 HOH HOH A .
F 4 HOH 106 406 192 HOH HOH A .
F 4 HOH 107 407 83 HOH HOH A .
F 4 HOH 108 408 231 HOH HOH A .
F 4 HOH 109 409 130 HOH HOH A .
F 4 HOH 110 410 67 HOH HOH A .
F 4 HOH 111 411 29 HOH HOH A .
F 4 HOH 112 412 129 HOH HOH A .
F 4 HOH 113 413 44 HOH HOH A .
F 4 HOH 114 414 152 HOH HOH A .
F 4 HOH 115 415 95 HOH HOH A .
F 4 HOH 116 416 233 HOH HOH A .
F 4 HOH 117 417 68 HOH HOH A .
F 4 HOH 118 418 203 HOH HOH A .
F 4 HOH 119 419 109 HOH HOH A .
F 4 HOH 120 420 116 HOH HOH A .
F 4 HOH 121 421 82 HOH HOH A .
F 4 HOH 122 422 239 HOH HOH A .
F 4 HOH 123 423 244 HOH HOH A .
F 4 HOH 124 424 115 HOH HOH A .
F 4 HOH 125 425 142 HOH HOH A .
F 4 HOH 126 426 23 HOH HOH A .
F 4 HOH 127 427 104 HOH HOH A .
F 4 HOH 128 428 38 HOH HOH A .
F 4 HOH 129 429 202 HOH HOH A .
F 4 HOH 130 430 85 HOH HOH A .
F 4 HOH 131 431 88 HOH HOH A .
F 4 HOH 132 432 63 HOH HOH A .
F 4 HOH 133 433 75 HOH HOH A .
F 4 HOH 134 434 92 HOH HOH A .
F 4 HOH 135 435 111 HOH HOH A .
F 4 HOH 136 436 108 HOH HOH A .
F 4 HOH 137 437 48 HOH HOH A .
F 4 HOH 138 438 96 HOH HOH A .
F 4 HOH 139 439 36 HOH HOH A .
F 4 HOH 140 440 159 HOH HOH A .
F 4 HOH 141 441 145 HOH HOH A .
F 4 HOH 142 442 64 HOH HOH A .
F 4 HOH 143 443 90 HOH HOH A .
F 4 HOH 144 444 210 HOH HOH A .
F 4 HOH 145 445 27 HOH HOH A .
F 4 HOH 146 446 22 HOH HOH A .
F 4 HOH 147 447 89 HOH HOH A .
F 4 HOH 148 448 61 HOH HOH A .
F 4 HOH 149 449 120 HOH HOH A .
F 4 HOH 150 450 164 HOH HOH A .
F 4 HOH 151 451 94 HOH HOH A .
F 4 HOH 152 452 147 HOH HOH A .
F 4 HOH 153 453 237 HOH HOH A .
F 4 HOH 154 454 7 HOH HOH A .
F 4 HOH 155 455 236 HOH HOH A .
F 4 HOH 156 456 30 HOH HOH A .
F 4 HOH 157 457 55 HOH HOH A .
F 4 HOH 158 458 49 HOH HOH A .
F 4 HOH 159 459 222 HOH HOH A .
F 4 HOH 160 460 182 HOH HOH A .
F 4 HOH 161 461 211 HOH HOH A .
F 4 HOH 162 462 169 HOH HOH A .
F 4 HOH 163 463 221 HOH HOH A .
F 4 HOH 164 464 161 HOH HOH A .
F 4 HOH 165 465 241 HOH HOH A .
F 4 HOH 166 466 77 HOH HOH A .
F 4 HOH 167 467 128 HOH HOH A .
F 4 HOH 168 468 125 HOH HOH A .
F 4 HOH 169 469 172 HOH HOH A .
F 4 HOH 170 470 188 HOH HOH A .
F 4 HOH 171 471 181 HOH HOH A .
F 4 HOH 172 472 100 HOH HOH A .
F 4 HOH 173 473 197 HOH HOH A .
F 4 HOH 174 474 177 HOH HOH A .
F 4 HOH 175 475 201 HOH HOH A .
F 4 HOH 176 476 170 HOH HOH A .
F 4 HOH 177 477 56 HOH HOH A .
F 4 HOH 178 478 220 HOH HOH A .
F 4 HOH 179 479 223 HOH HOH A .
F 4 HOH 180 480 158 HOH HOH A .
F 4 HOH 181 481 54 HOH HOH A .
F 4 HOH 182 482 60 HOH HOH A .
F 4 HOH 183 483 247 HOH HOH A .
F 4 HOH 184 484 136 HOH HOH A .
F 4 HOH 185 485 212 HOH HOH A .
F 4 HOH 186 486 225 HOH HOH A .
F 4 HOH 187 487 166 HOH HOH A .
F 4 HOH 188 488 208 HOH HOH A .
F 4 HOH 189 489 139 HOH HOH A .
F 4 HOH 190 490 206 HOH HOH A .
F 4 HOH 191 491 209 HOH HOH A .
F 4 HOH 192 492 215 HOH HOH A .
F 4 HOH 193 493 248 HOH HOH A .
F 4 HOH 194 494 227 HOH HOH A .
F 4 HOH 195 495 165 HOH HOH A .
F 4 HOH 196 496 156 HOH HOH A .
F 4 HOH 197 497 176 HOH HOH A .
F 4 HOH 198 498 47 HOH HOH A .
F 4 HOH 199 499 179 HOH HOH A .
F 4 HOH 200 500 245 HOH HOH A .
F 4 HOH 201 501 114 HOH HOH A .
F 4 HOH 202 502 232 HOH HOH A .
F 4 HOH 203 503 186 HOH HOH A .
F 4 HOH 204 504 171 HOH HOH A .
F 4 HOH 205 505 62 HOH HOH A .
F 4 HOH 206 506 58 HOH HOH A .
F 4 HOH 207 507 168 HOH HOH A .
F 4 HOH 208 508 138 HOH HOH A .
F 4 HOH 209 509 249 HOH HOH A .
F 4 HOH 210 510 180 HOH HOH A .
F 4 HOH 211 511 37 HOH HOH A .
F 4 HOH 212 512 50 HOH HOH A .
F 4 HOH 213 513 183 HOH HOH A .
F 4 HOH 214 514 214 HOH HOH A .
F 4 HOH 215 515 178 HOH HOH A .
F 4 HOH 216 516 137 HOH HOH A .
F 4 HOH 217 517 207 HOH HOH A .
F 4 HOH 218 518 185 HOH HOH A .
F 4 HOH 219 519 190 HOH HOH A .
F 4 HOH 220 520 71 HOH HOH A .
F 4 HOH 221 521 250 HOH HOH A .
F 4 HOH 222 522 196 HOH HOH A .
F 4 HOH 223 523 86 HOH HOH A .
F 4 HOH 224 524 199 HOH HOH A .
F 4 HOH 225 525 84 HOH HOH A .
F 4 HOH 226 526 24 HOH HOH A .
F 4 HOH 227 527 191 HOH HOH A .
F 4 HOH 228 528 243 HOH HOH A .
F 4 HOH 229 529 174 HOH HOH A .
F 4 HOH 230 530 162 HOH HOH A .
F 4 HOH 231 531 228 HOH HOH A .
F 4 HOH 232 532 187 HOH HOH A .
F 4 HOH 233 533 175 HOH HOH A .
F 4 HOH 234 534 189 HOH HOH A .
F 4 HOH 235 535 234 HOH HOH A .
F 4 HOH 236 536 224 HOH HOH A .
F 4 HOH 237 537 217 HOH HOH A .
F 4 HOH 238 538 235 HOH HOH A .
F 4 HOH 239 539 102 HOH HOH A .
F 4 HOH 240 540 113 HOH HOH A .
F 4 HOH 241 541 200 HOH HOH A .
#
loop_
_pdbx_unobs_or_zero_occ_atoms.id
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num
_pdbx_unobs_or_zero_occ_atoms.polymer_flag
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id
_pdbx_unobs_or_zero_occ_atoms.label_alt_id
_pdbx_unobs_or_zero_occ_atoms.label_asym_id
_pdbx_unobs_or_zero_occ_atoms.label_comp_id
_pdbx_unobs_or_zero_occ_atoms.label_seq_id
_pdbx_unobs_or_zero_occ_atoms.label_atom_id
1 1 Y 1 A ARG 8 ? CD ? A ARG 6 CD
2 1 Y 1 A ARG 8 ? NE ? A ARG 6 NE
3 1 Y 1 A ARG 8 ? CZ ? A ARG 6 CZ
4 1 Y 1 A ARG 8 ? NH1 ? A ARG 6 NH1
5 1 Y 1 A ARG 8 ? NH2 ? A ARG 6 NH2
#
loop_
_software.citation_id
_software.classification
_software.compiler_name
_software.compiler_version
_software.contact_author
_software.contact_author_email
_software.date
_software.description
_software.dependencies
_software.hardware
_software.language
_software.location
_software.mods
_software.name
_software.os
_software.os_version
_software.type
_software.version
_software.pdbx_ordinal
? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0419 1
? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2
? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? 0.7.13 3
? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? 2.8.3 4
#
_cell.angle_alpha 90.000
_cell.angle_alpha_esd ?
_cell.angle_beta 99.237
_cell.angle_beta_esd ?
_cell.angle_gamma 90.000
_cell.angle_gamma_esd ?
_cell.entry_id 8R8A
_cell.details ?
_cell.formula_units_Z ?
_cell.length_a 36.696
_cell.length_a_esd ?
_cell.length_b 36.782
_cell.length_b_esd ?
_cell.length_c 94.786
_cell.length_c_esd ?
_cell.volume ?
_cell.volume_esd ?
_cell.Z_PDB 4
_cell.reciprocal_angle_alpha ?
_cell.reciprocal_angle_beta ?
_cell.reciprocal_angle_gamma ?
_cell.reciprocal_angle_alpha_esd ?
_cell.reciprocal_angle_beta_esd ?
_cell.reciprocal_angle_gamma_esd ?
_cell.reciprocal_length_a ?
_cell.reciprocal_length_b ?
_cell.reciprocal_length_c ?
_cell.reciprocal_length_a_esd ?
_cell.reciprocal_length_b_esd ?
_cell.reciprocal_length_c_esd ?
_cell.pdbx_unique_axis ?
_cell.pdbx_esd_method ?
#
_symmetry.entry_id 8R8A
_symmetry.cell_setting ?
_symmetry.Int_Tables_number 5
_symmetry.space_group_name_Hall ?
_symmetry.space_group_name_H-M 'I 1 2 1'
_symmetry.pdbx_full_space_group_name_H-M ?
#
_exptl.absorpt_coefficient_mu ?
_exptl.absorpt_correction_T_max ?
_exptl.absorpt_correction_T_min ?
_exptl.absorpt_correction_type ?
_exptl.absorpt_process_details ?
_exptl.entry_id 8R8A
_exptl.crystals_number 1
_exptl.details ?
_exptl.method 'X-RAY DIFFRACTION'
_exptl.method_details ?
#
_exptl_crystal.colour ?
_exptl_crystal.density_diffrn ?
_exptl_crystal.density_Matthews 2.29
_exptl_crystal.density_method ?
_exptl_crystal.density_percent_sol 46.21
_exptl_crystal.description diamond
_exptl_crystal.F_000 ?
_exptl_crystal.id 1
_exptl_crystal.preparation ?
_exptl_crystal.size_max ?
_exptl_crystal.size_mid ?
_exptl_crystal.size_min ?
_exptl_crystal.size_rad ?
_exptl_crystal.colour_lustre ?
_exptl_crystal.colour_modifier ?
_exptl_crystal.colour_primary ?
_exptl_crystal.density_meas ?
_exptl_crystal.density_meas_esd ?
_exptl_crystal.density_meas_gt ?
_exptl_crystal.density_meas_lt ?
_exptl_crystal.density_meas_temp ?
_exptl_crystal.density_meas_temp_esd ?
_exptl_crystal.density_meas_temp_gt ?
_exptl_crystal.density_meas_temp_lt ?
_exptl_crystal.pdbx_crystal_image_url ?
_exptl_crystal.pdbx_crystal_image_format ?
_exptl_crystal.pdbx_mosaicity ?
_exptl_crystal.pdbx_mosaicity_esd ?
_exptl_crystal.pdbx_mosaic_method ?
_exptl_crystal.pdbx_mosaic_block_size ?
_exptl_crystal.pdbx_mosaic_block_size_esd ?
#
_exptl_crystal_grow.apparatus ?
_exptl_crystal_grow.atmosphere ?
_exptl_crystal_grow.crystal_id 1
_exptl_crystal_grow.details ?
_exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP'
_exptl_crystal_grow.method_ref ?
_exptl_crystal_grow.pH ?
_exptl_crystal_grow.pressure ?
_exptl_crystal_grow.pressure_esd ?
_exptl_crystal_grow.seeding ?
_exptl_crystal_grow.seeding_ref ?
_exptl_crystal_grow.temp_details ?
_exptl_crystal_grow.temp_esd ?
_exptl_crystal_grow.time ?
_exptl_crystal_grow.pdbx_details
;10% Peg Smear Medium, 0.1 M Mes pH 6.5, and 5 mM of CaCl2, MgCl2, CsCl2, CdCl2, NiCl2 and Zinc acetate
transfered in 30% Peg Smear Medium 5mM CdCl2 for cryoprotection
;
_exptl_crystal_grow.pdbx_pH_range ?
_exptl_crystal_grow.temp 292
#
_diffrn.ambient_environment ?
_diffrn.ambient_temp 100
_diffrn.ambient_temp_details ?
_diffrn.ambient_temp_esd ?
_diffrn.crystal_id 1
_diffrn.crystal_support ?
_diffrn.crystal_treatment ?
_diffrn.details ?
_diffrn.id 1
_diffrn.ambient_pressure ?
_diffrn.ambient_pressure_esd ?
_diffrn.ambient_pressure_gt ?
_diffrn.ambient_pressure_lt ?
_diffrn.ambient_temp_gt ?
_diffrn.ambient_temp_lt ?
_diffrn.pdbx_serial_crystal_experiment N
#
_diffrn_detector.details ?
_diffrn_detector.detector PIXEL
_diffrn_detector.diffrn_id 1
_diffrn_detector.type 'DECTRIS EIGER X 16M'
_diffrn_detector.area_resol_mean ?
_diffrn_detector.dtime ?
_diffrn_detector.pdbx_frames_total ?
_diffrn_detector.pdbx_collection_time_total ?
_diffrn_detector.pdbx_collection_date 2023-10-05
_diffrn_detector.pdbx_frequency ?
_diffrn_detector.id ?
_diffrn_detector.number_of_axes ?
#
_diffrn_radiation.collimation ?
_diffrn_radiation.diffrn_id 1
_diffrn_radiation.filter_edge ?
_diffrn_radiation.inhomogeneity ?
_diffrn_radiation.monochromator ?
_diffrn_radiation.polarisn_norm ?
_diffrn_radiation.polarisn_ratio ?
_diffrn_radiation.probe ?
_diffrn_radiation.type ?
_diffrn_radiation.xray_symbol ?
_diffrn_radiation.wavelength_id 1
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l M
_diffrn_radiation.pdbx_wavelength_list ?
_diffrn_radiation.pdbx_wavelength ?
_diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH'
_diffrn_radiation.pdbx_analyzer ?
_diffrn_radiation.pdbx_scattering_type x-ray
#
_diffrn_radiation_wavelength.id 1
_diffrn_radiation_wavelength.wavelength 0.97856
_diffrn_radiation_wavelength.wt 1.0
#
_diffrn_source.current ?
_diffrn_source.details ?
_diffrn_source.diffrn_id 1
_diffrn_source.power ?
_diffrn_source.size ?
_diffrn_source.source SYNCHROTRON
_diffrn_source.target ?
_diffrn_source.type 'SOLEIL BEAMLINE PROXIMA 1'
_diffrn_source.voltage ?
_diffrn_source.take-off_angle ?
_diffrn_source.pdbx_wavelength_list 0.97856
_diffrn_source.pdbx_wavelength ?
_diffrn_source.pdbx_synchrotron_beamline 'PROXIMA 1'
_diffrn_source.pdbx_synchrotron_site SOLEIL
#
_reflns.B_iso_Wilson_estimate ?
_reflns.entry_id 8R8A
_reflns.data_reduction_details ?
_reflns.data_reduction_method ?
_reflns.d_resolution_high 1.317
_reflns.d_resolution_low 46.78
_reflns.details ?
_reflns.limit_h_max ?
_reflns.limit_h_min ?
_reflns.limit_k_max ?
_reflns.limit_k_min ?
_reflns.limit_l_max ?
_reflns.limit_l_min ?
_reflns.number_all ?
_reflns.number_obs 29695
_reflns.observed_criterion ?
_reflns.observed_criterion_F_max ?
_reflns.observed_criterion_F_min ?
_reflns.observed_criterion_I_max ?
_reflns.observed_criterion_I_min ?
_reflns.observed_criterion_sigma_F ?
_reflns.observed_criterion_sigma_I ?
_reflns.percent_possible_obs 99.8
_reflns.R_free_details ?
_reflns.Rmerge_F_all ?
_reflns.Rmerge_F_obs ?
_reflns.Friedel_coverage ?
_reflns.number_gt ?
_reflns.threshold_expression ?
_reflns.pdbx_redundancy 13.5
_reflns.pdbx_netI_over_av_sigmaI ?
_reflns.pdbx_netI_over_sigmaI 25.2
_reflns.pdbx_res_netI_over_av_sigmaI_2 ?
_reflns.pdbx_res_netI_over_sigmaI_2 ?
_reflns.pdbx_chi_squared ?
_reflns.pdbx_scaling_rejects ?
_reflns.pdbx_d_res_high_opt ?
_reflns.pdbx_d_res_low_opt ?
_reflns.pdbx_d_res_opt_method ?
_reflns.phase_calculation_details ?
_reflns.pdbx_Rrim_I_all 0.059
_reflns.pdbx_Rpim_I_all 0.022
_reflns.pdbx_d_opt ?
_reflns.pdbx_number_measured_all ?
_reflns.pdbx_diffrn_id 1
_reflns.pdbx_ordinal 1
_reflns.pdbx_CC_half 0.999
_reflns.pdbx_CC_star ?
_reflns.pdbx_R_split ?
_reflns.pdbx_Rmerge_I_obs 0.055
_reflns.pdbx_Rmerge_I_all ?
_reflns.pdbx_Rsym_value ?
_reflns.pdbx_CC_split_method ?
_reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ?
_reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ?
_reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ?
_reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ?
_reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ?
_reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ?
_reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ?
_reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ?
_reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ?
_reflns.pdbx_aniso_diffraction_limit_1 ?
_reflns.pdbx_aniso_diffraction_limit_2 ?
_reflns.pdbx_aniso_diffraction_limit_3 ?
_reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ?
_reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ?
_reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ?
_reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ?
_reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ?
_reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ?
_reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ?
_reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ?
_reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ?
_reflns.pdbx_aniso_B_tensor_eigenvalue_1 ?
_reflns.pdbx_aniso_B_tensor_eigenvalue_2 ?
_reflns.pdbx_aniso_B_tensor_eigenvalue_3 ?
_reflns.pdbx_orthogonalization_convention ?
_reflns.pdbx_percent_possible_ellipsoidal ?
_reflns.pdbx_percent_possible_spherical ?
_reflns.pdbx_percent_possible_ellipsoidal_anomalous ?
_reflns.pdbx_percent_possible_spherical_anomalous ?
_reflns.pdbx_redundancy_anomalous ?
_reflns.pdbx_CC_half_anomalous ?
_reflns.pdbx_absDiff_over_sigma_anomalous ?
_reflns.pdbx_percent_possible_anomalous ?
_reflns.pdbx_observed_signal_threshold ?
_reflns.pdbx_signal_type ?
_reflns.pdbx_signal_details ?
_reflns.pdbx_signal_software_id ?
#
_reflns_shell.d_res_high 1.32
_reflns_shell.d_res_low 1.34
_reflns_shell.meanI_over_sigI_all ?
_reflns_shell.meanI_over_sigI_obs 5.7
_reflns_shell.number_measured_all ?
_reflns_shell.number_measured_obs ?
_reflns_shell.number_possible ?
_reflns_shell.number_unique_all ?
_reflns_shell.number_unique_obs 1434
_reflns_shell.percent_possible_obs ?
_reflns_shell.Rmerge_F_all ?
_reflns_shell.Rmerge_F_obs ?
_reflns_shell.meanI_over_sigI_gt ?
_reflns_shell.meanI_over_uI_all ?
_reflns_shell.meanI_over_uI_gt ?
_reflns_shell.number_measured_gt ?
_reflns_shell.number_unique_gt ?
_reflns_shell.percent_possible_gt ?
_reflns_shell.Rmerge_F_gt ?
_reflns_shell.Rmerge_I_gt ?
_reflns_shell.pdbx_redundancy ?
_reflns_shell.pdbx_chi_squared ?
_reflns_shell.pdbx_netI_over_sigmaI_all ?
_reflns_shell.pdbx_netI_over_sigmaI_obs ?
_reflns_shell.pdbx_Rrim_I_all 0.400
_reflns_shell.pdbx_Rpim_I_all 0.153
_reflns_shell.pdbx_rejects ?
_reflns_shell.pdbx_ordinal 1
_reflns_shell.pdbx_diffrn_id 1
_reflns_shell.pdbx_CC_half 0.969
_reflns_shell.pdbx_CC_star ?
_reflns_shell.pdbx_R_split ?
_reflns_shell.percent_possible_all ?
_reflns_shell.Rmerge_I_all ?
_reflns_shell.Rmerge_I_obs 0.369
_reflns_shell.pdbx_Rsym_value ?
_reflns_shell.pdbx_percent_possible_ellipsoidal ?
_reflns_shell.pdbx_percent_possible_spherical ?
_reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ?
_reflns_shell.pdbx_percent_possible_spherical_anomalous ?
_reflns_shell.pdbx_redundancy_anomalous ?
_reflns_shell.pdbx_CC_half_anomalous ?
_reflns_shell.pdbx_absDiff_over_sigma_anomalous ?
_reflns_shell.pdbx_percent_possible_anomalous ?
#
_refine.aniso_B[1][1] -0.245
_refine.aniso_B[1][2] -0.000
_refine.aniso_B[1][3] -0.068
_refine.aniso_B[2][2] 0.761
_refine.aniso_B[2][3] 0.000
_refine.aniso_B[3][3] -0.470
_refine.B_iso_max ?
_refine.B_iso_mean 13.471
_refine.B_iso_min ?
_refine.correlation_coeff_Fo_to_Fc 0.971
_refine.correlation_coeff_Fo_to_Fc_free 0.950
_refine.details 'Hydrogens have been added in their riding positions anisotropic refinement'
_refine.diff_density_max ?
_refine.diff_density_max_esd ?
_refine.diff_density_min ?
_refine.diff_density_min_esd ?
_refine.diff_density_rms ?
_refine.diff_density_rms_esd ?
_refine.entry_id 8R8A
_refine.pdbx_refine_id 'X-RAY DIFFRACTION'
_refine.ls_abs_structure_details ?
_refine.ls_abs_structure_Flack ?
_refine.ls_abs_structure_Flack_esd ?
_refine.ls_abs_structure_Rogers ?
_refine.ls_abs_structure_Rogers_esd ?
_refine.ls_d_res_high 1.317
_refine.ls_d_res_low 46.778
_refine.ls_extinction_coef ?
_refine.ls_extinction_coef_esd ?
_refine.ls_extinction_expression ?
_refine.ls_extinction_method ?
_refine.ls_goodness_of_fit_all ?
_refine.ls_goodness_of_fit_all_esd ?
_refine.ls_goodness_of_fit_obs ?
_refine.ls_goodness_of_fit_obs_esd ?
_refine.ls_hydrogen_treatment ?
_refine.ls_matrix_type ?
_refine.ls_number_constraints ?
_refine.ls_number_parameters ?
_refine.ls_number_reflns_all ?
_refine.ls_number_reflns_obs 29694
_refine.ls_number_reflns_R_free 1503
_refine.ls_number_reflns_R_work 28191
_refine.ls_number_restraints ?
_refine.ls_percent_reflns_obs 99.798
_refine.ls_percent_reflns_R_free 5.062
_refine.ls_R_factor_all 0.146
_refine.ls_R_factor_obs ?
_refine.ls_R_factor_R_free 0.1858
_refine.ls_R_factor_R_free_error ?
_refine.ls_R_factor_R_free_error_details ?
_refine.ls_R_factor_R_work 0.1435
_refine.ls_R_Fsqd_factor_obs ?
_refine.ls_R_I_factor_obs ?
_refine.ls_redundancy_reflns_all ?
_refine.ls_redundancy_reflns_obs ?
_refine.ls_restrained_S_all ?
_refine.ls_restrained_S_obs ?
_refine.ls_shift_over_esd_max ?
_refine.ls_shift_over_esd_mean ?
_refine.ls_structure_factor_coef ?
_refine.ls_weighting_details ?
_refine.ls_weighting_scheme ?
_refine.ls_wR_factor_all ?
_refine.ls_wR_factor_obs ?
_refine.ls_wR_factor_R_free ?
_refine.ls_wR_factor_R_work ?
_refine.occupancy_max ?
_refine.occupancy_min ?
_refine.solvent_model_details 'MASK BULK SOLVENT'
_refine.solvent_model_param_bsol ?
_refine.solvent_model_param_ksol ?
_refine.pdbx_R_complete ?
_refine.ls_R_factor_gt ?
_refine.ls_goodness_of_fit_gt ?
_refine.ls_goodness_of_fit_ref ?
_refine.ls_shift_over_su_max ?
_refine.ls_shift_over_su_max_lt ?
_refine.ls_shift_over_su_mean ?
_refine.ls_shift_over_su_mean_lt ?
_refine.pdbx_ls_sigma_I ?
_refine.pdbx_ls_sigma_F ?
_refine.pdbx_ls_sigma_Fsqd ?
_refine.pdbx_data_cutoff_high_absF ?
_refine.pdbx_data_cutoff_high_rms_absF ?
_refine.pdbx_data_cutoff_low_absF ?
_refine.pdbx_isotropic_thermal_model ?
_refine.pdbx_ls_cross_valid_method 'FREE R-VALUE'
_refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT'
_refine.pdbx_starting_model ?
_refine.pdbx_stereochemistry_target_values ?
_refine.pdbx_R_Free_selection_details ?
_refine.pdbx_stereochem_target_val_spec_case ?
_refine.pdbx_overall_ESU_R 0.054
_refine.pdbx_overall_ESU_R_Free 0.054
_refine.pdbx_solvent_vdw_probe_radii 1.200
_refine.pdbx_solvent_ion_probe_radii 0.800
_refine.pdbx_solvent_shrinkage_radii 0.800
_refine.pdbx_real_space_R ?
_refine.pdbx_density_correlation ?
_refine.pdbx_pd_number_of_powder_patterns ?
_refine.pdbx_pd_number_of_points ?
_refine.pdbx_pd_meas_number_of_points ?
_refine.pdbx_pd_proc_ls_prof_R_factor ?
_refine.pdbx_pd_proc_ls_prof_wR_factor ?
_refine.pdbx_pd_Marquardt_correlation_coeff ?
_refine.pdbx_pd_Fsqrd_R_factor ?
_refine.pdbx_pd_ls_matrix_band_width ?
_refine.pdbx_overall_phase_error ?
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI ?
_refine.pdbx_overall_SU_R_free_Blow_DPI ?
_refine.pdbx_overall_SU_R_Blow_DPI ?
_refine.pdbx_TLS_residual_ADP_flag ?
_refine.pdbx_diffrn_id 1
_refine.overall_SU_B 1.297
_refine.overall_SU_ML 0.025
_refine.overall_SU_R_Cruickshank_DPI ?
_refine.overall_SU_R_free ?
_refine.overall_FOM_free_R_set ?
_refine.overall_FOM_work_R_set ?
_refine.pdbx_average_fsc_overall ?
_refine.pdbx_average_fsc_work ?
_refine.pdbx_average_fsc_free ?
#
_refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION'
_refine_hist.cycle_id LAST
_refine_hist.details ?
_refine_hist.d_res_high 1.317
_refine_hist.d_res_low 46.778
_refine_hist.number_atoms_solvent 241
_refine_hist.number_atoms_total 1223
_refine_hist.number_reflns_all ?
_refine_hist.number_reflns_obs ?
_refine_hist.number_reflns_R_free ?
_refine_hist.number_reflns_R_work ?
_refine_hist.R_factor_all ?
_refine_hist.R_factor_obs ?
_refine_hist.R_factor_R_free ?
_refine_hist.R_factor_R_work ?
_refine_hist.pdbx_number_residues_total ?
_refine_hist.pdbx_B_iso_mean_ligand ?
_refine_hist.pdbx_B_iso_mean_solvent ?
_refine_hist.pdbx_number_atoms_protein 953
_refine_hist.pdbx_number_atoms_nucleic_acid 0
_refine_hist.pdbx_number_atoms_ligand 29
_refine_hist.pdbx_number_atoms_lipid ?
_refine_hist.pdbx_number_atoms_carb ?
_refine_hist.pdbx_pseudo_atom_details ?
#
loop_
_refine_ls_restr.pdbx_refine_id
_refine_ls_restr.criterion
_refine_ls_restr.dev_ideal
_refine_ls_restr.dev_ideal_target
_refine_ls_restr.number
_refine_ls_restr.rejects
_refine_ls_restr.type
_refine_ls_restr.weight
_refine_ls_restr.pdbx_restraint_function
'X-RAY DIFFRACTION' ? 0.013 0.012 1088 ? r_bond_refined_d ? ?
'X-RAY DIFFRACTION' ? 0.001 0.016 962 ? r_bond_other_d ? ?
'X-RAY DIFFRACTION' ? 1.721 1.776 1508 ? r_angle_refined_deg ? ?
'X-RAY DIFFRACTION' ? 0.616 1.749 2244 ? r_angle_other_deg ? ?
'X-RAY DIFFRACTION' ? 6.145 5.000 145 ? r_dihedral_angle_1_deg ? ?
'X-RAY DIFFRACTION' ? 1.385 5.000 2 ? r_dihedral_angle_2_deg ? ?
'X-RAY DIFFRACTION' ? 14.000 10.000 159 ? r_dihedral_angle_3_deg ? ?
'X-RAY DIFFRACTION' ? 17.075 10.000 42 ? r_dihedral_angle_6_deg ? ?
'X-RAY DIFFRACTION' ? 0.097 0.200 179 ? r_chiral_restr ? ?
'X-RAY DIFFRACTION' ? 0.008 0.020 1316 ? r_gen_planes_refined ? ?
'X-RAY DIFFRACTION' ? 0.001 0.020 228 ? r_gen_planes_other ? ?
'X-RAY DIFFRACTION' ? 0.213 0.200 193 ? r_nbd_refined ? ?
'X-RAY DIFFRACTION' ? 0.214 0.200 881 ? r_symmetry_nbd_other ? ?
'X-RAY DIFFRACTION' ? 0.176 0.200 551 ? r_nbtor_refined ? ?
'X-RAY DIFFRACTION' ? 0.091 0.200 544 ? r_symmetry_nbtor_other ? ?
'X-RAY DIFFRACTION' ? 0.193 0.200 144 ? r_xyhbond_nbd_refined ? ?
'X-RAY DIFFRACTION' ? 0.120 0.200 13 ? r_metal_ion_refined ? ?
'X-RAY DIFFRACTION' ? 0.229 0.200 20 ? r_symmetry_nbd_refined ? ?
'X-RAY DIFFRACTION' ? 0.188 0.200 43 ? r_nbd_other ? ?
'X-RAY DIFFRACTION' ? 0.142 0.200 36 ? r_symmetry_xyhbond_nbd_refined ? ?
'X-RAY DIFFRACTION' ? 0.287 0.200 2 ? r_symmetry_metal_ion_refined ? ?
'X-RAY DIFFRACTION' ? 4.445 1.397 558 ? r_mcbond_it ? ?
'X-RAY DIFFRACTION' ? 4.444 1.398 558 ? r_mcbond_other ? ?
'X-RAY DIFFRACTION' ? 5.852 2.511 709 ? r_mcangle_it ? ?
'X-RAY DIFFRACTION' ? 5.852 2.512 710 ? r_mcangle_other ? ?
'X-RAY DIFFRACTION' ? 6.411 1.568 530 ? r_scbond_it ? ?
'X-RAY DIFFRACTION' ? 6.406 1.570 531 ? r_scbond_other ? ?
'X-RAY DIFFRACTION' ? 8.283 2.792 798 ? r_scangle_it ? ?
'X-RAY DIFFRACTION' ? 8.277 2.793 799 ? r_scangle_other ? ?
'X-RAY DIFFRACTION' ? 11.386 19.716 1318 ? r_lrange_it ? ?
'X-RAY DIFFRACTION' ? 10.265 16.713 1243 ? r_lrange_other ? ?
'X-RAY DIFFRACTION' ? 5.716 3.000 2050 ? r_rigid_bond_restr ? ?
#
loop_
_refine_ls_shell.pdbx_refine_id
_refine_ls_shell.d_res_high
_refine_ls_shell.d_res_low
_refine_ls_shell.number_reflns_all
_refine_ls_shell.number_reflns_obs
_refine_ls_shell.number_reflns_R_free
_refine_ls_shell.number_reflns_R_work
_refine_ls_shell.percent_reflns_obs
_refine_ls_shell.percent_reflns_R_free
_refine_ls_shell.R_factor_all
_refine_ls_shell.R_factor_obs
_refine_ls_shell.R_factor_R_free_error
_refine_ls_shell.R_factor_R_work
_refine_ls_shell.redundancy_reflns_all
_refine_ls_shell.redundancy_reflns_obs
_refine_ls_shell.wR_factor_all
_refine_ls_shell.wR_factor_obs
_refine_ls_shell.wR_factor_R_free
_refine_ls_shell.wR_factor_R_work
_refine_ls_shell.pdbx_R_complete
_refine_ls_shell.pdbx_total_number_of_bins_used
_refine_ls_shell.pdbx_phase_error
_refine_ls_shell.pdbx_fsc_work
_refine_ls_shell.pdbx_fsc_free
_refine_ls_shell.R_factor_R_free
'X-RAY DIFFRACTION' 1.317 1.351 2185 . 120 2007 97.3455 . 0.220 . . 0.216 . . . . . 0.216 . 20 . 0.984 0.973 0.297
'X-RAY DIFFRACTION' 1.351 1.388 2105 . 114 1990 99.9525 . 0.162 . . 0.160 . . . . . 0.160 . 20 . 0.991 0.985 0.194
'X-RAY DIFFRACTION' 1.388 1.428 2087 . 123 1964 100.0000 . 0.141 . . 0.138 . . . . . 0.138 . 20 . 0.991 0.981 0.183
'X-RAY DIFFRACTION' 1.428 1.472 2027 . 115 1912 100.0000 . 0.128 . . 0.126 . . . . . 0.126 . 20 . 0.992 0.984 0.177
'X-RAY DIFFRACTION' 1.472 1.520 1939 . 97 1842 100.0000 . 0.102 . . 0.100 . . . . . 0.100 . 20 . 0.994 0.988 0.138
'X-RAY DIFFRACTION' 1.520 1.573 1888 . 85 1803 100.0000 . 0.104 . . 0.102 . . . . . 0.102 . 20 . 0.994 0.988 0.144
'X-RAY DIFFRACTION' 1.573 1.633 1811 . 83 1728 100.0000 . 0.110 . . 0.108 . . . . . 0.108 . 20 . 0.993 0.987 0.149
'X-RAY DIFFRACTION' 1.633 1.699 1751 . 92 1659 100.0000 . 0.118 . . 0.116 . . . . . 0.116 . 20 . 0.992 0.988 0.154
'X-RAY DIFFRACTION' 1.699 1.775 1704 . 77 1627 100.0000 . 0.106 . . 0.103 . . . . . 0.103 . 20 . 0.994 0.980 0.178
'X-RAY DIFFRACTION' 1.775 1.861 1604 . 76 1528 100.0000 . 0.111 . . 0.110 . . . . . 0.110 . 20 . 0.993 0.988 0.135
'X-RAY DIFFRACTION' 1.861 1.962 1540 . 67 1473 100.0000 . 0.123 . . 0.121 . . . . . 0.121 . 20 . 0.993 0.988 0.156
'X-RAY DIFFRACTION' 1.962 2.080 1456 . 65 1391 100.0000 . 0.128 . . 0.127 . . . . . 0.127 . 20 . 0.992 0.988 0.151
'X-RAY DIFFRACTION' 2.080 2.224 1368 . 79 1289 100.0000 . 0.127 . . 0.127 . . . . . 0.127 . 20 . 0.991 0.992 0.127
'X-RAY DIFFRACTION' 2.224 2.401 1267 . 57 1210 100.0000 . 0.136 . . 0.134 . . . . . 0.134 . 20 . 0.989 0.977 0.196
'X-RAY DIFFRACTION' 2.401 2.630 1188 . 68 1120 100.0000 . 0.143 . . 0.141 . . . . . 0.141 . 20 . 0.987 0.984 0.167
'X-RAY DIFFRACTION' 2.630 2.939 1061 . 55 1006 100.0000 . 0.144 . . 0.142 . . . . . 0.142 . 20 . 0.987 0.976 0.199
'X-RAY DIFFRACTION' 2.939 3.392 955 . 38 917 100.0000 . 0.153 . . 0.151 . . . . . 0.151 . 20 . 0.985 0.974 0.195
'X-RAY DIFFRACTION' 3.392 4.148 812 . 43 769 100.0000 . 0.165 . . 0.163 . . . . . 0.163 . 20 . 0.983 0.976 0.192
'X-RAY DIFFRACTION' 4.148 5.844 633 . 30 603 100.0000 . 0.180 . . 0.175 . . . . . 0.175 . 20 . 0.986 0.967 0.284
'X-RAY DIFFRACTION' 5.844 46.778 372 . 19 352 99.7312 . 0.316 . . 0.314 . . . . . 0.314 . 20 . 0.952 0.941 0.372
#
_struct.entry_id 8R8A
_struct.title 'Structure of the N-terminal domain of CMA in complex with N-acetyllactosamine'
_struct.pdbx_model_details ?
_struct.pdbx_formula_weight ?
_struct.pdbx_formula_weight_method ?
_struct.pdbx_model_type_details ?
_struct.pdbx_CASP_flag N
#
_struct_keywords.entry_id 8R8A
_struct_keywords.text 'lectin, beta-trefoil, galactose, N-acetyllactosamine, SUGAR BINDING PROTEIN'
_struct_keywords.pdbx_keywords 'SUGAR BINDING PROTEIN'
#
loop_
_struct_asym.id
_struct_asym.pdbx_blank_PDB_chainid_flag
_struct_asym.pdbx_modified
_struct_asym.entity_id
_struct_asym.details
A N N 1 ?
B N N 2 ?
C N N 3 ?
D N N 3 ?
E N N 3 ?
F N N 4 ?
#
_struct_ref.id 1
_struct_ref.db_name UNP
_struct_ref.db_code A0A1S4E5V9_CUCME
_struct_ref.pdbx_db_accession A0A1S4E5V9
_struct_ref.pdbx_db_isoform ?
_struct_ref.entity_id 1
_struct_ref.pdbx_seq_one_letter_code
;SRSTHLVGQDGLCLDVIGGYSDNHVPTQLWPCGPQNNQLWTIQADGTIRTMGKCLVPNGHDPGSYTMIDDCNKADPNDKT
WKLYPDGTLTHVRSSLVLTSQGTGAYAITTIETNTSAPTQSWGTAD
;
_struct_ref.pdbx_align_begin 34
#
_struct_ref_seq.align_id 1
_struct_ref_seq.ref_id 1
_struct_ref_seq.pdbx_PDB_id_code 8R8A
_struct_ref_seq.pdbx_strand_id A
_struct_ref_seq.seq_align_beg 5
_struct_ref_seq.pdbx_seq_align_beg_ins_code ?
_struct_ref_seq.seq_align_end 130
_struct_ref_seq.pdbx_seq_align_end_ins_code ?
_struct_ref_seq.pdbx_db_accession A0A1S4E5V9
_struct_ref_seq.db_align_beg 34
_struct_ref_seq.pdbx_db_align_beg_ins_code ?
_struct_ref_seq.db_align_end 159
_struct_ref_seq.pdbx_db_align_end_ins_code ?
_struct_ref_seq.pdbx_auth_seq_align_beg 7
_struct_ref_seq.pdbx_auth_seq_align_end 132
#
loop_
_struct_ref_seq_dif.align_id
_struct_ref_seq_dif.pdbx_pdb_id_code
_struct_ref_seq_dif.mon_id
_struct_ref_seq_dif.pdbx_pdb_strand_id
_struct_ref_seq_dif.seq_num
_struct_ref_seq_dif.pdbx_pdb_ins_code
_struct_ref_seq_dif.pdbx_seq_db_name
_struct_ref_seq_dif.pdbx_seq_db_accession_code
_struct_ref_seq_dif.db_mon_id
_struct_ref_seq_dif.pdbx_seq_db_seq_num
_struct_ref_seq_dif.details
_struct_ref_seq_dif.pdbx_auth_seq_num
_struct_ref_seq_dif.pdbx_ordinal
1 8R8A GLY A 1 ? UNP A0A1S4E5V9 ? ? 'expression tag' 3 1
1 8R8A ALA A 2 ? UNP A0A1S4E5V9 ? ? 'expression tag' 4 2
1 8R8A MET A 3 ? UNP A0A1S4E5V9 ? ? 'expression tag' 5 3
1 8R8A VAL A 4 ? UNP A0A1S4E5V9 ? ? 'expression tag' 6 4
#
_pdbx_struct_assembly.id 1
_pdbx_struct_assembly.details author_defined_assembly
_pdbx_struct_assembly.method_details ?
_pdbx_struct_assembly.oligomeric_details monomeric
_pdbx_struct_assembly.oligomeric_count 1
#
loop_
_pdbx_struct_assembly_prop.biol_id
_pdbx_struct_assembly_prop.type
_pdbx_struct_assembly_prop.value
_pdbx_struct_assembly_prop.details
1 'ABSA (A^2)' 860 ?
1 MORE -11 ?
1 'SSA (A^2)' 6280 ?
#
_pdbx_struct_assembly_gen.assembly_id 1
_pdbx_struct_assembly_gen.oper_expression 1
_pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F
#
_pdbx_struct_assembly_auth_evidence.id 1
_pdbx_struct_assembly_auth_evidence.assembly_id 1
_pdbx_struct_assembly_auth_evidence.experimental_support none
_pdbx_struct_assembly_auth_evidence.details ?
#
_pdbx_struct_oper_list.id 1
_pdbx_struct_oper_list.type 'identity operation'
_pdbx_struct_oper_list.name 1_555
_pdbx_struct_oper_list.symmetry_operation x,y,z
_pdbx_struct_oper_list.matrix[1][1] 1.0000000000
_pdbx_struct_oper_list.matrix[1][2] 0.0000000000
_pdbx_struct_oper_list.matrix[1][3] 0.0000000000
_pdbx_struct_oper_list.vector[1] 0.0000000000
_pdbx_struct_oper_list.matrix[2][1] 0.0000000000
_pdbx_struct_oper_list.matrix[2][2] 1.0000000000
_pdbx_struct_oper_list.matrix[2][3] 0.0000000000
_pdbx_struct_oper_list.vector[2] 0.0000000000
_pdbx_struct_oper_list.matrix[3][1] 0.0000000000
_pdbx_struct_oper_list.matrix[3][2] 0.0000000000
_pdbx_struct_oper_list.matrix[3][3] 1.0000000000
_pdbx_struct_oper_list.vector[3] 0.0000000000
#
loop_
_struct_conf.conf_type_id
_struct_conf.id
_struct_conf.pdbx_PDB_helix_id
_struct_conf.beg_label_comp_id
_struct_conf.beg_label_asym_id
_struct_conf.beg_label_seq_id
_struct_conf.pdbx_beg_PDB_ins_code
_struct_conf.end_label_comp_id
_struct_conf.end_label_asym_id
_struct_conf.end_label_seq_id
_struct_conf.pdbx_end_PDB_ins_code
_struct_conf.beg_auth_comp_id
_struct_conf.beg_auth_asym_id
_struct_conf.beg_auth_seq_id
_struct_conf.end_auth_comp_id
_struct_conf.end_auth_asym_id
_struct_conf.end_auth_seq_id
_struct_conf.pdbx_PDB_helix_class
_struct_conf.details
_struct_conf.pdbx_PDB_helix_length
HELX_P HELX_P1 AA1 GLY A 12 ? LEU A 16 ? GLY A 14 LEU A 18 5 ? 5
HELX_P HELX_P2 AA2 GLY A 22 ? TYR A 24 ? GLY A 24 TYR A 26 5 ? 3
HELX_P HELX_P3 AA3 GLN A 39 ? LEU A 43 ? GLN A 41 LEU A 45 5 ? 5
HELX_P HELX_P4 AA4 ASP A 79 ? THR A 84 ? ASP A 81 THR A 86 1 ? 6
HELX_P HELX_P5 AA5 ALA A 121 ? SER A 125 ? ALA A 123 SER A 127 5 ? 5
#
_struct_conf_type.id HELX_P
_struct_conf_type.criteria ?
_struct_conf_type.reference ?
#
loop_
_struct_conn.id
_struct_conn.conn_type_id
_struct_conn.pdbx_leaving_atom_flag
_struct_conn.pdbx_PDB_id
_struct_conn.ptnr1_label_asym_id
_struct_conn.ptnr1_label_comp_id
_struct_conn.ptnr1_label_seq_id
_struct_conn.ptnr1_label_atom_id
_struct_conn.pdbx_ptnr1_label_alt_id
_struct_conn.pdbx_ptnr1_PDB_ins_code
_struct_conn.pdbx_ptnr1_standard_comp_id
_struct_conn.ptnr1_symmetry
_struct_conn.ptnr2_label_asym_id
_struct_conn.ptnr2_label_comp_id
_struct_conn.ptnr2_label_seq_id
_struct_conn.ptnr2_label_atom_id
_struct_conn.pdbx_ptnr2_label_alt_id
_struct_conn.pdbx_ptnr2_PDB_ins_code
_struct_conn.ptnr1_auth_asym_id
_struct_conn.ptnr1_auth_comp_id
_struct_conn.ptnr1_auth_seq_id
_struct_conn.ptnr2_auth_asym_id
_struct_conn.ptnr2_auth_comp_id
_struct_conn.ptnr2_auth_seq_id
_struct_conn.ptnr2_symmetry
_struct_conn.pdbx_ptnr3_label_atom_id
_struct_conn.pdbx_ptnr3_label_seq_id
_struct_conn.pdbx_ptnr3_label_comp_id
_struct_conn.pdbx_ptnr3_label_asym_id
_struct_conn.pdbx_ptnr3_label_alt_id
_struct_conn.pdbx_ptnr3_PDB_ins_code
_struct_conn.details
_struct_conn.pdbx_dist_value
_struct_conn.pdbx_value_order
_struct_conn.pdbx_role
disulf1 disulf ? ? A CYS 17 SG ? ? ? 1_555 A CYS 36 SG ? ? A CYS 19 A CYS 38 1_555 ? ? ? ? ? ? ? 2.069 ? ?
disulf2 disulf ? ? A CYS 58 SG ? ? ? 1_555 A CYS 75 SG ? ? A CYS 60 A CYS 77 1_555 ? ? ? ? ? ? ? 2.041 ? ?
covale1 covale both ? B NDG . O4 ? ? ? 1_555 B GAL . C1 ? ? C NDG 1 C GAL 2 1_555 ? ? ? ? ? ? ? 1.420 ? ?
metalc1 metalc ? ? A HIS 9 NE2 ? ? ? 1_555 C CD . CD ? ? A HIS 11 A CD 201 1_555 ? ? ? ? ? ? ? 2.075 ? ?
metalc2 metalc ? ? A HIS 28 NE2 ? ? ? 1_555 D CD . CD ? ? A HIS 30 A CD 202 1_555 ? ? ? ? ? ? ? 2.077 ? ?
metalc3 metalc ? ? A HIS 64 NE2 ? ? ? 1_555 C CD . CD ? ? A HIS 66 A CD 201 1_655 ? ? ? ? ? ? ? 2.043 ? ?
metalc4 metalc ? ? A ASP 73 OD2 ? ? ? 1_555 D CD . CD ? ? A ASP 75 A CD 202 1_555 ? ? ? ? ? ? ? 2.061 ? ?
metalc5 metalc ? ? A ASN 81 OD1 B ? ? 1_555 E CD . CD ? ? A ASN 83 A CD 203 4_646 ? ? ? ? ? ? ? 1.846 ? ?
metalc6 metalc ? ? A ASP 90 OD1 ? ? ? 1_555 E CD . CD ? ? A ASP 92 A CD 203 1_555 ? ? ? ? ? ? ? 2.698 ? ?
metalc7 metalc ? ? A ASP 90 OD2 ? ? ? 1_555 E CD . CD ? ? A ASP 92 A CD 203 1_555 ? ? ? ? ? ? ? 2.096 ? ?
metalc8 metalc ? ? A THR 92 OG1 ? ? ? 1_555 E CD . CD ? ? A THR 94 A CD 203 1_555 ? ? ? ? ? ? ? 2.320 ? ?
metalc9 metalc ? ? A ASP 130 OXT ? ? ? 1_555 C CD . CD ? ? A ASP 132 A CD 201 1_555 ? ? ? ? ? ? ? 2.079 ? ?
metalc10 metalc ? ? C CD . CD ? ? ? 1_555 F HOH . O ? ? A CD 201 A HOH 310 1_555 ? ? ? ? ? ? ? 2.120 ? ?
metalc11 metalc ? ? C CD . CD ? ? ? 1_555 F HOH . O ? ? A CD 201 A HOH 415 1_555 ? ? ? ? ? ? ? 2.152 ? ?
metalc12 metalc ? ? C CD . CD ? ? ? 1_555 F HOH . O ? ? A CD 201 A HOH 434 1_555 ? ? ? ? ? ? ? 2.033 ? ?
metalc13 metalc ? ? D CD . CD ? ? ? 1_555 F HOH . O ? ? A CD 202 A HOH 362 1_555 ? ? ? ? ? ? ? 2.182 ? ?
metalc14 metalc ? ? D CD . CD ? ? ? 1_555 F HOH . O ? ? A CD 202 A HOH 430 1_555 ? ? ? ? ? ? ? 2.065 ? ?
metalc15 metalc ? ? D CD . CD ? ? ? 1_555 F HOH . O ? ? A CD 202 A HOH 438 1_555 ? ? ? ? ? ? ? 2.114 ? ?
metalc16 metalc ? ? D CD . CD ? ? ? 1_555 F HOH . O ? ? A CD 202 A HOH 445 1_555 ? ? ? ? ? ? ? 2.135 ? ?
metalc17 metalc ? ? E CD . CD ? ? ? 1_555 F HOH . O ? ? A CD 203 A HOH 349 1_555 ? ? ? ? ? ? ? 2.399 ? ?
metalc18 metalc ? ? E CD . CD ? ? ? 1_555 F HOH . O ? ? A CD 203 A HOH 454 1_555 ? ? ? ? ? ? ? 2.601 ? ?
metalc19 metalc ? ? E CD . CD ? ? ? 1_555 F HOH . O A ? A CD 203 A HOH 472 1_555 ? ? ? ? ? ? ? 2.051 ? ?
metalc20 metalc ? ? E CD . CD ? ? ? 1_555 F HOH . O B ? A CD 203 A HOH 472 1_555 ? ? ? ? ? ? ? 2.348 ? ?
#
loop_
_struct_conn_type.id
_struct_conn_type.criteria
_struct_conn_type.reference
disulf ? ?
covale ? ?
metalc ? ?
#
loop_
_pdbx_struct_conn_angle.id
_pdbx_struct_conn_angle.ptnr1_label_atom_id
_pdbx_struct_conn_angle.ptnr1_label_alt_id
_pdbx_struct_conn_angle.ptnr1_label_asym_id
_pdbx_struct_conn_angle.ptnr1_label_comp_id
_pdbx_struct_conn_angle.ptnr1_label_seq_id
_pdbx_struct_conn_angle.ptnr1_auth_atom_id
_pdbx_struct_conn_angle.ptnr1_auth_asym_id
_pdbx_struct_conn_angle.ptnr1_auth_comp_id
_pdbx_struct_conn_angle.ptnr1_auth_seq_id
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code
_pdbx_struct_conn_angle.ptnr1_symmetry
_pdbx_struct_conn_angle.ptnr2_label_atom_id
_pdbx_struct_conn_angle.ptnr2_label_alt_id
_pdbx_struct_conn_angle.ptnr2_label_asym_id
_pdbx_struct_conn_angle.ptnr2_label_comp_id
_pdbx_struct_conn_angle.ptnr2_label_seq_id
_pdbx_struct_conn_angle.ptnr2_auth_atom_id
_pdbx_struct_conn_angle.ptnr2_auth_asym_id
_pdbx_struct_conn_angle.ptnr2_auth_comp_id
_pdbx_struct_conn_angle.ptnr2_auth_seq_id
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code
_pdbx_struct_conn_angle.ptnr2_symmetry
_pdbx_struct_conn_angle.ptnr3_label_atom_id
_pdbx_struct_conn_angle.ptnr3_label_alt_id
_pdbx_struct_conn_angle.ptnr3_label_asym_id
_pdbx_struct_conn_angle.ptnr3_label_comp_id
_pdbx_struct_conn_angle.ptnr3_label_seq_id
_pdbx_struct_conn_angle.ptnr3_auth_atom_id
_pdbx_struct_conn_angle.ptnr3_auth_asym_id
_pdbx_struct_conn_angle.ptnr3_auth_comp_id
_pdbx_struct_conn_angle.ptnr3_auth_seq_id
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code
_pdbx_struct_conn_angle.ptnr3_symmetry
_pdbx_struct_conn_angle.value
_pdbx_struct_conn_angle.value_esd
1 NE2 ? A HIS 9 ? A HIS 11 ? 1_555 CD ? C CD . ? A CD 201 ? 1_555 NE2 ? A HIS 64 ? A HIS 66 ? 1_555 14.3 ?
2 NE2 ? A HIS 9 ? A HIS 11 ? 1_555 CD ? C CD . ? A CD 201 ? 1_555 OXT ? A ASP 130 ? A ASP 132 ? 1_555 90.3 ?
3 NE2 ? A HIS 64 ? A HIS 66 ? 1_555 CD ? C CD . ? A CD 201 ? 1_555 OXT ? A ASP 130 ? A ASP 132 ? 1_555 83.4 ?
4 NE2 ? A HIS 9 ? A HIS 11 ? 1_555 CD ? C CD . ? A CD 201 ? 1_555 O ? F HOH . ? A HOH 310 ? 1_555 87.6 ?
5 NE2 ? A HIS 64 ? A HIS 66 ? 1_555 CD ? C CD . ? A CD 201 ? 1_555 O ? F HOH . ? A HOH 310 ? 1_555 100.3 ?
6 OXT ? A ASP 130 ? A ASP 132 ? 1_555 CD ? C CD . ? A CD 201 ? 1_555 O ? F HOH . ? A HOH 310 ? 1_555 91.9 ?
7 NE2 ? A HIS 9 ? A HIS 11 ? 1_555 CD ? C CD . ? A CD 201 ? 1_555 O ? F HOH . ? A HOH 415 ? 1_555 90.0 ?
8 NE2 ? A HIS 64 ? A HIS 66 ? 1_555 CD ? C CD . ? A CD 201 ? 1_555 O ? F HOH . ? A HOH 415 ? 1_555 77.1 ?
9 OXT ? A ASP 130 ? A ASP 132 ? 1_555 CD ? C CD . ? A CD 201 ? 1_555 O ? F HOH . ? A HOH 415 ? 1_555 86.7 ?
10 O ? F HOH . ? A HOH 310 ? 1_555 CD ? C CD . ? A CD 201 ? 1_555 O ? F HOH . ? A HOH 415 ? 1_555 177.2 ?
11 NE2 ? A HIS 9 ? A HIS 11 ? 1_555 CD ? C CD . ? A CD 201 ? 1_555 O ? F HOH . ? A HOH 434 ? 1_555 92.7 ?
12 NE2 ? A HIS 64 ? A HIS 66 ? 1_555 CD ? C CD . ? A CD 201 ? 1_555 O ? F HOH . ? A HOH 434 ? 1_555 99.1 ?
13 OXT ? A ASP 130 ? A ASP 132 ? 1_555 CD ? C CD . ? A CD 201 ? 1_555 O ? F HOH . ? A HOH 434 ? 1_555 176.2 ?
14 O ? F HOH . ? A HOH 310 ? 1_555 CD ? C CD . ? A CD 201 ? 1_555 O ? F HOH . ? A HOH 434 ? 1_555 90.5 ?
15 O ? F HOH . ? A HOH 415 ? 1_555 CD ? C CD . ? A CD 201 ? 1_555 O ? F HOH . ? A HOH 434 ? 1_555 91.0 ?
16 NE2 ? A HIS 28 ? A HIS 30 ? 1_555 CD ? D CD . ? A CD 202 ? 1_555 OD2 ? A ASP 73 ? A ASP 75 ? 1_555 92.1 ?
17 NE2 ? A HIS 28 ? A HIS 30 ? 1_555 CD ? D CD . ? A CD 202 ? 1_555 O ? F HOH . ? A HOH 362 ? 1_555 94.1 ?
18 OD2 ? A ASP 73 ? A ASP 75 ? 1_555 CD ? D CD . ? A CD 202 ? 1_555 O ? F HOH . ? A HOH 362 ? 1_555 92.9 ?
19 NE2 ? A HIS 28 ? A HIS 30 ? 1_555 CD ? D CD . ? A CD 202 ? 1_555 O ? F HOH . ? A HOH 430 ? 1_555 174.9 ?
20 OD2 ? A ASP 73 ? A ASP 75 ? 1_555 CD ? D CD . ? A CD 202 ? 1_555 O ? F HOH . ? A HOH 430 ? 1_555 91.8 ?
21 O ? F HOH . ? A HOH 362 ? 1_555 CD ? D CD . ? A CD 202 ? 1_555 O ? F HOH . ? A HOH 430 ? 1_555 88.9 ?
22 NE2 ? A HIS 28 ? A HIS 30 ? 1_555 CD ? D CD . ? A CD 202 ? 1_555 O ? F HOH . ? A HOH 438 ? 1_555 92.7 ?
23 OD2 ? A ASP 73 ? A ASP 75 ? 1_555 CD ? D CD . ? A CD 202 ? 1_555 O ? F HOH . ? A HOH 438 ? 1_555 91.3 ?
24 O ? F HOH . ? A HOH 362 ? 1_555 CD ? D CD . ? A CD 202 ? 1_555 O ? F HOH . ? A HOH 438 ? 1_555 171.9 ?
25 O ? F HOH . ? A HOH 430 ? 1_555 CD ? D CD . ? A CD 202 ? 1_555 O ? F HOH . ? A HOH 438 ? 1_555 84.0 ?
26 NE2 ? A HIS 28 ? A HIS 30 ? 1_555 CD ? D CD . ? A CD 202 ? 1_555 O ? F HOH . ? A HOH 445 ? 1_555 92.1 ?
27 OD2 ? A ASP 73 ? A ASP 75 ? 1_555 CD ? D CD . ? A CD 202 ? 1_555 O ? F HOH . ? A HOH 445 ? 1_555 175.7 ?
28 O ? F HOH . ? A HOH 362 ? 1_555 CD ? D CD . ? A CD 202 ? 1_555 O ? F HOH . ? A HOH 445 ? 1_555 86.2 ?
29 O ? F HOH . ? A HOH 430 ? 1_555 CD ? D CD . ? A CD 202 ? 1_555 O ? F HOH . ? A HOH 445 ? 1_555 83.9 ?
30 O ? F HOH . ? A HOH 438 ? 1_555 CD ? D CD . ? A CD 202 ? 1_555 O ? F HOH . ? A HOH 445 ? 1_555 89.1 ?
31 OD1 B A ASN 81 ? A ASN 83 ? 1_555 CD ? E CD . ? A CD 203 ? 4_646 OD1 ? A ASP 90 ? A ASP 92 ? 1_555 52.8 ?
32 OD1 B A ASN 81 ? A ASN 83 ? 1_555 CD ? E CD . ? A CD 203 ? 4_646 OD2 ? A ASP 90 ? A ASP 92 ? 1_555 53.5 ?
33 OD1 ? A ASP 90 ? A ASP 92 ? 1_555 CD ? E CD . ? A CD 203 ? 4_646 OD2 ? A ASP 90 ? A ASP 92 ? 1_555 4.1 ?
34 OD1 B A ASN 81 ? A ASN 83 ? 1_555 CD ? E CD . ? A CD 203 ? 4_646 OG1 ? A THR 92 ? A THR 94 ? 1_555 47.3 ?
35 OD1 ? A ASP 90 ? A ASP 92 ? 1_555 CD ? E CD . ? A CD 203 ? 4_646 OG1 ? A THR 92 ? A THR 94 ? 1_555 7.1 ?
36 OD2 ? A ASP 90 ? A ASP 92 ? 1_555 CD ? E CD . ? A CD 203 ? 4_646 OG1 ? A THR 92 ? A THR 94 ? 1_555 6.2 ?
37 OD1 B A ASN 81 ? A ASN 83 ? 1_555 CD ? E CD . ? A CD 203 ? 4_646 O ? F HOH . ? A HOH 349 ? 1_555 48.1 ?
38 OD1 ? A ASP 90 ? A ASP 92 ? 1_555 CD ? E CD . ? A CD 203 ? 4_646 O ? F HOH . ? A HOH 349 ? 1_555 9.6 ?
39 OD2 ? A ASP 90 ? A ASP 92 ? 1_555 CD ? E CD . ? A CD 203 ? 4_646 O ? F HOH . ? A HOH 349 ? 1_555 7.0 ?
40 OG1 ? A THR 92 ? A THR 94 ? 1_555 CD ? E CD . ? A CD 203 ? 4_646 O ? F HOH . ? A HOH 349 ? 1_555 3.8 ?
41 OD1 B A ASN 81 ? A ASN 83 ? 1_555 CD ? E CD . ? A CD 203 ? 4_646 O ? F HOH . ? A HOH 454 ? 1_555 57.5 ?
42 OD1 ? A ASP 90 ? A ASP 92 ? 1_555 CD ? E CD . ? A CD 203 ? 4_646 O ? F HOH . ? A HOH 454 ? 1_555 7.1 ?
43 OD2 ? A ASP 90 ? A ASP 92 ? 1_555 CD ? E CD . ? A CD 203 ? 4_646 O ? F HOH . ? A HOH 454 ? 1_555 4.2 ?
44 OG1 ? A THR 92 ? A THR 94 ? 1_555 CD ? E CD . ? A CD 203 ? 4_646 O ? F HOH . ? A HOH 454 ? 1_555 10.2 ?
45 O ? F HOH . ? A HOH 349 ? 1_555 CD ? E CD . ? A CD 203 ? 4_646 O ? F HOH . ? A HOH 454 ? 1_555 10.0 ?
46 OD1 B A ASN 81 ? A ASN 83 ? 1_555 CD ? E CD . ? A CD 203 ? 4_646 O A F HOH . ? A HOH 472 ? 1_555 53.4 ?
47 OD1 ? A ASP 90 ? A ASP 92 ? 1_555 CD ? E CD . ? A CD 203 ? 4_646 O A F HOH . ? A HOH 472 ? 1_555 12.0 ?
48 OD2 ? A ASP 90 ? A ASP 92 ? 1_555 CD ? E CD . ? A CD 203 ? 4_646 O A F HOH . ? A HOH 472 ? 1_555 8.1 ?
49 OG1 ? A THR 92 ? A THR 94 ? 1_555 CD ? E CD . ? A CD 203 ? 4_646 O A F HOH . ? A HOH 472 ? 1_555 9.3 ?
50 O ? F HOH . ? A HOH 349 ? 1_555 CD ? E CD . ? A CD 203 ? 4_646 O A F HOH . ? A HOH 472 ? 1_555 6.2 ?
51 O ? F HOH . ? A HOH 454 ? 1_555 CD ? E CD . ? A CD 203 ? 4_646 O A F HOH . ? A HOH 472 ? 1_555 8.1 ?
52 OD1 B A ASN 81 ? A ASN 83 ? 1_555 CD ? E CD . ? A CD 203 ? 4_646 O B F HOH . ? A HOH 472 ? 1_555 51.7 ?
53 OD1 ? A ASP 90 ? A ASP 92 ? 1_555 CD ? E CD . ? A CD 203 ? 4_646 O B F HOH . ? A HOH 472 ? 1_555 12.7 ?
54 OD2 ? A ASP 90 ? A ASP 92 ? 1_555 CD ? E CD . ? A CD 203 ? 4_646 O B F HOH . ? A HOH 472 ? 1_555 8.9 ?
55 OG1 ? A THR 92 ? A THR 94 ? 1_555 CD ? E CD . ? A CD 203 ? 4_646 O B F HOH . ? A HOH 472 ? 1_555 8.9 ?
56 O ? F HOH . ? A HOH 349 ? 1_555 CD ? E CD . ? A CD 203 ? 4_646 O B F HOH . ? A HOH 472 ? 1_555 5.3 ?
57 O ? F HOH . ? A HOH 454 ? 1_555 CD ? E CD . ? A CD 203 ? 4_646 O B F HOH . ? A HOH 472 ? 1_555 9.6 ?
58 O A F HOH . ? A HOH 472 ? 1_555 CD ? E CD . ? A CD 203 ? 4_646 O B F HOH . ? A HOH 472 ? 1_555 1.8 ?
#
loop_
_pdbx_modification_feature.ordinal
_pdbx_modification_feature.label_comp_id
_pdbx_modification_feature.label_asym_id
_pdbx_modification_feature.label_seq_id
_pdbx_modification_feature.label_alt_id
_pdbx_modification_feature.modified_residue_label_comp_id
_pdbx_modification_feature.modified_residue_label_asym_id
_pdbx_modification_feature.modified_residue_label_seq_id
_pdbx_modification_feature.modified_residue_label_alt_id
_pdbx_modification_feature.auth_comp_id
_pdbx_modification_feature.auth_asym_id
_pdbx_modification_feature.auth_seq_id
_pdbx_modification_feature.PDB_ins_code
_pdbx_modification_feature.symmetry
_pdbx_modification_feature.modified_residue_auth_comp_id
_pdbx_modification_feature.modified_residue_auth_asym_id
_pdbx_modification_feature.modified_residue_auth_seq_id
_pdbx_modification_feature.modified_residue_PDB_ins_code
_pdbx_modification_feature.modified_residue_symmetry
_pdbx_modification_feature.comp_id_linking_atom
_pdbx_modification_feature.modified_residue_id_linking_atom
_pdbx_modification_feature.modified_residue_id
_pdbx_modification_feature.ref_pcm_id
_pdbx_modification_feature.ref_comp_id
_pdbx_modification_feature.type
_pdbx_modification_feature.category
1 CYS A 17 ? CYS A 36 ? CYS A 19 ? 1_555 CYS A 38 ? 1_555 SG SG . . . None 'Disulfide bridge'
2 CYS A 58 ? CYS A 75 ? CYS A 60 ? 1_555 CYS A 77 ? 1_555 SG SG . . . None 'Disulfide bridge'
#
loop_
_struct_sheet.id
_struct_sheet.type
_struct_sheet.number_strands
_struct_sheet.details
AA1 ? 8 ?
AA2 ? 2 ?
AA3 ? 2 ?
#
loop_
_struct_sheet_order.sheet_id
_struct_sheet_order.range_id_1
_struct_sheet_order.range_id_2
_struct_sheet_order.offset
_struct_sheet_order.sense
AA1 1 2 ? anti-parallel
AA1 2 3 ? anti-parallel
AA1 3 4 ? anti-parallel
AA1 4 5 ? anti-parallel
AA1 5 6 ? anti-parallel
AA1 6 7 ? anti-parallel
AA1 7 8 ? anti-parallel
AA2 1 2 ? anti-parallel
AA3 1 2 ? anti-parallel
#
loop_
_struct_sheet_range.sheet_id
_struct_sheet_range.id
_struct_sheet_range.beg_label_comp_id
_struct_sheet_range.beg_label_asym_id
_struct_sheet_range.beg_label_seq_id
_struct_sheet_range.pdbx_beg_PDB_ins_code
_struct_sheet_range.end_label_comp_id
_struct_sheet_range.end_label_asym_id
_struct_sheet_range.end_label_seq_id
_struct_sheet_range.pdbx_end_PDB_ins_code
_struct_sheet_range.beg_auth_comp_id
_struct_sheet_range.beg_auth_asym_id
_struct_sheet_range.beg_auth_seq_id
_struct_sheet_range.end_auth_comp_id
_struct_sheet_range.end_auth_asym_id
_struct_sheet_range.end_auth_seq_id
AA1 1 VAL A 101 ? THR A 103 ? VAL A 103 THR A 105
AA1 2 THR A 114 ? GLU A 116 ? THR A 116 GLU A 118
AA1 3 SER A 68 ? ASP A 73 ? SER A 70 ASP A 75
AA1 4 LYS A 57 ? PRO A 61 ? LYS A 59 PRO A 63
AA1 5 ILE A 52 ? THR A 54 ? ILE A 54 THR A 56
AA1 6 TRP A 44 ? ILE A 46 ? TRP A 46 ILE A 48
AA1 7 ARG A 6 ? VAL A 11 ? ARG A 8 VAL A 13
AA1 8 GLY A 127 ? ALA A 129 ? GLY A 129 ALA A 131
AA2 1 CYS A 17 ? VAL A 20 ? CYS A 19 VAL A 22
AA2 2 THR A 31 ? TRP A 34 ? THR A 33 TRP A 36
AA3 1 TRP A 85 ? LEU A 87 ? TRP A 87 LEU A 89
AA3 2 LEU A 93 ? HIS A 95 ? LEU A 95 HIS A 97
#
loop_
_pdbx_struct_sheet_hbond.sheet_id
_pdbx_struct_sheet_hbond.range_id_1
_pdbx_struct_sheet_hbond.range_id_2
_pdbx_struct_sheet_hbond.range_1_label_atom_id
_pdbx_struct_sheet_hbond.range_1_label_comp_id
_pdbx_struct_sheet_hbond.range_1_label_asym_id
_pdbx_struct_sheet_hbond.range_1_label_seq_id
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code
_pdbx_struct_sheet_hbond.range_1_auth_atom_id
_pdbx_struct_sheet_hbond.range_1_auth_comp_id
_pdbx_struct_sheet_hbond.range_1_auth_asym_id
_pdbx_struct_sheet_hbond.range_1_auth_seq_id
_pdbx_struct_sheet_hbond.range_2_label_atom_id
_pdbx_struct_sheet_hbond.range_2_label_comp_id
_pdbx_struct_sheet_hbond.range_2_label_asym_id
_pdbx_struct_sheet_hbond.range_2_label_seq_id
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code
_pdbx_struct_sheet_hbond.range_2_auth_atom_id
_pdbx_struct_sheet_hbond.range_2_auth_comp_id
_pdbx_struct_sheet_hbond.range_2_auth_asym_id
_pdbx_struct_sheet_hbond.range_2_auth_seq_id
AA1 1 2 N THR A 103 ? N THR A 105 O THR A 114 ? O THR A 116
AA1 2 3 O ILE A 115 ? O ILE A 117 N SER A 68 ? N SER A 70
AA1 3 4 O ASP A 73 ? O ASP A 75 N CYS A 58 ? N CYS A 60
AA1 4 5 O LEU A 59 ? O LEU A 61 N ILE A 52 ? N ILE A 54
AA1 5 6 O ARG A 53 ? O ARG A 55 N THR A 45 ? N THR A 47
AA1 6 7 O TRP A 44 ? O TRP A 46 N THR A 8 ? N THR A 10
AA1 7 8 N VAL A 11 ? N VAL A 13 O GLY A 127 ? O GLY A 129
AA2 1 2 N CYS A 17 ? N CYS A 19 O TRP A 34 ? O TRP A 36
AA3 1 2 N LYS A 86 ? N LYS A 88 O THR A 94 ? O THR A 96
#
_pdbx_entry_details.entry_id 8R8A
_pdbx_entry_details.has_ligand_of_interest Y
_pdbx_entry_details.compound_details ?
_pdbx_entry_details.source_details ?
_pdbx_entry_details.nonpolymer_details ?
_pdbx_entry_details.sequence_details ?
_pdbx_entry_details.has_protein_modification Y
#
loop_
_pdbx_validate_torsion.id
_pdbx_validate_torsion.PDB_model_num
_pdbx_validate_torsion.auth_comp_id
_pdbx_validate_torsion.auth_asym_id
_pdbx_validate_torsion.auth_seq_id
_pdbx_validate_torsion.PDB_ins_code
_pdbx_validate_torsion.label_alt_id
_pdbx_validate_torsion.phi
_pdbx_validate_torsion.psi
1 1 HIS A 30 ? ? 81.17 15.29
2 1 TYR A 112 ? ? 70.75 30.02
#
_pdbx_molecule_features.prd_id PRD_900019
_pdbx_molecule_features.name N-acetyl-alpha-lactosamine
_pdbx_molecule_features.type Oligosaccharide
_pdbx_molecule_features.class 'Glycan component'
_pdbx_molecule_features.details oligosaccharide
#
_pdbx_molecule.instance_id 1
_pdbx_molecule.prd_id PRD_900019
_pdbx_molecule.asym_id B
#
_pdbx_struct_special_symmetry.id 1
_pdbx_struct_special_symmetry.PDB_model_num 1
_pdbx_struct_special_symmetry.auth_asym_id A
_pdbx_struct_special_symmetry.auth_comp_id HOH
_pdbx_struct_special_symmetry.auth_seq_id 524
_pdbx_struct_special_symmetry.PDB_ins_code ?
_pdbx_struct_special_symmetry.label_asym_id F
_pdbx_struct_special_symmetry.label_comp_id HOH
_pdbx_struct_special_symmetry.label_seq_id .
#
loop_
_pdbx_distant_solvent_atoms.id
_pdbx_distant_solvent_atoms.PDB_model_num
_pdbx_distant_solvent_atoms.auth_atom_id
_pdbx_distant_solvent_atoms.label_alt_id
_pdbx_distant_solvent_atoms.auth_asym_id
_pdbx_distant_solvent_atoms.auth_comp_id
_pdbx_distant_solvent_atoms.auth_seq_id
_pdbx_distant_solvent_atoms.PDB_ins_code
_pdbx_distant_solvent_atoms.neighbor_macromolecule_distance
_pdbx_distant_solvent_atoms.neighbor_ligand_distance
1 1 O A A HOH 536 ? 6.05 .
2 1 O ? A HOH 537 ? 6.31 .
#
loop_
_pdbx_unobs_or_zero_occ_residues.id
_pdbx_unobs_or_zero_occ_residues.PDB_model_num
_pdbx_unobs_or_zero_occ_residues.polymer_flag
_pdbx_unobs_or_zero_occ_residues.occupancy_flag
_pdbx_unobs_or_zero_occ_residues.auth_asym_id
_pdbx_unobs_or_zero_occ_residues.auth_comp_id
_pdbx_unobs_or_zero_occ_residues.auth_seq_id
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code
_pdbx_unobs_or_zero_occ_residues.label_asym_id
_pdbx_unobs_or_zero_occ_residues.label_comp_id
_pdbx_unobs_or_zero_occ_residues.label_seq_id
1 1 Y 1 A GLY 3 ? A GLY 1
2 1 Y 1 A ALA 4 ? A ALA 2
3 1 Y 1 A MET 5 ? A MET 3
#
loop_
_chem_comp_atom.comp_id
_chem_comp_atom.atom_id
_chem_comp_atom.type_symbol
_chem_comp_atom.pdbx_aromatic_flag
_chem_comp_atom.pdbx_stereo_config
_chem_comp_atom.pdbx_ordinal
ALA N N N N 1
ALA CA C N S 2
ALA C C N N 3
ALA O O N N 4
ALA CB C N N 5
ALA OXT O N N 6
ALA H H N N 7
ALA H2 H N N 8
ALA HA H N N 9
ALA HB1 H N N 10
ALA HB2 H N N 11
ALA HB3 H N N 12
ALA HXT H N N 13
ARG N N N N 14
ARG CA C N S 15
ARG C C N N 16
ARG O O N N 17
ARG CB C N N 18
ARG CG C N N 19
ARG CD C N N 20
ARG NE N N N 21
ARG CZ C N N 22
ARG NH1 N N N 23
ARG NH2 N N N 24
ARG OXT O N N 25
ARG H H N N 26
ARG H2 H N N 27
ARG HA H N N 28
ARG HB2 H N N 29
ARG HB3 H N N 30
ARG HG2 H N N 31
ARG HG3 H N N 32
ARG HD2 H N N 33
ARG HD3 H N N 34
ARG HE H N N 35
ARG HH11 H N N 36
ARG HH12 H N N 37
ARG HH21 H N N 38
ARG HH22 H N N 39
ARG HXT H N N 40
ASN N N N N 41
ASN CA C N S 42
ASN C C N N 43
ASN O O N N 44
ASN CB C N N 45
ASN CG C N N 46
ASN OD1 O N N 47
ASN ND2 N N N 48
ASN OXT O N N 49
ASN H H N N 50
ASN H2 H N N 51
ASN HA H N N 52
ASN HB2 H N N 53
ASN HB3 H N N 54
ASN HD21 H N N 55
ASN HD22 H N N 56
ASN HXT H N N 57
ASP N N N N 58
ASP CA C N S 59
ASP C C N N 60
ASP O O N N 61
ASP CB C N N 62
ASP CG C N N 63
ASP OD1 O N N 64
ASP OD2 O N N 65
ASP OXT O N N 66
ASP H H N N 67
ASP H2 H N N 68
ASP HA H N N 69
ASP HB2 H N N 70
ASP HB3 H N N 71
ASP HD2 H N N 72
ASP HXT H N N 73
CD CD CD N N 74
CYS N N N N 75
CYS CA C N R 76
CYS C C N N 77
CYS O O N N 78
CYS CB C N N 79
CYS SG S N N 80
CYS OXT O N N 81
CYS H H N N 82
CYS H2 H N N 83
CYS HA H N N 84
CYS HB2 H N N 85
CYS HB3 H N N 86
CYS HG H N N 87
CYS HXT H N N 88
GAL C1 C N R 89
GAL C2 C N R 90
GAL C3 C N S 91
GAL C4 C N R 92
GAL C5 C N R 93
GAL C6 C N N 94
GAL O1 O N N 95
GAL O2 O N N 96
GAL O3 O N N 97
GAL O4 O N N 98
GAL O5 O N N 99
GAL O6 O N N 100
GAL H1 H N N 101
GAL H2 H N N 102
GAL H3 H N N 103
GAL H4 H N N 104
GAL H5 H N N 105
GAL H61 H N N 106
GAL H62 H N N 107
GAL HO1 H N N 108
GAL HO2 H N N 109
GAL HO3 H N N 110
GAL HO4 H N N 111
GAL HO6 H N N 112
GLN N N N N 113
GLN CA C N S 114
GLN C C N N 115
GLN O O N N 116
GLN CB C N N 117
GLN CG C N N 118
GLN CD C N N 119
GLN OE1 O N N 120
GLN NE2 N N N 121
GLN OXT O N N 122
GLN H H N N 123
GLN H2 H N N 124
GLN HA H N N 125
GLN HB2 H N N 126
GLN HB3 H N N 127
GLN HG2 H N N 128
GLN HG3 H N N 129
GLN HE21 H N N 130
GLN HE22 H N N 131
GLN HXT H N N 132
GLU N N N N 133
GLU CA C N S 134
GLU C C N N 135
GLU O O N N 136
GLU CB C N N 137
GLU CG C N N 138
GLU CD C N N 139
GLU OE1 O N N 140
GLU OE2 O N N 141
GLU OXT O N N 142
GLU H H N N 143
GLU H2 H N N 144
GLU HA H N N 145
GLU HB2 H N N 146
GLU HB3 H N N 147
GLU HG2 H N N 148
GLU HG3 H N N 149
GLU HE2 H N N 150
GLU HXT H N N 151
GLY N N N N 152
GLY CA C N N 153
GLY C C N N 154
GLY O O N N 155
GLY OXT O N N 156
GLY H H N N 157
GLY H2 H N N 158
GLY HA2 H N N 159
GLY HA3 H N N 160
GLY HXT H N N 161
HIS N N N N 162
HIS CA C N S 163
HIS C C N N 164
HIS O O N N 165
HIS CB C N N 166
HIS CG C Y N 167
HIS ND1 N Y N 168
HIS CD2 C Y N 169
HIS CE1 C Y N 170
HIS NE2 N Y N 171
HIS OXT O N N 172
HIS H H N N 173
HIS H2 H N N 174
HIS HA H N N 175
HIS HB2 H N N 176
HIS HB3 H N N 177
HIS HD1 H N N 178
HIS HD2 H N N 179
HIS HE1 H N N 180
HIS HE2 H N N 181
HIS HXT H N N 182
HOH O O N N 183
HOH H1 H N N 184
HOH H2 H N N 185
ILE N N N N 186
ILE CA C N S 187
ILE C C N N 188
ILE O O N N 189
ILE CB C N S 190
ILE CG1 C N N 191
ILE CG2 C N N 192
ILE CD1 C N N 193
ILE OXT O N N 194
ILE H H N N 195
ILE H2 H N N 196
ILE HA H N N 197
ILE HB H N N 198
ILE HG12 H N N 199
ILE HG13 H N N 200
ILE HG21 H N N 201
ILE HG22 H N N 202
ILE HG23 H N N 203
ILE HD11 H N N 204
ILE HD12 H N N 205
ILE HD13 H N N 206
ILE HXT H N N 207
LEU N N N N 208
LEU CA C N S 209
LEU C C N N 210
LEU O O N N 211
LEU CB C N N 212
LEU CG C N N 213
LEU CD1 C N N 214
LEU CD2 C N N 215
LEU OXT O N N 216
LEU H H N N 217
LEU H2 H N N 218
LEU HA H N N 219
LEU HB2 H N N 220
LEU HB3 H N N 221
LEU HG H N N 222
LEU HD11 H N N 223
LEU HD12 H N N 224
LEU HD13 H N N 225
LEU HD21 H N N 226
LEU HD22 H N N 227
LEU HD23 H N N 228
LEU HXT H N N 229
LYS N N N N 230
LYS CA C N S 231
LYS C C N N 232
LYS O O N N 233
LYS CB C N N 234
LYS CG C N N 235
LYS CD C N N 236
LYS CE C N N 237
LYS NZ N N N 238
LYS OXT O N N 239
LYS H H N N 240
LYS H2 H N N 241
LYS HA H N N 242
LYS HB2 H N N 243
LYS HB3 H N N 244
LYS HG2 H N N 245
LYS HG3 H N N 246
LYS HD2 H N N 247
LYS HD3 H N N 248
LYS HE2 H N N 249
LYS HE3 H N N 250
LYS HZ1 H N N 251
LYS HZ2 H N N 252
LYS HZ3 H N N 253
LYS HXT H N N 254
MET N N N N 255
MET CA C N S 256
MET C C N N 257
MET O O N N 258
MET CB C N N 259
MET CG C N N 260
MET SD S N N 261
MET CE C N N 262
MET OXT O N N 263
MET H H N N 264
MET H2 H N N 265
MET HA H N N 266
MET HB2 H N N 267
MET HB3 H N N 268
MET HG2 H N N 269
MET HG3 H N N 270
MET HE1 H N N 271
MET HE2 H N N 272
MET HE3 H N N 273
MET HXT H N N 274
NDG C1 C N S 275
NDG C2 C N R 276
NDG C3 C N R 277
NDG C4 C N S 278
NDG C5 C N R 279
NDG C6 C N N 280
NDG C7 C N N 281
NDG C8 C N N 282
NDG O5 O N N 283
NDG O3 O N N 284
NDG O4 O N N 285
NDG O6 O N N 286
NDG O7 O N N 287
NDG N2 N N N 288
NDG O1 O N N 289
NDG H1 H N N 290
NDG H2 H N N 291
NDG H3 H N N 292
NDG H4 H N N 293
NDG H5 H N N 294
NDG H61 H N N 295
NDG H62 H N N 296
NDG H81 H N N 297
NDG H82 H N N 298
NDG H83 H N N 299
NDG HO3 H N N 300
NDG HO4 H N N 301
NDG HO6 H N N 302
NDG HN2 H N N 303
NDG HO1 H N N 304
PRO N N N N 305
PRO CA C N S 306
PRO C C N N 307
PRO O O N N 308
PRO CB C N N 309
PRO CG C N N 310
PRO CD C N N 311
PRO OXT O N N 312
PRO H H N N 313
PRO HA H N N 314
PRO HB2 H N N 315
PRO HB3 H N N 316
PRO HG2 H N N 317
PRO HG3 H N N 318
PRO HD2 H N N 319
PRO HD3 H N N 320
PRO HXT H N N 321
SER N N N N 322
SER CA C N S 323
SER C C N N 324
SER O O N N 325
SER CB C N N 326
SER OG O N N 327
SER OXT O N N 328
SER H H N N 329
SER H2 H N N 330
SER HA H N N 331
SER HB2 H N N 332
SER HB3 H N N 333
SER HG H N N 334
SER HXT H N N 335
THR N N N N 336
THR CA C N S 337
THR C C N N 338
THR O O N N 339
THR CB C N R 340
THR OG1 O N N 341
THR CG2 C N N 342
THR OXT O N N 343
THR H H N N 344
THR H2 H N N 345
THR HA H N N 346
THR HB H N N 347
THR HG1 H N N 348
THR HG21 H N N 349
THR HG22 H N N 350
THR HG23 H N N 351
THR HXT H N N 352
TRP N N N N 353
TRP CA C N S 354
TRP C C N N 355
TRP O O N N 356
TRP CB C N N 357
TRP CG C Y N 358
TRP CD1 C Y N 359
TRP CD2 C Y N 360
TRP NE1 N Y N 361
TRP CE2 C Y N 362
TRP CE3 C Y N 363
TRP CZ2 C Y N 364
TRP CZ3 C Y N 365
TRP CH2 C Y N 366
TRP OXT O N N 367
TRP H H N N 368
TRP H2 H N N 369
TRP HA H N N 370
TRP HB2 H N N 371
TRP HB3 H N N 372
TRP HD1 H N N 373
TRP HE1 H N N 374
TRP HE3 H N N 375
TRP HZ2 H N N 376
TRP HZ3 H N N 377
TRP HH2 H N N 378
TRP HXT H N N 379
TYR N N N N 380
TYR CA C N S 381
TYR C C N N 382
TYR O O N N 383
TYR CB C N N 384
TYR CG C Y N 385
TYR CD1 C Y N 386
TYR CD2 C Y N 387
TYR CE1 C Y N 388
TYR CE2 C Y N 389
TYR CZ C Y N 390
TYR OH O N N 391
TYR OXT O N N 392
TYR H H N N 393
TYR H2 H N N 394
TYR HA H N N 395
TYR HB2 H N N 396
TYR HB3 H N N 397
TYR HD1 H N N 398
TYR HD2 H N N 399
TYR HE1 H N N 400
TYR HE2 H N N 401
TYR HH H N N 402
TYR HXT H N N 403
VAL N N N N 404
VAL CA C N S 405
VAL C C N N 406
VAL O O N N 407
VAL CB C N N 408
VAL CG1 C N N 409
VAL CG2 C N N 410
VAL OXT O N N 411
VAL H H N N 412
VAL H2 H N N 413
VAL HA H N N 414
VAL HB H N N 415
VAL HG11 H N N 416
VAL HG12 H N N 417
VAL HG13 H N N 418
VAL HG21 H N N 419
VAL HG22 H N N 420
VAL HG23 H N N 421
VAL HXT H N N 422
#
loop_
_chem_comp_bond.comp_id
_chem_comp_bond.atom_id_1
_chem_comp_bond.atom_id_2
_chem_comp_bond.value_order
_chem_comp_bond.pdbx_aromatic_flag
_chem_comp_bond.pdbx_stereo_config
_chem_comp_bond.pdbx_ordinal
ALA N CA sing N N 1
ALA N H sing N N 2
ALA N H2 sing N N 3
ALA CA C sing N N 4
ALA CA CB sing N N 5
ALA CA HA sing N N 6
ALA C O doub N N 7
ALA C OXT sing N N 8
ALA CB HB1 sing N N 9
ALA CB HB2 sing N N 10
ALA CB HB3 sing N N 11
ALA OXT HXT sing N N 12
ARG N CA sing N N 13
ARG N H sing N N 14
ARG N H2 sing N N 15
ARG CA C sing N N 16
ARG CA CB sing N N 17
ARG CA HA sing N N 18
ARG C O doub N N 19
ARG C OXT sing N N 20
ARG CB CG sing N N 21
ARG CB HB2 sing N N 22
ARG CB HB3 sing N N 23
ARG CG CD sing N N 24
ARG CG HG2 sing N N 25
ARG CG HG3 sing N N 26
ARG CD NE sing N N 27
ARG CD HD2 sing N N 28
ARG CD HD3 sing N N 29
ARG NE CZ sing N N 30
ARG NE HE sing N N 31
ARG CZ NH1 sing N N 32
ARG CZ NH2 doub N N 33
ARG NH1 HH11 sing N N 34
ARG NH1 HH12 sing N N 35
ARG NH2 HH21 sing N N 36
ARG NH2 HH22 sing N N 37
ARG OXT HXT sing N N 38
ASN N CA sing N N 39
ASN N H sing N N 40
ASN N H2 sing N N 41
ASN CA C sing N N 42
ASN CA CB sing N N 43
ASN CA HA sing N N 44
ASN C O doub N N 45
ASN C OXT sing N N 46
ASN CB CG sing N N 47
ASN CB HB2 sing N N 48
ASN CB HB3 sing N N 49
ASN CG OD1 doub N N 50
ASN CG ND2 sing N N 51
ASN ND2 HD21 sing N N 52
ASN ND2 HD22 sing N N 53
ASN OXT HXT sing N N 54
ASP N CA sing N N 55
ASP N H sing N N 56
ASP N H2 sing N N 57
ASP CA C sing N N 58
ASP CA CB sing N N 59
ASP CA HA sing N N 60
ASP C O doub N N 61
ASP C OXT sing N N 62
ASP CB CG sing N N 63
ASP CB HB2 sing N N 64
ASP CB HB3 sing N N 65
ASP CG OD1 doub N N 66
ASP CG OD2 sing N N 67
ASP OD2 HD2 sing N N 68
ASP OXT HXT sing N N 69
CYS N CA sing N N 70
CYS N H sing N N 71
CYS N H2 sing N N 72
CYS CA C sing N N 73
CYS CA CB sing N N 74
CYS CA HA sing N N 75
CYS C O doub N N 76
CYS C OXT sing N N 77
CYS CB SG sing N N 78
CYS CB HB2 sing N N 79
CYS CB HB3 sing N N 80
CYS SG HG sing N N 81
CYS OXT HXT sing N N 82
GAL C1 C2 sing N N 83
GAL C1 O1 sing N N 84
GAL C1 O5 sing N N 85
GAL C1 H1 sing N N 86
GAL C2 C3 sing N N 87
GAL C2 O2 sing N N 88
GAL C2 H2 sing N N 89
GAL C3 C4 sing N N 90
GAL C3 O3 sing N N 91
GAL C3 H3 sing N N 92
GAL C4 C5 sing N N 93
GAL C4 O4 sing N N 94
GAL C4 H4 sing N N 95
GAL C5 C6 sing N N 96
GAL C5 O5 sing N N 97
GAL C5 H5 sing N N 98
GAL C6 O6 sing N N 99
GAL C6 H61 sing N N 100
GAL C6 H62 sing N N 101
GAL O1 HO1 sing N N 102
GAL O2 HO2 sing N N 103
GAL O3 HO3 sing N N 104
GAL O4 HO4 sing N N 105
GAL O6 HO6 sing N N 106
GLN N CA sing N N 107
GLN N H sing N N 108
GLN N H2 sing N N 109
GLN CA C sing N N 110
GLN CA CB sing N N 111
GLN CA HA sing N N 112
GLN C O doub N N 113
GLN C OXT sing N N 114
GLN CB CG sing N N 115
GLN CB HB2 sing N N 116
GLN CB HB3 sing N N 117
GLN CG CD sing N N 118
GLN CG HG2 sing N N 119
GLN CG HG3 sing N N 120
GLN CD OE1 doub N N 121
GLN CD NE2 sing N N 122
GLN NE2 HE21 sing N N 123
GLN NE2 HE22 sing N N 124
GLN OXT HXT sing N N 125
GLU N CA sing N N 126
GLU N H sing N N 127
GLU N H2 sing N N 128
GLU CA C sing N N 129
GLU CA CB sing N N 130
GLU CA HA sing N N 131
GLU C O doub N N 132
GLU C OXT sing N N 133
GLU CB CG sing N N 134
GLU CB HB2 sing N N 135
GLU CB HB3 sing N N 136
GLU CG CD sing N N 137
GLU CG HG2 sing N N 138
GLU CG HG3 sing N N 139
GLU CD OE1 doub N N 140
GLU CD OE2 sing N N 141
GLU OE2 HE2 sing N N 142
GLU OXT HXT sing N N 143
GLY N CA sing N N 144
GLY N H sing N N 145
GLY N H2 sing N N 146
GLY CA C sing N N 147
GLY CA HA2 sing N N 148
GLY CA HA3 sing N N 149
GLY C O doub N N 150
GLY C OXT sing N N 151
GLY OXT HXT sing N N 152
HIS N CA sing N N 153
HIS N H sing N N 154
HIS N H2 sing N N 155
HIS CA C sing N N 156
HIS CA CB sing N N 157
HIS CA HA sing N N 158
HIS C O doub N N 159
HIS C OXT sing N N 160
HIS CB CG sing N N 161
HIS CB HB2 sing N N 162
HIS CB HB3 sing N N 163
HIS CG ND1 sing Y N 164
HIS CG CD2 doub Y N 165
HIS ND1 CE1 doub Y N 166
HIS ND1 HD1 sing N N 167
HIS CD2 NE2 sing Y N 168
HIS CD2 HD2 sing N N 169
HIS CE1 NE2 sing Y N 170
HIS CE1 HE1 sing N N 171
HIS NE2 HE2 sing N N 172
HIS OXT HXT sing N N 173
HOH O H1 sing N N 174
HOH O H2 sing N N 175
ILE N CA sing N N 176
ILE N H sing N N 177
ILE N H2 sing N N 178
ILE CA C sing N N 179
ILE CA CB sing N N 180
ILE CA HA sing N N 181
ILE C O doub N N 182
ILE C OXT sing N N 183
ILE CB CG1 sing N N 184
ILE CB CG2 sing N N 185
ILE CB HB sing N N 186
ILE CG1 CD1 sing N N 187
ILE CG1 HG12 sing N N 188
ILE CG1 HG13 sing N N 189
ILE CG2 HG21 sing N N 190
ILE CG2 HG22 sing N N 191
ILE CG2 HG23 sing N N 192
ILE CD1 HD11 sing N N 193
ILE CD1 HD12 sing N N 194
ILE CD1 HD13 sing N N 195
ILE OXT HXT sing N N 196
LEU N CA sing N N 197
LEU N H sing N N 198
LEU N H2 sing N N 199
LEU CA C sing N N 200
LEU CA CB sing N N 201
LEU CA HA sing N N 202
LEU C O doub N N 203
LEU C OXT sing N N 204
LEU CB CG sing N N 205
LEU CB HB2 sing N N 206
LEU CB HB3 sing N N 207
LEU CG CD1 sing N N 208
LEU CG CD2 sing N N 209
LEU CG HG sing N N 210
LEU CD1 HD11 sing N N 211
LEU CD1 HD12 sing N N 212
LEU CD1 HD13 sing N N 213
LEU CD2 HD21 sing N N 214
LEU CD2 HD22 sing N N 215
LEU CD2 HD23 sing N N 216
LEU OXT HXT sing N N 217
LYS N CA sing N N 218
LYS N H sing N N 219
LYS N H2 sing N N 220
LYS CA C sing N N 221
LYS CA CB sing N N 222
LYS CA HA sing N N 223
LYS C O doub N N 224
LYS C OXT sing N N 225
LYS CB CG sing N N 226
LYS CB HB2 sing N N 227
LYS CB HB3 sing N N 228
LYS CG CD sing N N 229
LYS CG HG2 sing N N 230
LYS CG HG3 sing N N 231
LYS CD CE sing N N 232
LYS CD HD2 sing N N 233
LYS CD HD3 sing N N 234
LYS CE NZ sing N N 235
LYS CE HE2 sing N N 236
LYS CE HE3 sing N N 237
LYS NZ HZ1 sing N N 238
LYS NZ HZ2 sing N N 239
LYS NZ HZ3 sing N N 240
LYS OXT HXT sing N N 241
MET N CA sing N N 242
MET N H sing N N 243
MET N H2 sing N N 244
MET CA C sing N N 245
MET CA CB sing N N 246
MET CA HA sing N N 247
MET C O doub N N 248
MET C OXT sing N N 249
MET CB CG sing N N 250
MET CB HB2 sing N N 251
MET CB HB3 sing N N 252
MET CG SD sing N N 253
MET CG HG2 sing N N 254
MET CG HG3 sing N N 255
MET SD CE sing N N 256
MET CE HE1 sing N N 257
MET CE HE2 sing N N 258
MET CE HE3 sing N N 259
MET OXT HXT sing N N 260
NDG C1 C2 sing N N 261
NDG C1 O5 sing N N 262
NDG C1 O1 sing N N 263
NDG C1 H1 sing N N 264
NDG C2 C3 sing N N 265
NDG C2 N2 sing N N 266
NDG C2 H2 sing N N 267
NDG C3 C4 sing N N 268
NDG C3 O3 sing N N 269
NDG C3 H3 sing N N 270
NDG C4 C5 sing N N 271
NDG C4 O4 sing N N 272
NDG C4 H4 sing N N 273
NDG C5 C6 sing N N 274
NDG C5 O5 sing N N 275
NDG C5 H5 sing N N 276
NDG C6 O6 sing N N 277
NDG C6 H61 sing N N 278
NDG C6 H62 sing N N 279
NDG C7 C8 sing N N 280
NDG C7 O7 doub N N 281
NDG C7 N2 sing N N 282
NDG C8 H81 sing N N 283
NDG C8 H82 sing N N 284
NDG C8 H83 sing N N 285
NDG O3 HO3 sing N N 286
NDG O4 HO4 sing N N 287
NDG O6 HO6 sing N N 288
NDG N2 HN2 sing N N 289
NDG O1 HO1 sing N N 290
PRO N CA sing N N 291
PRO N CD sing N N 292
PRO N H sing N N 293
PRO CA C sing N N 294
PRO CA CB sing N N 295
PRO CA HA sing N N 296
PRO C O doub N N 297
PRO C OXT sing N N 298
PRO CB CG sing N N 299
PRO CB HB2 sing N N 300
PRO CB HB3 sing N N 301
PRO CG CD sing N N 302
PRO CG HG2 sing N N 303
PRO CG HG3 sing N N 304
PRO CD HD2 sing N N 305
PRO CD HD3 sing N N 306
PRO OXT HXT sing N N 307
SER N CA sing N N 308
SER N H sing N N 309
SER N H2 sing N N 310
SER CA C sing N N 311
SER CA CB sing N N 312
SER CA HA sing N N 313
SER C O doub N N 314
SER C OXT sing N N 315
SER CB OG sing N N 316
SER CB HB2 sing N N 317
SER CB HB3 sing N N 318
SER OG HG sing N N 319
SER OXT HXT sing N N 320
THR N CA sing N N 321
THR N H sing N N 322
THR N H2 sing N N 323
THR CA C sing N N 324
THR CA CB sing N N 325
THR CA HA sing N N 326
THR C O doub N N 327
THR C OXT sing N N 328
THR CB OG1 sing N N 329
THR CB CG2 sing N N 330
THR CB HB sing N N 331
THR OG1 HG1 sing N N 332
THR CG2 HG21 sing N N 333
THR CG2 HG22 sing N N 334
THR CG2 HG23 sing N N 335
THR OXT HXT sing N N 336
TRP N CA sing N N 337
TRP N H sing N N 338
TRP N H2 sing N N 339
TRP CA C sing N N 340
TRP CA CB sing N N 341
TRP CA HA sing N N 342
TRP C O doub N N 343
TRP C OXT sing N N 344
TRP CB CG sing N N 345
TRP CB HB2 sing N N 346
TRP CB HB3 sing N N 347
TRP CG CD1 doub Y N 348
TRP CG CD2 sing Y N 349
TRP CD1 NE1 sing Y N 350
TRP CD1 HD1 sing N N 351
TRP CD2 CE2 doub Y N 352
TRP CD2 CE3 sing Y N 353
TRP NE1 CE2 sing Y N 354
TRP NE1 HE1 sing N N 355
TRP CE2 CZ2 sing Y N 356
TRP CE3 CZ3 doub Y N 357
TRP CE3 HE3 sing N N 358
TRP CZ2 CH2 doub Y N 359
TRP CZ2 HZ2 sing N N 360
TRP CZ3 CH2 sing Y N 361
TRP CZ3 HZ3 sing N N 362
TRP CH2 HH2 sing N N 363
TRP OXT HXT sing N N 364
TYR N CA sing N N 365
TYR N H sing N N 366
TYR N H2 sing N N 367
TYR CA C sing N N 368
TYR CA CB sing N N 369
TYR CA HA sing N N 370
TYR C O doub N N 371
TYR C OXT sing N N 372
TYR CB CG sing N N 373
TYR CB HB2 sing N N 374
TYR CB HB3 sing N N 375
TYR CG CD1 doub Y N 376
TYR CG CD2 sing Y N 377
TYR CD1 CE1 sing Y N 378
TYR CD1 HD1 sing N N 379
TYR CD2 CE2 doub Y N 380
TYR CD2 HD2 sing N N 381
TYR CE1 CZ doub Y N 382
TYR CE1 HE1 sing N N 383
TYR CE2 CZ sing Y N 384
TYR CE2 HE2 sing N N 385
TYR CZ OH sing N N 386
TYR OH HH sing N N 387
TYR OXT HXT sing N N 388
VAL N CA sing N N 389
VAL N H sing N N 390
VAL N H2 sing N N 391
VAL CA C sing N N 392
VAL CA CB sing N N 393
VAL CA HA sing N N 394
VAL C O doub N N 395
VAL C OXT sing N N 396
VAL CB CG1 sing N N 397
VAL CB CG2 sing N N 398
VAL CB HB sing N N 399
VAL CG1 HG11 sing N N 400
VAL CG1 HG12 sing N N 401
VAL CG1 HG13 sing N N 402
VAL CG2 HG21 sing N N 403
VAL CG2 HG22 sing N N 404
VAL CG2 HG23 sing N N 405
VAL OXT HXT sing N N 406
#
loop_
_pdbx_audit_support.funding_organization
_pdbx_audit_support.country
_pdbx_audit_support.grant_number
_pdbx_audit_support.ordinal
'Knut and Alice Wallenberg Foundation' Sweden ? 1
'Branco Weiss Fellowship - Society in Science' Switzerland ? 2
'COST (European Cooperation in Science and Technology) action' 'European Union' CA18103 3
'COST (European Cooperation in Science and Technology) action' 'European Union' CA18132 4
#
loop_
_pdbx_entity_branch_list.entity_id
_pdbx_entity_branch_list.comp_id
_pdbx_entity_branch_list.num
_pdbx_entity_branch_list.hetero
2 NDG 1 n
2 GAL 2 n
#
_pdbx_initial_refinement_model.id 1
_pdbx_initial_refinement_model.entity_id_list ?
_pdbx_initial_refinement_model.type 'in silico model'
_pdbx_initial_refinement_model.source_name AlphaFold
_pdbx_initial_refinement_model.accession_code A0A1S4E5V9
_pdbx_initial_refinement_model.details ?
#
_atom_sites.entry_id 8R8A
_atom_sites.Cartn_transf_matrix[1][1] ?
_atom_sites.Cartn_transf_matrix[1][2] ?
_atom_sites.Cartn_transf_matrix[1][3] ?
_atom_sites.Cartn_transf_matrix[2][1] ?
_atom_sites.Cartn_transf_matrix[2][2] ?
_atom_sites.Cartn_transf_matrix[2][3] ?
_atom_sites.Cartn_transf_matrix[3][1] ?
_atom_sites.Cartn_transf_matrix[3][2] ?
_atom_sites.Cartn_transf_matrix[3][3] ?
_atom_sites.Cartn_transf_vector[1] ?
_atom_sites.Cartn_transf_vector[2] ?
_atom_sites.Cartn_transf_vector[3] ?
_atom_sites.Cartn_transform_axes ?
_atom_sites.fract_transf_matrix[1][1] 0.027251
_atom_sites.fract_transf_matrix[1][2] 0.000000
_atom_sites.fract_transf_matrix[1][3] 0.004432
_atom_sites.fract_transf_matrix[2][1] 0.000000
_atom_sites.fract_transf_matrix[2][2] 0.027187
_atom_sites.fract_transf_matrix[2][3] 0.000000
_atom_sites.fract_transf_matrix[3][1] 0.000000
_atom_sites.fract_transf_matrix[3][2] 0.000000
_atom_sites.fract_transf_matrix[3][3] 0.010689
_atom_sites.fract_transf_vector[1] 0.00000
_atom_sites.fract_transf_vector[2] 0.00000
_atom_sites.fract_transf_vector[3] 0.00000
_atom_sites.solution_primary ?
_atom_sites.solution_secondary ?
_atom_sites.solution_hydrogens ?
_atom_sites.special_details ?
#
loop_
_atom_type.symbol
_atom_type.pdbx_scat_Z
_atom_type.pdbx_N_electrons
_atom_type.scat_Cromer_Mann_a1
_atom_type.scat_Cromer_Mann_b1
_atom_type.scat_Cromer_Mann_a2
_atom_type.scat_Cromer_Mann_b2
_atom_type.scat_Cromer_Mann_a3
_atom_type.scat_Cromer_Mann_b3
_atom_type.scat_Cromer_Mann_a4
_atom_type.scat_Cromer_Mann_b4
_atom_type.scat_Cromer_Mann_c
C 6 6 2.3103 20.8439 1.0201 10.2075 1.5888 0.5687 0.8651 51.6512 0.2156
CD 48 48 19.2218 0.5946 17.6447 6.9089 4.4611 24.7008 1.6029 87.4825 4.5906
H 1 1 0.4930 10.5109 0.3229 26.1257 0.1402 3.1424 0.0408 57.7997 0.0030
N 7 7 12.2220 0.0057 3.1346 9.8933 2.0141 28.9975 1.1672 0.5826 -11.5379
O 8 8 3.0487 13.2771 2.2870 5.7011 1.5464 0.3239 0.8671 32.9089 0.2508
S 16 16 6.9054 1.4679 5.2035 22.2151 1.4379 0.2536 1.5863 56.1720 1.0493
#
loop_