data_8RF4 # _entry.id 8RF4 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.394 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 8RF4 pdb_00008rf4 10.2210/pdb8rf4/pdb WWPDB D_1292135294 ? ? # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2024-06-19 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 8RF4 _pdbx_database_status.recvd_initial_deposition_date 2023-12-12 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_contact_author.id 2 _pdbx_contact_author.email f.kozielski@ucl.ac.uk _pdbx_contact_author.name_first Frank _pdbx_contact_author.name_last Kozielski _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0001-6096-9102 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Ma, S.' 1 0000-0002-9560-5082 'Damfo, S.' 2 0000-0002-2070-7770 'Mykhaylyk, V.' 3 0000-0003-0106-2724 'Kozielski, F.' 4 0000-0001-6096-9102 # loop_ _citation.abstract _citation.abstract_id_CAS _citation.book_id_ISBN _citation.book_publisher _citation.book_publisher_city _citation.book_title _citation.coordinate_linkage _citation.country _citation.database_id_Medline _citation.details _citation.id _citation.journal_abbrev _citation.journal_id_ASTM _citation.journal_id_CSD _citation.journal_id_ISSN _citation.journal_full _citation.journal_issue _citation.journal_volume _citation.language _citation.page_first _citation.page_last _citation.title _citation.year _citation.database_id_CSD _citation.pdbx_database_id_DOI _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_patent _citation.unpublished_flag ? ? ? ? ? ? ? ? ? ? primary 'Acta Crystallogr D Struct Biol' ? ? 2059-7983 ? ? 80 ? 451 463 'High-confidence placement of low-occupancy fragments into electron density using the anomalous signal of sulfur and halogen atoms.' 2024 ? 10.1107/S2059798324004480 38841886 ? ? ? ? ? ? ? ? ? CH ? ? 1 'Int J Mol Sci' ? ? 1422-0067 ? ? 24 ? ? ? ;High-Confidence Placement of Fragments into Electron Density Using Anomalous Diffraction-A Case Study Using Hits Targeting SARS-CoV-2 Non-Structural Protein 1. ; 2023 ? ? 37446375 ? ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Ma, S.' 1 0000-0002-9560-5082 primary 'Damfo, S.' 2 0000-0002-2070-7770 primary 'Bowler, M.W.' 3 0000-0003-0465-3351 primary 'Mykhaylyk, V.' 4 ? primary 'Kozielski, F.' 5 0000-0001-6096-9102 1 'Ma, S.' 6 ? 1 'Mykhaylyk, V.' 7 0000-0003-0106-2724 1 'Bowler, M.W.' 8 0000-0003-0465-3351 1 'Pinotsis, N.' 9 0000-0002-5096-257X 1 'Kozielski, F.' 10 0000-0001-6096-9102 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Host translation inhibitor nsp1' 13109.153 1 ? ? ? ? 2 non-polymer syn '4-chloranyl-1~{H}-indazol-3-amine' 167.596 1 ? ? ? ? 3 water nat water 18.015 77 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Leader protein,Non-structural protein 1,nsp1' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MEKTHVQLSLPVLQVRDVLVRGFGDSVEEVLSEARQHLKDGTCGLVEVEKGVLPQLEQPYVFIKRSDARTAPHGHVMVEL VAELEGIQYGRSGETLGVLVPHVGEIPVAYRKVLLRKN ; _entity_poly.pdbx_seq_one_letter_code_can ;MEKTHVQLSLPVLQVRDVLVRGFGDSVEEVLSEARQHLKDGTCGLVEVEKGVLPQLEQPYVFIKRSDARTAPHGHVMVEL VAELEGIQYGRSGETLGVLVPHVGEIPVAYRKVLLRKN ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 '4-chloranyl-1~{H}-indazol-3-amine' EQT 3 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLU n 1 3 LYS n 1 4 THR n 1 5 HIS n 1 6 VAL n 1 7 GLN n 1 8 LEU n 1 9 SER n 1 10 LEU n 1 11 PRO n 1 12 VAL n 1 13 LEU n 1 14 GLN n 1 15 VAL n 1 16 ARG n 1 17 ASP n 1 18 VAL n 1 19 LEU n 1 20 VAL n 1 21 ARG n 1 22 GLY n 1 23 PHE n 1 24 GLY n 1 25 ASP n 1 26 SER n 1 27 VAL n 1 28 GLU n 1 29 GLU n 1 30 VAL n 1 31 LEU n 1 32 SER n 1 33 GLU n 1 34 ALA n 1 35 ARG n 1 36 GLN n 1 37 HIS n 1 38 LEU n 1 39 LYS n 1 40 ASP n 1 41 GLY n 1 42 THR n 1 43 CYS n 1 44 GLY n 1 45 LEU n 1 46 VAL n 1 47 GLU n 1 48 VAL n 1 49 GLU n 1 50 LYS n 1 51 GLY n 1 52 VAL n 1 53 LEU n 1 54 PRO n 1 55 GLN n 1 56 LEU n 1 57 GLU n 1 58 GLN n 1 59 PRO n 1 60 TYR n 1 61 VAL n 1 62 PHE n 1 63 ILE n 1 64 LYS n 1 65 ARG n 1 66 SER n 1 67 ASP n 1 68 ALA n 1 69 ARG n 1 70 THR n 1 71 ALA n 1 72 PRO n 1 73 HIS n 1 74 GLY n 1 75 HIS n 1 76 VAL n 1 77 MET n 1 78 VAL n 1 79 GLU n 1 80 LEU n 1 81 VAL n 1 82 ALA n 1 83 GLU n 1 84 LEU n 1 85 GLU n 1 86 GLY n 1 87 ILE n 1 88 GLN n 1 89 TYR n 1 90 GLY n 1 91 ARG n 1 92 SER n 1 93 GLY n 1 94 GLU n 1 95 THR n 1 96 LEU n 1 97 GLY n 1 98 VAL n 1 99 LEU n 1 100 VAL n 1 101 PRO n 1 102 HIS n 1 103 VAL n 1 104 GLY n 1 105 GLU n 1 106 ILE n 1 107 PRO n 1 108 VAL n 1 109 ALA n 1 110 TYR n 1 111 ARG n 1 112 LYS n 1 113 VAL n 1 114 LEU n 1 115 LEU n 1 116 ARG n 1 117 LYS n 1 118 ASN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 118 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'rep, 1a-1b' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Severe acute respiratory syndrome coronavirus 2' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 2697049 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 EQT non-polymer . '4-chloranyl-1~{H}-indazol-3-amine' ? 'C7 H6 Cl N3' 167.596 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 9 9 MET MET A . n A 1 2 GLU 2 10 10 GLU GLU A . n A 1 3 LYS 3 11 11 LYS LYS A . n A 1 4 THR 4 12 12 THR THR A . n A 1 5 HIS 5 13 13 HIS HIS A . n A 1 6 VAL 6 14 14 VAL VAL A . n A 1 7 GLN 7 15 15 GLN GLN A . n A 1 8 LEU 8 16 16 LEU LEU A . n A 1 9 SER 9 17 17 SER SER A . n A 1 10 LEU 10 18 18 LEU LEU A . n A 1 11 PRO 11 19 19 PRO PRO A . n A 1 12 VAL 12 20 20 VAL VAL A . n A 1 13 LEU 13 21 21 LEU LEU A . n A 1 14 GLN 14 22 22 GLN GLN A . n A 1 15 VAL 15 23 23 VAL VAL A . n A 1 16 ARG 16 24 24 ARG ARG A . n A 1 17 ASP 17 25 25 ASP ASP A . n A 1 18 VAL 18 26 26 VAL VAL A . n A 1 19 LEU 19 27 27 LEU LEU A . n A 1 20 VAL 20 28 28 VAL VAL A . n A 1 21 ARG 21 29 29 ARG ARG A . n A 1 22 GLY 22 30 30 GLY GLY A . n A 1 23 PHE 23 31 31 PHE PHE A . n A 1 24 GLY 24 32 32 GLY GLY A . n A 1 25 ASP 25 33 33 ASP ASP A . n A 1 26 SER 26 34 34 SER SER A . n A 1 27 VAL 27 35 35 VAL VAL A . n A 1 28 GLU 28 36 36 GLU GLU A . n A 1 29 GLU 29 37 37 GLU GLU A . n A 1 30 VAL 30 38 38 VAL VAL A . n A 1 31 LEU 31 39 39 LEU LEU A . n A 1 32 SER 32 40 40 SER SER A . n A 1 33 GLU 33 41 41 GLU GLU A . n A 1 34 ALA 34 42 42 ALA ALA A . n A 1 35 ARG 35 43 43 ARG ARG A . n A 1 36 GLN 36 44 44 GLN GLN A . n A 1 37 HIS 37 45 45 HIS HIS A . n A 1 38 LEU 38 46 46 LEU LEU A . n A 1 39 LYS 39 47 47 LYS LYS A . n A 1 40 ASP 40 48 48 ASP ASP A . n A 1 41 GLY 41 49 49 GLY GLY A . n A 1 42 THR 42 50 50 THR THR A . n A 1 43 CYS 43 51 51 CYS CYS A . n A 1 44 GLY 44 52 52 GLY GLY A . n A 1 45 LEU 45 53 53 LEU LEU A . n A 1 46 VAL 46 54 54 VAL VAL A . n A 1 47 GLU 47 55 55 GLU GLU A . n A 1 48 VAL 48 56 56 VAL VAL A . n A 1 49 GLU 49 57 57 GLU GLU A . n A 1 50 LYS 50 58 58 LYS LYS A . n A 1 51 GLY 51 59 59 GLY GLY A . n A 1 52 VAL 52 60 60 VAL VAL A . n A 1 53 LEU 53 61 61 LEU LEU A . n A 1 54 PRO 54 62 62 PRO PRO A . n A 1 55 GLN 55 63 63 GLN GLN A . n A 1 56 LEU 56 64 64 LEU LEU A . n A 1 57 GLU 57 65 65 GLU GLU A . n A 1 58 GLN 58 66 66 GLN GLN A . n A 1 59 PRO 59 67 67 PRO PRO A . n A 1 60 TYR 60 68 68 TYR TYR A . n A 1 61 VAL 61 69 69 VAL VAL A . n A 1 62 PHE 62 70 70 PHE PHE A . n A 1 63 ILE 63 71 71 ILE ILE A . n A 1 64 LYS 64 72 72 LYS LYS A . n A 1 65 ARG 65 73 73 ARG ARG A . n A 1 66 SER 66 74 74 SER SER A . n A 1 67 ASP 67 75 75 ASP ASP A . n A 1 68 ALA 68 76 76 ALA ALA A . n A 1 69 ARG 69 77 77 ARG ARG A . n A 1 70 THR 70 78 78 THR THR A . n A 1 71 ALA 71 79 79 ALA ALA A . n A 1 72 PRO 72 80 80 PRO PRO A . n A 1 73 HIS 73 81 81 HIS HIS A . n A 1 74 GLY 74 82 82 GLY GLY A . n A 1 75 HIS 75 83 83 HIS HIS A . n A 1 76 VAL 76 84 84 VAL VAL A . n A 1 77 MET 77 85 85 MET MET A . n A 1 78 VAL 78 86 86 VAL VAL A . n A 1 79 GLU 79 87 87 GLU GLU A . n A 1 80 LEU 80 88 88 LEU LEU A . n A 1 81 VAL 81 89 89 VAL VAL A . n A 1 82 ALA 82 90 90 ALA ALA A . n A 1 83 GLU 83 91 91 GLU GLU A . n A 1 84 LEU 84 92 92 LEU LEU A . n A 1 85 GLU 85 93 93 GLU GLU A . n A 1 86 GLY 86 94 94 GLY GLY A . n A 1 87 ILE 87 95 95 ILE ILE A . n A 1 88 GLN 88 96 96 GLN GLN A . n A 1 89 TYR 89 97 97 TYR TYR A . n A 1 90 GLY 90 98 98 GLY GLY A . n A 1 91 ARG 91 99 99 ARG ARG A . n A 1 92 SER 92 100 100 SER SER A . n A 1 93 GLY 93 101 101 GLY GLY A . n A 1 94 GLU 94 102 102 GLU GLU A . n A 1 95 THR 95 103 103 THR THR A . n A 1 96 LEU 96 104 104 LEU LEU A . n A 1 97 GLY 97 105 105 GLY GLY A . n A 1 98 VAL 98 106 106 VAL VAL A . n A 1 99 LEU 99 107 107 LEU LEU A . n A 1 100 VAL 100 108 108 VAL VAL A . n A 1 101 PRO 101 109 109 PRO PRO A . n A 1 102 HIS 102 110 110 HIS HIS A . n A 1 103 VAL 103 111 111 VAL VAL A . n A 1 104 GLY 104 112 112 GLY GLY A . n A 1 105 GLU 105 113 113 GLU GLU A . n A 1 106 ILE 106 114 114 ILE ILE A . n A 1 107 PRO 107 115 115 PRO PRO A . n A 1 108 VAL 108 116 116 VAL VAL A . n A 1 109 ALA 109 117 117 ALA ALA A . n A 1 110 TYR 110 118 118 TYR TYR A . n A 1 111 ARG 111 119 119 ARG ARG A . n A 1 112 LYS 112 120 120 LYS LYS A . n A 1 113 VAL 113 121 121 VAL VAL A . n A 1 114 LEU 114 122 122 LEU LEU A . n A 1 115 LEU 115 123 123 LEU LEU A . n A 1 116 ARG 116 124 124 ARG ARG A . n A 1 117 LYS 117 125 125 LYS LYS A . n A 1 118 ASN 118 126 126 ASN ASN A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 EQT 1 201 209 EQT 00Z A . C 3 HOH 1 301 55 HOH HOH A . C 3 HOH 2 302 61 HOH HOH A . C 3 HOH 3 303 45 HOH HOH A . C 3 HOH 4 304 15 HOH HOH A . C 3 HOH 5 305 81 HOH HOH A . C 3 HOH 6 306 40 HOH HOH A . C 3 HOH 7 307 56 HOH HOH A . C 3 HOH 8 308 74 HOH HOH A . C 3 HOH 9 309 80 HOH HOH A . C 3 HOH 10 310 48 HOH HOH A . C 3 HOH 11 311 50 HOH HOH A . C 3 HOH 12 312 41 HOH HOH A . C 3 HOH 13 313 1 HOH HOH A . C 3 HOH 14 314 30 HOH HOH A . C 3 HOH 15 315 20 HOH HOH A . C 3 HOH 16 316 28 HOH HOH A . C 3 HOH 17 317 3 HOH HOH A . C 3 HOH 18 318 6 HOH HOH A . C 3 HOH 19 319 10 HOH HOH A . C 3 HOH 20 320 25 HOH HOH A . C 3 HOH 21 321 35 HOH HOH A . C 3 HOH 22 322 16 HOH HOH A . C 3 HOH 23 323 69 HOH HOH A . C 3 HOH 24 324 31 HOH HOH A . C 3 HOH 25 325 37 HOH HOH A . C 3 HOH 26 326 49 HOH HOH A . C 3 HOH 27 327 17 HOH HOH A . C 3 HOH 28 328 39 HOH HOH A . C 3 HOH 29 329 46 HOH HOH A . C 3 HOH 30 330 5 HOH HOH A . C 3 HOH 31 331 12 HOH HOH A . C 3 HOH 32 332 18 HOH HOH A . C 3 HOH 33 333 14 HOH HOH A . C 3 HOH 34 334 23 HOH HOH A . C 3 HOH 35 335 8 HOH HOH A . C 3 HOH 36 336 2 HOH HOH A . C 3 HOH 37 337 44 HOH HOH A . C 3 HOH 38 338 51 HOH HOH A . C 3 HOH 39 339 78 HOH HOH A . C 3 HOH 40 340 29 HOH HOH A . C 3 HOH 41 341 34 HOH HOH A . C 3 HOH 42 342 26 HOH HOH A . C 3 HOH 43 343 13 HOH HOH A . C 3 HOH 44 344 38 HOH HOH A . C 3 HOH 45 345 66 HOH HOH A . C 3 HOH 46 346 11 HOH HOH A . C 3 HOH 47 347 7 HOH HOH A . C 3 HOH 48 348 68 HOH HOH A . C 3 HOH 49 349 42 HOH HOH A . C 3 HOH 50 350 4 HOH HOH A . C 3 HOH 51 351 21 HOH HOH A . C 3 HOH 52 352 47 HOH HOH A . C 3 HOH 53 353 19 HOH HOH A . C 3 HOH 54 354 64 HOH HOH A . C 3 HOH 55 355 43 HOH HOH A . C 3 HOH 56 356 32 HOH HOH A . C 3 HOH 57 357 24 HOH HOH A . C 3 HOH 58 358 27 HOH HOH A . C 3 HOH 59 359 54 HOH HOH A . C 3 HOH 60 360 22 HOH HOH A . C 3 HOH 61 361 9 HOH HOH A . C 3 HOH 62 362 36 HOH HOH A . C 3 HOH 63 363 52 HOH HOH A . C 3 HOH 64 364 59 HOH HOH A . C 3 HOH 65 365 72 HOH HOH A . C 3 HOH 66 366 62 HOH HOH A . C 3 HOH 67 367 60 HOH HOH A . C 3 HOH 68 368 65 HOH HOH A . C 3 HOH 69 369 57 HOH HOH A . C 3 HOH 70 370 67 HOH HOH A . C 3 HOH 71 371 73 HOH HOH A . C 3 HOH 72 372 82 HOH HOH A . C 3 HOH 73 373 77 HOH HOH A . C 3 HOH 74 374 58 HOH HOH A . C 3 HOH 75 375 63 HOH HOH A . C 3 HOH 76 376 79 HOH HOH A . C 3 HOH 77 377 53 HOH HOH A . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A GLU 10 ? CG ? A GLU 2 CG 2 1 Y 1 A GLU 10 ? CD ? A GLU 2 CD 3 1 Y 1 A GLU 10 ? OE1 ? A GLU 2 OE1 4 1 Y 1 A GLU 10 ? OE2 ? A GLU 2 OE2 5 1 Y 1 A LYS 47 ? CD ? A LYS 39 CD 6 1 Y 1 A LYS 47 ? CE ? A LYS 39 CE 7 1 Y 1 A LYS 47 ? NZ ? A LYS 39 NZ 8 1 Y 1 A LYS 58 ? CD ? A LYS 50 CD 9 1 Y 1 A LYS 58 ? CE ? A LYS 50 CE 10 1 Y 1 A LYS 58 ? NZ ? A LYS 50 NZ 11 1 Y 1 A ASP 75 ? OD1 ? A ASP 67 OD1 12 1 Y 1 A THR 78 ? CB ? A THR 70 CB 13 1 Y 1 A THR 78 ? OG1 ? A THR 70 OG1 14 1 Y 1 A THR 78 ? CG2 ? A THR 70 CG2 # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? '(1.20.1-4487-000)' 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? 0.7.9 2 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? 'Jan 10, 2022 BUILT=20220820' 3 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 8RF4 _cell.details ? _cell.formula_units_Z ? _cell.length_a 36.958 _cell.length_a_esd ? _cell.length_b 36.958 _cell.length_b_esd ? _cell.length_c 141.538 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 8RF4 _symmetry.cell_setting ? _symmetry.Int_Tables_number 96 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 43 21 2' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 8RF4 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 1.84 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 33.28 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 6.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details ;The crystallisation condition used is Index 71 (Cat. No.: HR2-944-71; Hampton Research, Aliso Viejo, CA, USA) containing 0.1 M BIS-TRIS pH 6.5, 0.2 M NaCl and 25% w/v Polyethylene glycol 3350. ; _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 291.15 # loop_ _diffrn.ambient_environment _diffrn.ambient_temp _diffrn.ambient_temp_details _diffrn.ambient_temp_esd _diffrn.crystal_id _diffrn.crystal_support _diffrn.crystal_treatment _diffrn.details _diffrn.id _diffrn.ambient_pressure _diffrn.ambient_pressure_esd _diffrn.ambient_pressure_gt _diffrn.ambient_pressure_lt _diffrn.ambient_temp_gt _diffrn.ambient_temp_lt _diffrn.pdbx_serial_crystal_experiment ? 100 ? ? 1 ? ? ? 1 ? ? ? ? ? ? N ? 80 ? ? 1 ? ? ? 2 ? ? ? ? ? ? N # loop_ _diffrn_detector.details _diffrn_detector.detector _diffrn_detector.diffrn_id _diffrn_detector.type _diffrn_detector.area_resol_mean _diffrn_detector.dtime _diffrn_detector.pdbx_frames_total _diffrn_detector.pdbx_collection_time_total _diffrn_detector.pdbx_collection_date _diffrn_detector.pdbx_frequency _diffrn_detector.id _diffrn_detector.number_of_axes ? PIXEL 1 'DECTRIS PILATUS3 2M' ? ? ? ? 2023-07-21 ? ? ? ? PIXEL 2 'DECTRIS PILATUS 12M' ? ? ? ? 2023-07-28 ? ? ? # loop_ _diffrn_radiation.collimation _diffrn_radiation.diffrn_id _diffrn_radiation.filter_edge _diffrn_radiation.inhomogeneity _diffrn_radiation.monochromator _diffrn_radiation.polarisn_norm _diffrn_radiation.polarisn_ratio _diffrn_radiation.probe _diffrn_radiation.type _diffrn_radiation.xray_symbol _diffrn_radiation.wavelength_id _diffrn_radiation.pdbx_monochromatic_or_laue_m_l _diffrn_radiation.pdbx_wavelength_list _diffrn_radiation.pdbx_wavelength _diffrn_radiation.pdbx_diffrn_protocol _diffrn_radiation.pdbx_analyzer _diffrn_radiation.pdbx_scattering_type ? 1 ? ? ? ? ? ? ? ? 1 M ? ? 'SINGLE WAVELENGTH' ? x-ray ? 2 ? ? ? ? ? ? ? ? 2 M ? ? 'SINGLE WAVELENGTH' ? x-ray # loop_ _diffrn_radiation_wavelength.id _diffrn_radiation_wavelength.wavelength _diffrn_radiation_wavelength.wt 1 0.96546 1.0 2 2.75520 1.0 # loop_ _diffrn_source.current _diffrn_source.details _diffrn_source.diffrn_id _diffrn_source.power _diffrn_source.size _diffrn_source.source _diffrn_source.target _diffrn_source.type _diffrn_source.voltage _diffrn_source.take-off_angle _diffrn_source.pdbx_wavelength_list _diffrn_source.pdbx_wavelength _diffrn_source.pdbx_synchrotron_beamline _diffrn_source.pdbx_synchrotron_site ? ? 1 ? ? SYNCHROTRON ? 'ESRF BEAMLINE MASSIF-1' ? ? 0.96546 ? MASSIF-1 ESRF ? ? 2 ? ? SYNCHROTRON ? 'DIAMOND BEAMLINE I23' ? ? 2.75520 ? I23 Diamond # loop_ _reflns.B_iso_Wilson_estimate _reflns.entry_id _reflns.data_reduction_details _reflns.data_reduction_method _reflns.d_resolution_high _reflns.d_resolution_low _reflns.details _reflns.limit_h_max _reflns.limit_h_min _reflns.limit_k_max _reflns.limit_k_min _reflns.limit_l_max _reflns.limit_l_min _reflns.number_all _reflns.number_obs _reflns.observed_criterion _reflns.observed_criterion_F_max _reflns.observed_criterion_F_min _reflns.observed_criterion_I_max _reflns.observed_criterion_I_min _reflns.observed_criterion_sigma_F _reflns.observed_criterion_sigma_I _reflns.percent_possible_obs _reflns.R_free_details _reflns.Rmerge_F_all _reflns.Rmerge_F_obs _reflns.Friedel_coverage _reflns.number_gt _reflns.threshold_expression _reflns.pdbx_redundancy _reflns.pdbx_netI_over_av_sigmaI _reflns.pdbx_netI_over_sigmaI _reflns.pdbx_res_netI_over_av_sigmaI_2 _reflns.pdbx_res_netI_over_sigmaI_2 _reflns.pdbx_chi_squared _reflns.pdbx_scaling_rejects _reflns.pdbx_d_res_high_opt _reflns.pdbx_d_res_low_opt _reflns.pdbx_d_res_opt_method _reflns.phase_calculation_details _reflns.pdbx_Rrim_I_all _reflns.pdbx_Rpim_I_all _reflns.pdbx_d_opt _reflns.pdbx_number_measured_all _reflns.pdbx_diffrn_id _reflns.pdbx_ordinal _reflns.pdbx_CC_half _reflns.pdbx_CC_star _reflns.pdbx_R_split _reflns.pdbx_Rmerge_I_obs _reflns.pdbx_Rmerge_I_all _reflns.pdbx_Rsym_value _reflns.pdbx_CC_split_method ? 8RF4 ? ? 1.107 35.76 ? ? ? ? ? ? ? ? 38471 ? ? ? ? ? ? ? 95.4 ? ? ? ? ? ? 24.0 ? 10.3 ? ? ? ? ? ? ? ? 0.156 0.032 ? ? 1 1 0.994 ? ? 0.153 ? ? ? ? 8RF4 ? ? 1.77 35.59 ? ? ? ? ? ? ? ? 9161 ? ? ? ? ? ? ? 90.6 ? ? ? ? ? ? 12.1 ? 29.0 ? ? ? ? ? ? ? ? ? 0.013 ? ? 2 2 0.999 ? ? 0.049 ? ? ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_CC_star _reflns_shell.pdbx_R_split _reflns_shell.percent_possible_all _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_percent_possible_ellipsoidal _reflns_shell.pdbx_percent_possible_spherical _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous _reflns_shell.pdbx_percent_possible_spherical_anomalous _reflns_shell.pdbx_redundancy_anomalous _reflns_shell.pdbx_CC_half_anomalous _reflns_shell.pdbx_absDiff_over_sigma_anomalous _reflns_shell.pdbx_percent_possible_anomalous 1.107 1.127 ? ? ? ? ? ? 1831 ? ? ? ? ? ? ? ? ? ? ? 19.6 ? ? ? 6.246 1.385 ? 1 1 0.393 ? ? 92.6 ? 6.082 ? ? ? ? ? ? ? ? ? 1.77 1.80 ? ? ? ? ? ? 340 ? ? ? ? ? ? ? ? ? ? ? 5.2 ? ? ? 0.303 0.131 ? 2 2 0.933 ? ? 71.7 ? 0.272 ? ? ? ? ? ? ? ? ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean ? _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 8RF4 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.11 _refine.ls_d_res_low 35.76 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 37808 _refine.ls_number_reflns_R_free 1885 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 93.80 _refine.ls_percent_reflns_R_free 4.99 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1878 _refine.ls_R_factor_R_free 0.2124 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1865 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.33 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.10 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 24.98 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.15 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 1.11 _refine_hist.d_res_low 35.76 _refine_hist.number_atoms_solvent 77 _refine_hist.number_atoms_total 995 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 918 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.009 ? 969 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 1.240 ? 1318 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 8.731 ? 135 ? f_dihedral_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.100 ? 150 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.010 ? 172 ? f_plane_restr ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free _refine_ls_shell.R_factor_R_free 'X-RAY DIFFRACTION' 1.11 1.14 . . 112 2140 74.00 . . . . 0.4251 . . . . . . . . . . . 0.4034 'X-RAY DIFFRACTION' 1.14 1.17 . . 155 2661 93.00 . . . . 0.2849 . . . . . . . . . . . 0.2856 'X-RAY DIFFRACTION' 1.17 1.21 . . 136 2694 93.00 . . . . 0.2618 . . . . . . . . . . . 0.2910 'X-RAY DIFFRACTION' 1.21 1.25 . . 132 2724 94.00 . . . . 0.2588 . . . . . . . . . . . 0.2805 'X-RAY DIFFRACTION' 1.25 1.30 . . 147 2673 93.00 . . . . 0.2976 . . . . . . . . . . . 0.3283 'X-RAY DIFFRACTION' 1.30 1.36 . . 165 2735 95.00 . . . . 0.2129 . . . . . . . . . . . 0.2436 'X-RAY DIFFRACTION' 1.36 1.43 . . 141 2764 95.00 . . . . 0.1963 . . . . . . . . . . . 0.2456 'X-RAY DIFFRACTION' 1.43 1.52 . . 139 2808 96.00 . . . . 0.1741 . . . . . . . . . . . 0.2383 'X-RAY DIFFRACTION' 1.52 1.64 . . 135 2850 96.00 . . . . 0.1643 . . . . . . . . . . . 0.1970 'X-RAY DIFFRACTION' 1.64 1.81 . . 148 2866 97.00 . . . . 0.1597 . . . . . . . . . . . 0.1994 'X-RAY DIFFRACTION' 1.81 2.07 . . 154 2926 98.00 . . . . 0.1705 . . . . . . . . . . . 0.1903 'X-RAY DIFFRACTION' 2.07 2.60 . . 146 2991 99.00 . . . . 0.1885 . . . . . . . . . . . 0.2033 'X-RAY DIFFRACTION' 2.60 35.76 . . 175 3091 96.00 . . . . 0.1778 . . . . . . . . . . . 0.2038 # _struct.entry_id 8RF4 _struct.title 'Crystal structure of N-terminal SARS-CoV-2 nsp1 in complex with fragment hit 9D4 refined against the anomalous diffraction data' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 8RF4 _struct_keywords.text 'Viral Protein, SARS-CoV-2, non-structural protein 1, nsp1, fragment hit, anomalous diffraction, Protein binding' _struct_keywords.pdbx_keywords 'PROTEIN BINDING' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code R1AB_SARS2 _struct_ref.pdbx_db_accession P0DTD1 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;EKTHVQLSLPVLQVRDVLVRGFGDSVEEVLSEARQHLKDGTCGLVEVEKGVLPQLEQPYVFIKRSDARTAPHGHVMVELV AELEGIQYGRSGETLGVLVPHVGEIPVAYRKVLLRKN ; _struct_ref.pdbx_align_begin 10 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 8RF4 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 118 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P0DTD1 _struct_ref_seq.db_align_beg 10 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 126 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 10 _struct_ref_seq.pdbx_auth_seq_align_end 126 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 8RF4 _struct_ref_seq_dif.mon_id MET _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 1 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code P0DTD1 _struct_ref_seq_dif.db_mon_id ? _struct_ref_seq_dif.pdbx_seq_db_seq_num ? _struct_ref_seq_dif.details 'initiating methionine' _struct_ref_seq_dif.pdbx_auth_seq_num 9 _struct_ref_seq_dif.pdbx_ordinal 1 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 6910 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details 'Single protein molecule' # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 GLN A 14 ? VAL A 18 ? GLN A 22 VAL A 26 5 ? 5 HELX_P HELX_P2 AA2 SER A 26 ? GLY A 41 ? SER A 34 GLY A 49 1 ? 16 HELX_P HELX_P3 AA3 VAL A 52 ? LEU A 56 ? VAL A 60 LEU A 64 5 ? 5 HELX_P HELX_P4 AA4 ALA A 71 ? HIS A 75 ? ALA A 79 HIS A 83 5 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id GLN _struct_mon_prot_cis.label_seq_id 58 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id GLN _struct_mon_prot_cis.auth_seq_id 66 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 59 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 67 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle -8.42 # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 8 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? parallel AA1 3 4 ? anti-parallel AA1 4 5 ? parallel AA1 5 6 ? anti-parallel AA1 6 7 ? anti-parallel AA1 7 8 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ILE A 87 ? TYR A 89 ? ILE A 95 TYR A 97 AA1 2 VAL A 76 ? LEU A 84 ? VAL A 84 LEU A 92 AA1 3 ALA A 109 ? ARG A 116 ? ALA A 117 ARG A 124 AA1 4 HIS A 5 ? VAL A 12 ? HIS A 13 VAL A 20 AA1 5 CYS A 43 ? VAL A 46 ? CYS A 51 VAL A 54 AA1 6 THR A 95 ? PRO A 101 ? THR A 103 PRO A 109 AA1 7 TYR A 60 ? ARG A 65 ? TYR A 68 ARG A 73 AA1 8 VAL A 76 ? LEU A 84 ? VAL A 84 LEU A 92 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O TYR A 89 ? O TYR A 97 N ALA A 82 ? N ALA A 90 AA1 2 3 N VAL A 76 ? N VAL A 84 O LEU A 114 ? O LEU A 122 AA1 3 4 O ALA A 109 ? O ALA A 117 N VAL A 12 ? N VAL A 20 AA1 4 5 N PRO A 11 ? N PRO A 19 O LEU A 45 ? O LEU A 53 AA1 5 6 N GLY A 44 ? N GLY A 52 O VAL A 100 ? O VAL A 108 AA1 6 7 O LEU A 99 ? O LEU A 107 N VAL A 61 ? N VAL A 69 AA1 7 8 N PHE A 62 ? N PHE A 70 O VAL A 81 ? O VAL A 89 # loop_ _pdbx_validate_rmsd_bond.id _pdbx_validate_rmsd_bond.PDB_model_num _pdbx_validate_rmsd_bond.auth_atom_id_1 _pdbx_validate_rmsd_bond.auth_asym_id_1 _pdbx_validate_rmsd_bond.auth_comp_id_1 _pdbx_validate_rmsd_bond.auth_seq_id_1 _pdbx_validate_rmsd_bond.PDB_ins_code_1 _pdbx_validate_rmsd_bond.label_alt_id_1 _pdbx_validate_rmsd_bond.auth_atom_id_2 _pdbx_validate_rmsd_bond.auth_asym_id_2 _pdbx_validate_rmsd_bond.auth_comp_id_2 _pdbx_validate_rmsd_bond.auth_seq_id_2 _pdbx_validate_rmsd_bond.PDB_ins_code_2 _pdbx_validate_rmsd_bond.label_alt_id_2 _pdbx_validate_rmsd_bond.bond_value _pdbx_validate_rmsd_bond.bond_target_value _pdbx_validate_rmsd_bond.bond_deviation _pdbx_validate_rmsd_bond.bond_standard_deviation _pdbx_validate_rmsd_bond.linker_flag 1 1 C A LEU 53 ? ? O A LEU 53 ? ? 1.351 1.229 0.122 0.019 N 2 1 C A MET 85 ? ? O A MET 85 ? ? 1.355 1.229 0.126 0.019 N # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 1 ARG A 73 ? ? 0.192 'SIDE CHAIN' 2 1 ARG A 77 ? ? 0.102 'SIDE CHAIN' # _pdbx_struct_special_symmetry.id 1 _pdbx_struct_special_symmetry.PDB_model_num 1 _pdbx_struct_special_symmetry.auth_asym_id A _pdbx_struct_special_symmetry.auth_comp_id HOH _pdbx_struct_special_symmetry.auth_seq_id 377 _pdbx_struct_special_symmetry.PDB_ins_code ? _pdbx_struct_special_symmetry.label_asym_id C _pdbx_struct_special_symmetry.label_comp_id HOH _pdbx_struct_special_symmetry.label_seq_id . # _pdbx_entry_details.entry_id 8RF4 _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.has_protein_modification ? # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 EQT C2 C Y N 88 EQT N4 N Y N 89 EQT C5 C Y N 90 EQT C6 C Y N 91 EQT C7 C Y N 92 EQT C8 C Y N 93 EQT C11 C Y N 94 EQT N1 N N N 95 EQT N3 N Y N 96 EQT C9 C Y N 97 EQT CL1 CL N N 98 EQT H12 H N N 99 EQT H15 H N N 100 EQT H16 H N N 101 EQT H17 H N N 102 EQT H14 H N N 103 EQT H13 H N N 104 GLN N N N N 105 GLN CA C N S 106 GLN C C N N 107 GLN O O N N 108 GLN CB C N N 109 GLN CG C N N 110 GLN CD C N N 111 GLN OE1 O N N 112 GLN NE2 N N N 113 GLN OXT O N N 114 GLN H H N N 115 GLN H2 H N N 116 GLN HA H N N 117 GLN HB2 H N N 118 GLN HB3 H N N 119 GLN HG2 H N N 120 GLN HG3 H N N 121 GLN HE21 H N N 122 GLN HE22 H N N 123 GLN HXT H N N 124 GLU N N N N 125 GLU CA C N S 126 GLU C C N N 127 GLU O O N N 128 GLU CB C N N 129 GLU CG C N N 130 GLU CD C N N 131 GLU OE1 O N N 132 GLU OE2 O N N 133 GLU OXT O N N 134 GLU H H N N 135 GLU H2 H N N 136 GLU HA H N N 137 GLU HB2 H N N 138 GLU HB3 H N N 139 GLU HG2 H N N 140 GLU HG3 H N N 141 GLU HE2 H N N 142 GLU HXT H N N 143 GLY N N N N 144 GLY CA C N N 145 GLY C C N N 146 GLY O O N N 147 GLY OXT O N N 148 GLY H H N N 149 GLY H2 H N N 150 GLY HA2 H N N 151 GLY HA3 H N N 152 GLY HXT H N N 153 HIS N N N N 154 HIS CA C N S 155 HIS C C N N 156 HIS O O N N 157 HIS CB C N N 158 HIS CG C Y N 159 HIS ND1 N Y N 160 HIS CD2 C Y N 161 HIS CE1 C Y N 162 HIS NE2 N Y N 163 HIS OXT O N N 164 HIS H H N N 165 HIS H2 H N N 166 HIS HA H N N 167 HIS HB2 H N N 168 HIS HB3 H N N 169 HIS HD1 H N N 170 HIS HD2 H N N 171 HIS HE1 H N N 172 HIS HE2 H N N 173 HIS HXT H N N 174 HOH O O N N 175 HOH H1 H N N 176 HOH H2 H N N 177 ILE N N N N 178 ILE CA C N S 179 ILE C C N N 180 ILE O O N N 181 ILE CB C N S 182 ILE CG1 C N N 183 ILE CG2 C N N 184 ILE CD1 C N N 185 ILE OXT O N N 186 ILE H H N N 187 ILE H2 H N N 188 ILE HA H N N 189 ILE HB H N N 190 ILE HG12 H N N 191 ILE HG13 H N N 192 ILE HG21 H N N 193 ILE HG22 H N N 194 ILE HG23 H N N 195 ILE HD11 H N N 196 ILE HD12 H N N 197 ILE HD13 H N N 198 ILE HXT H N N 199 LEU N N N N 200 LEU CA C N S 201 LEU C C N N 202 LEU O O N N 203 LEU CB C N N 204 LEU CG C N N 205 LEU CD1 C N N 206 LEU CD2 C N N 207 LEU OXT O N N 208 LEU H H N N 209 LEU H2 H N N 210 LEU HA H N N 211 LEU HB2 H N N 212 LEU HB3 H N N 213 LEU HG H N N 214 LEU HD11 H N N 215 LEU HD12 H N N 216 LEU HD13 H N N 217 LEU HD21 H N N 218 LEU HD22 H N N 219 LEU HD23 H N N 220 LEU HXT H N N 221 LYS N N N N 222 LYS CA C N S 223 LYS C C N N 224 LYS O O N N 225 LYS CB C N N 226 LYS CG C N N 227 LYS CD C N N 228 LYS CE C N N 229 LYS NZ N N N 230 LYS OXT O N N 231 LYS H H N N 232 LYS H2 H N N 233 LYS HA H N N 234 LYS HB2 H N N 235 LYS HB3 H N N 236 LYS HG2 H N N 237 LYS HG3 H N N 238 LYS HD2 H N N 239 LYS HD3 H N N 240 LYS HE2 H N N 241 LYS HE3 H N N 242 LYS HZ1 H N N 243 LYS HZ2 H N N 244 LYS HZ3 H N N 245 LYS HXT H N N 246 MET N N N N 247 MET CA C N S 248 MET C C N N 249 MET O O N N 250 MET CB C N N 251 MET CG C N N 252 MET SD S N N 253 MET CE C N N 254 MET OXT O N N 255 MET H H N N 256 MET H2 H N N 257 MET HA H N N 258 MET HB2 H N N 259 MET HB3 H N N 260 MET HG2 H N N 261 MET HG3 H N N 262 MET HE1 H N N 263 MET HE2 H N N 264 MET HE3 H N N 265 MET HXT H N N 266 PHE N N N N 267 PHE CA C N S 268 PHE C C N N 269 PHE O O N N 270 PHE CB C N N 271 PHE CG C Y N 272 PHE CD1 C Y N 273 PHE CD2 C Y N 274 PHE CE1 C Y N 275 PHE CE2 C Y N 276 PHE CZ C Y N 277 PHE OXT O N N 278 PHE H H N N 279 PHE H2 H N N 280 PHE HA H N N 281 PHE HB2 H N N 282 PHE HB3 H N N 283 PHE HD1 H N N 284 PHE HD2 H N N 285 PHE HE1 H N N 286 PHE HE2 H N N 287 PHE HZ H N N 288 PHE HXT H N N 289 PRO N N N N 290 PRO CA C N S 291 PRO C C N N 292 PRO O O N N 293 PRO CB C N N 294 PRO CG C N N 295 PRO CD C N N 296 PRO OXT O N N 297 PRO H H N N 298 PRO HA H N N 299 PRO HB2 H N N 300 PRO HB3 H N N 301 PRO HG2 H N N 302 PRO HG3 H N N 303 PRO HD2 H N N 304 PRO HD3 H N N 305 PRO HXT H N N 306 SER N N N N 307 SER CA C N S 308 SER C C N N 309 SER O O N N 310 SER CB C N N 311 SER OG O N N 312 SER OXT O N N 313 SER H H N N 314 SER H2 H N N 315 SER HA H N N 316 SER HB2 H N N 317 SER HB3 H N N 318 SER HG H N N 319 SER HXT H N N 320 THR N N N N 321 THR CA C N S 322 THR C C N N 323 THR O O N N 324 THR CB C N R 325 THR OG1 O N N 326 THR CG2 C N N 327 THR OXT O N N 328 THR H H N N 329 THR H2 H N N 330 THR HA H N N 331 THR HB H N N 332 THR HG1 H N N 333 THR HG21 H N N 334 THR HG22 H N N 335 THR HG23 H N N 336 THR HXT H N N 337 TYR N N N N 338 TYR CA C N S 339 TYR C C N N 340 TYR O O N N 341 TYR CB C N N 342 TYR CG C Y N 343 TYR CD1 C Y N 344 TYR CD2 C Y N 345 TYR CE1 C Y N 346 TYR CE2 C Y N 347 TYR CZ C Y N 348 TYR OH O N N 349 TYR OXT O N N 350 TYR H H N N 351 TYR H2 H N N 352 TYR HA H N N 353 TYR HB2 H N N 354 TYR HB3 H N N 355 TYR HD1 H N N 356 TYR HD2 H N N 357 TYR HE1 H N N 358 TYR HE2 H N N 359 TYR HH H N N 360 TYR HXT H N N 361 VAL N N N N 362 VAL CA C N S 363 VAL C C N N 364 VAL O O N N 365 VAL CB C N N 366 VAL CG1 C N N 367 VAL CG2 C N N 368 VAL OXT O N N 369 VAL H H N N 370 VAL H2 H N N 371 VAL HA H N N 372 VAL HB H N N 373 VAL HG11 H N N 374 VAL HG12 H N N 375 VAL HG13 H N N 376 VAL HG21 H N N 377 VAL HG22 H N N 378 VAL HG23 H N N 379 VAL HXT H N N 380 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 EQT N3 N4 sing Y N 83 EQT N3 C2 doub Y N 84 EQT N4 C5 sing Y N 85 EQT C2 N1 sing N N 86 EQT C2 C11 sing Y N 87 EQT C5 C6 doub Y N 88 EQT C5 C11 sing Y N 89 EQT C6 C7 sing Y N 90 EQT C11 C9 doub Y N 91 EQT C7 C8 doub Y N 92 EQT C9 C8 sing Y N 93 EQT C9 CL1 sing N N 94 EQT N4 H12 sing N N 95 EQT C6 H15 sing N N 96 EQT C7 H16 sing N N 97 EQT C8 H17 sing N N 98 EQT N1 H14 sing N N 99 EQT N1 H13 sing N N 100 GLN N CA sing N N 101 GLN N H sing N N 102 GLN N H2 sing N N 103 GLN CA C sing N N 104 GLN CA CB sing N N 105 GLN CA HA sing N N 106 GLN C O doub N N 107 GLN C OXT sing N N 108 GLN CB CG sing N N 109 GLN CB HB2 sing N N 110 GLN CB HB3 sing N N 111 GLN CG CD sing N N 112 GLN CG HG2 sing N N 113 GLN CG HG3 sing N N 114 GLN CD OE1 doub N N 115 GLN CD NE2 sing N N 116 GLN NE2 HE21 sing N N 117 GLN NE2 HE22 sing N N 118 GLN OXT HXT sing N N 119 GLU N CA sing N N 120 GLU N H sing N N 121 GLU N H2 sing N N 122 GLU CA C sing N N 123 GLU CA CB sing N N 124 GLU CA HA sing N N 125 GLU C O doub N N 126 GLU C OXT sing N N 127 GLU CB CG sing N N 128 GLU CB HB2 sing N N 129 GLU CB HB3 sing N N 130 GLU CG CD sing N N 131 GLU CG HG2 sing N N 132 GLU CG HG3 sing N N 133 GLU CD OE1 doub N N 134 GLU CD OE2 sing N N 135 GLU OE2 HE2 sing N N 136 GLU OXT HXT sing N N 137 GLY N CA sing N N 138 GLY N H sing N N 139 GLY N H2 sing N N 140 GLY CA C sing N N 141 GLY CA HA2 sing N N 142 GLY CA HA3 sing N N 143 GLY C O doub N N 144 GLY C OXT sing N N 145 GLY OXT HXT sing N N 146 HIS N CA sing N N 147 HIS N H sing N N 148 HIS N H2 sing N N 149 HIS CA C sing N N 150 HIS CA CB sing N N 151 HIS CA HA sing N N 152 HIS C O doub N N 153 HIS C OXT sing N N 154 HIS CB CG sing N N 155 HIS CB HB2 sing N N 156 HIS CB HB3 sing N N 157 HIS CG ND1 sing Y N 158 HIS CG CD2 doub Y N 159 HIS ND1 CE1 doub Y N 160 HIS ND1 HD1 sing N N 161 HIS CD2 NE2 sing Y N 162 HIS CD2 HD2 sing N N 163 HIS CE1 NE2 sing Y N 164 HIS CE1 HE1 sing N N 165 HIS NE2 HE2 sing N N 166 HIS OXT HXT sing N N 167 HOH O H1 sing N N 168 HOH O H2 sing N N 169 ILE N CA sing N N 170 ILE N H sing N N 171 ILE N H2 sing N N 172 ILE CA C sing N N 173 ILE CA CB sing N N 174 ILE CA HA sing N N 175 ILE C O doub N N 176 ILE C OXT sing N N 177 ILE CB CG1 sing N N 178 ILE CB CG2 sing N N 179 ILE CB HB sing N N 180 ILE CG1 CD1 sing N N 181 ILE CG1 HG12 sing N N 182 ILE CG1 HG13 sing N N 183 ILE CG2 HG21 sing N N 184 ILE CG2 HG22 sing N N 185 ILE CG2 HG23 sing N N 186 ILE CD1 HD11 sing N N 187 ILE CD1 HD12 sing N N 188 ILE CD1 HD13 sing N N 189 ILE OXT HXT sing N N 190 LEU N CA sing N N 191 LEU N H sing N N 192 LEU N H2 sing N N 193 LEU CA C sing N N 194 LEU CA CB sing N N 195 LEU CA HA sing N N 196 LEU C O doub N N 197 LEU C OXT sing N N 198 LEU CB CG sing N N 199 LEU CB HB2 sing N N 200 LEU CB HB3 sing N N 201 LEU CG CD1 sing N N 202 LEU CG CD2 sing N N 203 LEU CG HG sing N N 204 LEU CD1 HD11 sing N N 205 LEU CD1 HD12 sing N N 206 LEU CD1 HD13 sing N N 207 LEU CD2 HD21 sing N N 208 LEU CD2 HD22 sing N N 209 LEU CD2 HD23 sing N N 210 LEU OXT HXT sing N N 211 LYS N CA sing N N 212 LYS N H sing N N 213 LYS N H2 sing N N 214 LYS CA C sing N N 215 LYS CA CB sing N N 216 LYS CA HA sing N N 217 LYS C O doub N N 218 LYS C OXT sing N N 219 LYS CB CG sing N N 220 LYS CB HB2 sing N N 221 LYS CB HB3 sing N N 222 LYS CG CD sing N N 223 LYS CG HG2 sing N N 224 LYS CG HG3 sing N N 225 LYS CD CE sing N N 226 LYS CD HD2 sing N N 227 LYS CD HD3 sing N N 228 LYS CE NZ sing N N 229 LYS CE HE2 sing N N 230 LYS CE HE3 sing N N 231 LYS NZ HZ1 sing N N 232 LYS NZ HZ2 sing N N 233 LYS NZ HZ3 sing N N 234 LYS OXT HXT sing N N 235 MET N CA sing N N 236 MET N H sing N N 237 MET N H2 sing N N 238 MET CA C sing N N 239 MET CA CB sing N N 240 MET CA HA sing N N 241 MET C O doub N N 242 MET C OXT sing N N 243 MET CB CG sing N N 244 MET CB HB2 sing N N 245 MET CB HB3 sing N N 246 MET CG SD sing N N 247 MET CG HG2 sing N N 248 MET CG HG3 sing N N 249 MET SD CE sing N N 250 MET CE HE1 sing N N 251 MET CE HE2 sing N N 252 MET CE HE3 sing N N 253 MET OXT HXT sing N N 254 PHE N CA sing N N 255 PHE N H sing N N 256 PHE N H2 sing N N 257 PHE CA C sing N N 258 PHE CA CB sing N N 259 PHE CA HA sing N N 260 PHE C O doub N N 261 PHE C OXT sing N N 262 PHE CB CG sing N N 263 PHE CB HB2 sing N N 264 PHE CB HB3 sing N N 265 PHE CG CD1 doub Y N 266 PHE CG CD2 sing Y N 267 PHE CD1 CE1 sing Y N 268 PHE CD1 HD1 sing N N 269 PHE CD2 CE2 doub Y N 270 PHE CD2 HD2 sing N N 271 PHE CE1 CZ doub Y N 272 PHE CE1 HE1 sing N N 273 PHE CE2 CZ sing Y N 274 PHE CE2 HE2 sing N N 275 PHE CZ HZ sing N N 276 PHE OXT HXT sing N N 277 PRO N CA sing N N 278 PRO N CD sing N N 279 PRO N H sing N N 280 PRO CA C sing N N 281 PRO CA CB sing N N 282 PRO CA HA sing N N 283 PRO C O doub N N 284 PRO C OXT sing N N 285 PRO CB CG sing N N 286 PRO CB HB2 sing N N 287 PRO CB HB3 sing N N 288 PRO CG CD sing N N 289 PRO CG HG2 sing N N 290 PRO CG HG3 sing N N 291 PRO CD HD2 sing N N 292 PRO CD HD3 sing N N 293 PRO OXT HXT sing N N 294 SER N CA sing N N 295 SER N H sing N N 296 SER N H2 sing N N 297 SER CA C sing N N 298 SER CA CB sing N N 299 SER CA HA sing N N 300 SER C O doub N N 301 SER C OXT sing N N 302 SER CB OG sing N N 303 SER CB HB2 sing N N 304 SER CB HB3 sing N N 305 SER OG HG sing N N 306 SER OXT HXT sing N N 307 THR N CA sing N N 308 THR N H sing N N 309 THR N H2 sing N N 310 THR CA C sing N N 311 THR CA CB sing N N 312 THR CA HA sing N N 313 THR C O doub N N 314 THR C OXT sing N N 315 THR CB OG1 sing N N 316 THR CB CG2 sing N N 317 THR CB HB sing N N 318 THR OG1 HG1 sing N N 319 THR CG2 HG21 sing N N 320 THR CG2 HG22 sing N N 321 THR CG2 HG23 sing N N 322 THR OXT HXT sing N N 323 TYR N CA sing N N 324 TYR N H sing N N 325 TYR N H2 sing N N 326 TYR CA C sing N N 327 TYR CA CB sing N N 328 TYR CA HA sing N N 329 TYR C O doub N N 330 TYR C OXT sing N N 331 TYR CB CG sing N N 332 TYR CB HB2 sing N N 333 TYR CB HB3 sing N N 334 TYR CG CD1 doub Y N 335 TYR CG CD2 sing Y N 336 TYR CD1 CE1 sing Y N 337 TYR CD1 HD1 sing N N 338 TYR CD2 CE2 doub Y N 339 TYR CD2 HD2 sing N N 340 TYR CE1 CZ doub Y N 341 TYR CE1 HE1 sing N N 342 TYR CE2 CZ sing Y N 343 TYR CE2 HE2 sing N N 344 TYR CZ OH sing N N 345 TYR OH HH sing N N 346 TYR OXT HXT sing N N 347 VAL N CA sing N N 348 VAL N H sing N N 349 VAL N H2 sing N N 350 VAL CA C sing N N 351 VAL CA CB sing N N 352 VAL CA HA sing N N 353 VAL C O doub N N 354 VAL C OXT sing N N 355 VAL CB CG1 sing N N 356 VAL CB CG2 sing N N 357 VAL CB HB sing N N 358 VAL CG1 HG11 sing N N 359 VAL CG1 HG12 sing N N 360 VAL CG1 HG13 sing N N 361 VAL CG2 HG21 sing N N 362 VAL CG2 HG22 sing N N 363 VAL CG2 HG23 sing N N 364 VAL OXT HXT sing N N 365 # _pdbx_audit_support.funding_organization 'Not funded' _pdbx_audit_support.country ? _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id EQT _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id EQT _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 8A55 _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 8RF4 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 0.027058 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.027058 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.007065 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C CL N O S # loop_