data_8RJX # _entry.id 8RJX # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.395 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 8RJX pdb_00008rjx 10.2210/pdb8rjx/pdb WWPDB D_1292135325 ? ? BMRB 34889 ? 10.13018/BMR34889 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2024-07-03 2 'Structure model' 1 1 2024-07-17 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_audit_revision_group.ordinal 1 _pdbx_audit_revision_group.revision_ordinal 2 _pdbx_audit_revision_group.data_content_type 'Structure model' _pdbx_audit_revision_group.group 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_volume' 2 2 'Structure model' '_citation.title' 3 2 'Structure model' '_citation_author.name' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr . _pdbx_database_status.entry_id 8RJX _pdbx_database_status.recvd_initial_deposition_date 2023-12-22 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs . _pdbx_database_status.status_code_nmr_data REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_database_related.db_name BMRB _pdbx_database_related.details 'Solution structure of osmoregulator OsmY from E. coli.' _pdbx_database_related.db_id 34889 _pdbx_database_related.content_type unspecified # _pdbx_contact_author.id 2 _pdbx_contact_author.email h.vaningen@uu.nl _pdbx_contact_author.name_first Hugo _pdbx_contact_author.name_last 'van Ingen' _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-0808-3811 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Iyer, A.' 1 ? 'Luo, Y.' 2 ? 'le Paige, U.B.A.' 3 ? 'van Ingen, H.' 4 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev J.Mol.Biol. _citation.journal_id_ASTM JMOBAK _citation.journal_id_CSD 0070 _citation.journal_id_ISSN 1089-8638 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 436 _citation.language ? _citation.page_first 168668 _citation.page_last 168668 _citation.title 'The Structure and Function of the Bacterial Osmotically Inducible Protein Y.' _citation.year 2024 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1016/j.jmb.2024.168668 _citation.pdbx_database_id_PubMed 38908784 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Iyer, A.' 1 ? primary 'Frallicciardi, J.' 2 ? primary 'le Paige, U.B.A.' 3 ? primary 'Narasimhan, S.' 4 ? primary 'Luo, Y.' 5 ? primary 'Sieiro, P.A.' 6 ? primary 'Syga, L.' 7 ? primary 'van den Brekel, F.' 8 ? primary 'Tran, B.M.' 9 ? primary 'Tjioe, R.' 10 ? primary 'Schuurman-Wolters, G.' 11 ? primary 'Stuart, M.C.A.' 12 ? primary 'Baldus, M.' 13 ? primary 'van Ingen, H.' 14 ? primary 'Poolman, B.' 15 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Osmotically-inducible protein Y' _entity.formula_weight 19187.184 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;ENNAQTTNESAGQKVDSSMNKVGNFMDDSAITAKVKAALVDHDNIKSTDISVKTDQKVVTLSGFVESQAQAEEAVKVAKG VEGVTSVSDKLHVRDAKEGSVKGYAGDTATTSEIKAKLLADDIVPSRHVKVETTDGVVQLSGTVDSQAQSDRAESIAKAV DGVKSVKNDLKTKGGGHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;ENNAQTTNESAGQKVDSSMNKVGNFMDDSAITAKVKAALVDHDNIKSTDISVKTDQKVVTLSGFVESQAQAEEAVKVAKG VEGVTSVSDKLHVRDAKEGSVKGYAGDTATTSEIKAKLLADDIVPSRHVKVETTDGVVQLSGTVDSQAQSDRAESIAKAV DGVKSVKNDLKTKGGGHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLU n 1 2 ASN n 1 3 ASN n 1 4 ALA n 1 5 GLN n 1 6 THR n 1 7 THR n 1 8 ASN n 1 9 GLU n 1 10 SER n 1 11 ALA n 1 12 GLY n 1 13 GLN n 1 14 LYS n 1 15 VAL n 1 16 ASP n 1 17 SER n 1 18 SER n 1 19 MET n 1 20 ASN n 1 21 LYS n 1 22 VAL n 1 23 GLY n 1 24 ASN n 1 25 PHE n 1 26 MET n 1 27 ASP n 1 28 ASP n 1 29 SER n 1 30 ALA n 1 31 ILE n 1 32 THR n 1 33 ALA n 1 34 LYS n 1 35 VAL n 1 36 LYS n 1 37 ALA n 1 38 ALA n 1 39 LEU n 1 40 VAL n 1 41 ASP n 1 42 HIS n 1 43 ASP n 1 44 ASN n 1 45 ILE n 1 46 LYS n 1 47 SER n 1 48 THR n 1 49 ASP n 1 50 ILE n 1 51 SER n 1 52 VAL n 1 53 LYS n 1 54 THR n 1 55 ASP n 1 56 GLN n 1 57 LYS n 1 58 VAL n 1 59 VAL n 1 60 THR n 1 61 LEU n 1 62 SER n 1 63 GLY n 1 64 PHE n 1 65 VAL n 1 66 GLU n 1 67 SER n 1 68 GLN n 1 69 ALA n 1 70 GLN n 1 71 ALA n 1 72 GLU n 1 73 GLU n 1 74 ALA n 1 75 VAL n 1 76 LYS n 1 77 VAL n 1 78 ALA n 1 79 LYS n 1 80 GLY n 1 81 VAL n 1 82 GLU n 1 83 GLY n 1 84 VAL n 1 85 THR n 1 86 SER n 1 87 VAL n 1 88 SER n 1 89 ASP n 1 90 LYS n 1 91 LEU n 1 92 HIS n 1 93 VAL n 1 94 ARG n 1 95 ASP n 1 96 ALA n 1 97 LYS n 1 98 GLU n 1 99 GLY n 1 100 SER n 1 101 VAL n 1 102 LYS n 1 103 GLY n 1 104 TYR n 1 105 ALA n 1 106 GLY n 1 107 ASP n 1 108 THR n 1 109 ALA n 1 110 THR n 1 111 THR n 1 112 SER n 1 113 GLU n 1 114 ILE n 1 115 LYS n 1 116 ALA n 1 117 LYS n 1 118 LEU n 1 119 LEU n 1 120 ALA n 1 121 ASP n 1 122 ASP n 1 123 ILE n 1 124 VAL n 1 125 PRO n 1 126 SER n 1 127 ARG n 1 128 HIS n 1 129 VAL n 1 130 LYS n 1 131 VAL n 1 132 GLU n 1 133 THR n 1 134 THR n 1 135 ASP n 1 136 GLY n 1 137 VAL n 1 138 VAL n 1 139 GLN n 1 140 LEU n 1 141 SER n 1 142 GLY n 1 143 THR n 1 144 VAL n 1 145 ASP n 1 146 SER n 1 147 GLN n 1 148 ALA n 1 149 GLN n 1 150 SER n 1 151 ASP n 1 152 ARG n 1 153 ALA n 1 154 GLU n 1 155 SER n 1 156 ILE n 1 157 ALA n 1 158 LYS n 1 159 ALA n 1 160 VAL n 1 161 ASP n 1 162 GLY n 1 163 VAL n 1 164 LYS n 1 165 SER n 1 166 VAL n 1 167 LYS n 1 168 ASN n 1 169 ASP n 1 170 LEU n 1 171 LYS n 1 172 THR n 1 173 LYS n 1 174 GLY n 1 175 GLY n 1 176 GLY n 1 177 HIS n 1 178 HIS n 1 179 HIS n 1 180 HIS n 1 181 HIS n 1 182 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 182 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'osmY, b4376, JW4338' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 562 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLU 1 1 1 GLU GLU A . n A 1 2 ASN 2 2 2 ASN ASN A . n A 1 3 ASN 3 3 3 ASN ASN A . n A 1 4 ALA 4 4 4 ALA ALA A . n A 1 5 GLN 5 5 5 GLN GLN A . n A 1 6 THR 6 6 6 THR THR A . n A 1 7 THR 7 7 7 THR THR A . n A 1 8 ASN 8 8 8 ASN ASN A . n A 1 9 GLU 9 9 9 GLU GLU A . n A 1 10 SER 10 10 10 SER SER A . n A 1 11 ALA 11 11 11 ALA ALA A . n A 1 12 GLY 12 12 12 GLY GLY A . n A 1 13 GLN 13 13 13 GLN GLN A . n A 1 14 LYS 14 14 14 LYS LYS A . n A 1 15 VAL 15 15 15 VAL VAL A . n A 1 16 ASP 16 16 16 ASP ASP A . n A 1 17 SER 17 17 17 SER SER A . n A 1 18 SER 18 18 18 SER SER A . n A 1 19 MET 19 19 19 MET MET A . n A 1 20 ASN 20 20 20 ASN ASN A . n A 1 21 LYS 21 21 21 LYS LYS A . n A 1 22 VAL 22 22 22 VAL VAL A . n A 1 23 GLY 23 23 23 GLY GLY A . n A 1 24 ASN 24 24 24 ASN ASN A . n A 1 25 PHE 25 25 25 PHE PHE A . n A 1 26 MET 26 26 26 MET MET A . n A 1 27 ASP 27 27 27 ASP ASP A . n A 1 28 ASP 28 28 28 ASP ASP A . n A 1 29 SER 29 29 29 SER SER A . n A 1 30 ALA 30 30 30 ALA ALA A . n A 1 31 ILE 31 31 31 ILE ILE A . n A 1 32 THR 32 32 32 THR THR A . n A 1 33 ALA 33 33 33 ALA ALA A . n A 1 34 LYS 34 34 34 LYS LYS A . n A 1 35 VAL 35 35 35 VAL VAL A . n A 1 36 LYS 36 36 36 LYS LYS A . n A 1 37 ALA 37 37 37 ALA ALA A . n A 1 38 ALA 38 38 38 ALA ALA A . n A 1 39 LEU 39 39 39 LEU LEU A . n A 1 40 VAL 40 40 40 VAL VAL A . n A 1 41 ASP 41 41 41 ASP ASP A . n A 1 42 HIS 42 42 42 HIS HIS A . n A 1 43 ASP 43 43 43 ASP ASP A . n A 1 44 ASN 44 44 44 ASN ASN A . n A 1 45 ILE 45 45 45 ILE ILE A . n A 1 46 LYS 46 46 46 LYS LYS A . n A 1 47 SER 47 47 47 SER SER A . n A 1 48 THR 48 48 48 THR THR A . n A 1 49 ASP 49 49 49 ASP ASP A . n A 1 50 ILE 50 50 50 ILE ILE A . n A 1 51 SER 51 51 51 SER SER A . n A 1 52 VAL 52 52 52 VAL VAL A . n A 1 53 LYS 53 53 53 LYS LYS A . n A 1 54 THR 54 54 54 THR THR A . n A 1 55 ASP 55 55 55 ASP ASP A . n A 1 56 GLN 56 56 56 GLN GLN A . n A 1 57 LYS 57 57 57 LYS LYS A . n A 1 58 VAL 58 58 58 VAL VAL A . n A 1 59 VAL 59 59 59 VAL VAL A . n A 1 60 THR 60 60 60 THR THR A . n A 1 61 LEU 61 61 61 LEU LEU A . n A 1 62 SER 62 62 62 SER SER A . n A 1 63 GLY 63 63 63 GLY GLY A . n A 1 64 PHE 64 64 64 PHE PHE A . n A 1 65 VAL 65 65 65 VAL VAL A . n A 1 66 GLU 66 66 66 GLU GLU A . n A 1 67 SER 67 67 67 SER SER A . n A 1 68 GLN 68 68 68 GLN GLN A . n A 1 69 ALA 69 69 69 ALA ALA A . n A 1 70 GLN 70 70 70 GLN GLN A . n A 1 71 ALA 71 71 71 ALA ALA A . n A 1 72 GLU 72 72 72 GLU GLU A . n A 1 73 GLU 73 73 73 GLU GLU A . n A 1 74 ALA 74 74 74 ALA ALA A . n A 1 75 VAL 75 75 75 VAL VAL A . n A 1 76 LYS 76 76 76 LYS LYS A . n A 1 77 VAL 77 77 77 VAL VAL A . n A 1 78 ALA 78 78 78 ALA ALA A . n A 1 79 LYS 79 79 79 LYS LYS A . n A 1 80 GLY 80 80 80 GLY GLY A . n A 1 81 VAL 81 81 81 VAL VAL A . n A 1 82 GLU 82 82 82 GLU GLU A . n A 1 83 GLY 83 83 83 GLY GLY A . n A 1 84 VAL 84 84 84 VAL VAL A . n A 1 85 THR 85 85 85 THR THR A . n A 1 86 SER 86 86 86 SER SER A . n A 1 87 VAL 87 87 87 VAL VAL A . n A 1 88 SER 88 88 88 SER SER A . n A 1 89 ASP 89 89 89 ASP ASP A . n A 1 90 LYS 90 90 90 LYS LYS A . n A 1 91 LEU 91 91 91 LEU LEU A . n A 1 92 HIS 92 92 92 HIS HIS A . n A 1 93 VAL 93 93 93 VAL VAL A . n A 1 94 ARG 94 94 94 ARG ARG A . n A 1 95 ASP 95 95 95 ASP ASP A . n A 1 96 ALA 96 96 96 ALA ALA A . n A 1 97 LYS 97 97 97 LYS LYS A . n A 1 98 GLU 98 98 98 GLU GLU A . n A 1 99 GLY 99 99 99 GLY GLY A . n A 1 100 SER 100 100 100 SER SER A . n A 1 101 VAL 101 101 101 VAL VAL A . n A 1 102 LYS 102 102 102 LYS LYS A . n A 1 103 GLY 103 103 103 GLY GLY A . n A 1 104 TYR 104 104 104 TYR TYR A . n A 1 105 ALA 105 105 105 ALA ALA A . n A 1 106 GLY 106 106 106 GLY GLY A . n A 1 107 ASP 107 107 107 ASP ASP A . n A 1 108 THR 108 108 108 THR THR A . n A 1 109 ALA 109 109 109 ALA ALA A . n A 1 110 THR 110 110 110 THR THR A . n A 1 111 THR 111 111 111 THR THR A . n A 1 112 SER 112 112 112 SER SER A . n A 1 113 GLU 113 113 113 GLU GLU A . n A 1 114 ILE 114 114 114 ILE ILE A . n A 1 115 LYS 115 115 115 LYS LYS A . n A 1 116 ALA 116 116 116 ALA ALA A . n A 1 117 LYS 117 117 117 LYS LYS A . n A 1 118 LEU 118 118 118 LEU LEU A . n A 1 119 LEU 119 119 119 LEU LEU A . n A 1 120 ALA 120 120 120 ALA ALA A . n A 1 121 ASP 121 121 121 ASP ASP A . n A 1 122 ASP 122 122 122 ASP ASP A . n A 1 123 ILE 123 123 123 ILE ILE A . n A 1 124 VAL 124 124 124 VAL VAL A . n A 1 125 PRO 125 125 125 PRO PRO A . n A 1 126 SER 126 126 126 SER SER A . n A 1 127 ARG 127 127 127 ARG ARG A . n A 1 128 HIS 128 128 128 HIS HIS A . n A 1 129 VAL 129 129 129 VAL VAL A . n A 1 130 LYS 130 130 130 LYS LYS A . n A 1 131 VAL 131 131 131 VAL VAL A . n A 1 132 GLU 132 132 132 GLU GLU A . n A 1 133 THR 133 133 133 THR THR A . n A 1 134 THR 134 134 134 THR THR A . n A 1 135 ASP 135 135 135 ASP ASP A . n A 1 136 GLY 136 136 136 GLY GLY A . n A 1 137 VAL 137 137 137 VAL VAL A . n A 1 138 VAL 138 138 138 VAL VAL A . n A 1 139 GLN 139 139 139 GLN GLN A . n A 1 140 LEU 140 140 140 LEU LEU A . n A 1 141 SER 141 141 141 SER SER A . n A 1 142 GLY 142 142 142 GLY GLY A . n A 1 143 THR 143 143 143 THR THR A . n A 1 144 VAL 144 144 144 VAL VAL A . n A 1 145 ASP 145 145 145 ASP ASP A . n A 1 146 SER 146 146 146 SER SER A . n A 1 147 GLN 147 147 147 GLN GLN A . n A 1 148 ALA 148 148 148 ALA ALA A . n A 1 149 GLN 149 149 149 GLN GLN A . n A 1 150 SER 150 150 150 SER SER A . n A 1 151 ASP 151 151 151 ASP ASP A . n A 1 152 ARG 152 152 152 ARG ARG A . n A 1 153 ALA 153 153 153 ALA ALA A . n A 1 154 GLU 154 154 154 GLU GLU A . n A 1 155 SER 155 155 155 SER SER A . n A 1 156 ILE 156 156 156 ILE ILE A . n A 1 157 ALA 157 157 157 ALA ALA A . n A 1 158 LYS 158 158 158 LYS LYS A . n A 1 159 ALA 159 159 159 ALA ALA A . n A 1 160 VAL 160 160 160 VAL VAL A . n A 1 161 ASP 161 161 161 ASP ASP A . n A 1 162 GLY 162 162 162 GLY GLY A . n A 1 163 VAL 163 163 163 VAL VAL A . n A 1 164 LYS 164 164 164 LYS LYS A . n A 1 165 SER 165 165 165 SER SER A . n A 1 166 VAL 166 166 166 VAL VAL A . n A 1 167 LYS 167 167 167 LYS LYS A . n A 1 168 ASN 168 168 168 ASN ASN A . n A 1 169 ASP 169 169 169 ASP ASP A . n A 1 170 LEU 170 170 170 LEU LEU A . n A 1 171 LYS 171 171 171 LYS LYS A . n A 1 172 THR 172 172 172 THR THR A . n A 1 173 LYS 173 173 173 LYS LYS A . n A 1 174 GLY 174 174 ? ? ? A . n A 1 175 GLY 175 175 ? ? ? A . n A 1 176 GLY 176 176 ? ? ? A . n A 1 177 HIS 177 177 ? ? ? A . n A 1 178 HIS 178 178 ? ? ? A . n A 1 179 HIS 179 179 ? ? ? A . n A 1 180 HIS 180 180 ? ? ? A . n A 1 181 HIS 181 181 ? ? ? A . n A 1 182 HIS 182 182 ? ? ? A . n # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 8RJX _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 8RJX _struct.title 'Solution structure of osmoregulator OsmY from E. coli.' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 8RJX _struct_keywords.text 'osmoregulatory protein bacterial protein, TRANSPORT PROTEIN' _struct_keywords.pdbx_keywords 'TRANSPORT PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code OSMY_ECOLI _struct_ref.pdbx_db_accession P0AFH8 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;ENNAQTTNESAGQKVDSSMNKVGNFMDDSAITAKVKAALVDHDNIKSTDISVKTDQKVVTLSGFVESQAQAEEAVKVAKG VEGVTSVSDKLHVRDAKEGSVKGYAGDTATTSEIKAKLLADDIVPSRHVKVETTDGVVQLSGTVDSQAQSDRAESIAKAV DGVKSVKNDLKTK ; _struct_ref.pdbx_align_begin 29 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 8RJX _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 173 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P0AFH8 _struct_ref_seq.db_align_beg 29 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 201 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 173 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 8RJX GLY A 174 ? UNP P0AFH8 ? ? 'expression tag' 174 1 1 8RJX GLY A 175 ? UNP P0AFH8 ? ? 'expression tag' 175 2 1 8RJX GLY A 176 ? UNP P0AFH8 ? ? 'expression tag' 176 3 1 8RJX HIS A 177 ? UNP P0AFH8 ? ? 'expression tag' 177 4 1 8RJX HIS A 178 ? UNP P0AFH8 ? ? 'expression tag' 178 5 1 8RJX HIS A 179 ? UNP P0AFH8 ? ? 'expression tag' 179 6 1 8RJX HIS A 180 ? UNP P0AFH8 ? ? 'expression tag' 180 7 1 8RJX HIS A 181 ? UNP P0AFH8 ? ? 'expression tag' 181 8 1 8RJX HIS A 182 ? UNP P0AFH8 ? ? 'expression tag' 182 9 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'NMR Distance Restraints' _pdbx_struct_assembly_auth_evidence.details 'not applicable' # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0 _pdbx_struct_oper_list.matrix[1][2] 0.0 _pdbx_struct_oper_list.matrix[1][3] 0.0 _pdbx_struct_oper_list.vector[1] 0.0 _pdbx_struct_oper_list.matrix[2][1] 0.0 _pdbx_struct_oper_list.matrix[2][2] 1.0 _pdbx_struct_oper_list.matrix[2][3] 0.0 _pdbx_struct_oper_list.vector[2] 0.0 _pdbx_struct_oper_list.matrix[3][1] 0.0 _pdbx_struct_oper_list.matrix[3][2] 0.0 _pdbx_struct_oper_list.matrix[3][3] 1.0 _pdbx_struct_oper_list.vector[3] 0.0 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASP A 28 ? HIS A 42 ? ASP A 28 HIS A 42 1 ? 15 HELX_P HELX_P2 AA2 LYS A 46 ? THR A 48 ? LYS A 46 THR A 48 5 ? 3 HELX_P HELX_P3 AA3 SER A 67 ? LYS A 79 ? SER A 67 LYS A 79 1 ? 13 HELX_P HELX_P4 AA4 ASP A 107 ? LEU A 119 ? ASP A 107 LEU A 119 1 ? 13 HELX_P HELX_P5 AA5 SER A 146 ? VAL A 160 ? SER A 146 VAL A 160 1 ? 15 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 3 ? AA2 ? 3 ? AA3 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? parallel AA2 1 2 ? anti-parallel AA2 2 3 ? parallel AA3 1 2 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ILE A 50 ? ASP A 55 ? ILE A 50 ASP A 55 AA1 2 VAL A 58 ? VAL A 65 ? VAL A 58 VAL A 65 AA1 3 SER A 86 ? VAL A 93 ? SER A 86 VAL A 93 AA2 1 LYS A 130 ? THR A 134 ? LYS A 130 THR A 134 AA2 2 VAL A 137 ? SER A 141 ? VAL A 137 SER A 141 AA2 3 SER A 165 ? ASN A 168 ? SER A 165 ASN A 168 AA3 1 THR A 143 ? VAL A 144 ? THR A 143 VAL A 144 AA3 2 LYS A 171 ? THR A 172 ? LYS A 171 THR A 172 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N LYS A 53 ? N LYS A 53 O THR A 60 ? O THR A 60 AA1 2 3 N LEU A 61 ? N LEU A 61 O LYS A 90 ? O LYS A 90 AA2 1 2 N GLU A 132 ? N GLU A 132 O GLN A 139 ? O GLN A 139 AA2 2 3 N VAL A 138 ? N VAL A 138 O LYS A 167 ? O LYS A 167 AA3 1 2 N VAL A 144 ? N VAL A 144 O LYS A 171 ? O LYS A 171 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 OE2 A GLU 73 ? ? HZ1 A LYS 76 ? ? 1.50 2 1 HZ2 A LYS 46 ? ? OD1 A ASP 49 ? ? 1.53 3 1 OE2 A GLU 154 ? ? HZ1 A LYS 158 ? ? 1.53 4 1 OD2 A ASP 121 ? ? H A VAL 124 ? ? 1.54 5 1 OD1 A ASP 27 ? ? HZ2 A LYS 57 ? ? 1.59 6 2 OE1 A GLU 113 ? ? HZ2 A LYS 117 ? ? 1.54 7 3 OE2 A GLU 113 ? ? HZ3 A LYS 117 ? ? 1.53 8 4 OE2 A GLU 113 ? ? HZ3 A LYS 117 ? ? 1.59 9 4 OE1 A GLN 68 ? ? HZ2 A LYS 97 ? ? 1.60 10 5 OD2 A ASP 27 ? ? HZ1 A LYS 57 ? ? 1.50 11 5 OE1 A GLU 72 ? ? HZ1 A LYS 76 ? ? 1.51 12 5 HH21 A ARG 94 ? ? OD1 A ASP 95 ? ? 1.54 13 5 OD2 A ASP 121 ? ? H A VAL 124 ? ? 1.56 14 5 OE1 A GLU 154 ? ? HZ2 A LYS 158 ? ? 1.57 15 6 OE1 A GLU 113 ? ? HZ3 A LYS 117 ? ? 1.48 16 6 OE2 A GLU 72 ? ? HZ2 A LYS 76 ? ? 1.49 17 6 HZ3 A LYS 46 ? ? OE1 A GLU 66 ? ? 1.58 18 6 OD1 A ASP 27 ? ? HZ1 A LYS 57 ? ? 1.59 19 7 OD2 A ASP 27 ? ? HZ2 A LYS 57 ? ? 1.51 20 8 OE1 A GLU 113 ? ? HZ1 A LYS 117 ? ? 1.57 21 8 HZ2 A LYS 46 ? ? OD1 A ASP 49 ? ? 1.57 22 8 OD2 A ASP 145 ? ? HZ2 A LYS 173 ? ? 1.60 23 9 OE2 A GLU 154 ? ? HZ1 A LYS 158 ? ? 1.51 24 9 OD1 A ASP 16 ? ? HG A SER 18 ? ? 1.52 25 9 OD2 A ASP 27 ? ? HZ3 A LYS 57 ? ? 1.57 26 9 OD1 A ASP 28 ? ? H A LYS 57 ? ? 1.57 27 10 OE2 A GLU 98 ? ? HZ1 A LYS 102 ? ? 1.56 28 10 HH11 A ARG 94 ? ? OD1 A ASP 95 ? ? 1.60 29 11 OD2 A ASP 27 ? ? HZ3 A LYS 57 ? ? 1.59 30 12 OE1 A GLU 113 ? ? HZ3 A LYS 117 ? ? 1.55 31 12 HH11 A ARG 94 ? ? OD2 A ASP 95 ? ? 1.55 32 13 HZ1 A LYS 46 ? ? OD2 A ASP 49 ? ? 1.55 33 13 O A ASP 151 ? ? H A SER 155 ? ? 1.59 34 14 OE2 A GLU 113 ? ? HZ1 A LYS 117 ? ? 1.55 35 15 OE2 A GLU 113 ? ? HZ3 A LYS 117 ? ? 1.55 36 15 OD2 A ASP 107 ? ? HG1 A THR 110 ? ? 1.59 37 16 OD1 A ASP 28 ? ? H A LYS 57 ? ? 1.46 38 16 HH22 A ARG 94 ? ? OD2 A ASP 95 ? ? 1.55 39 16 OD2 A ASP 121 ? ? HE A ARG 152 ? ? 1.58 40 16 OE2 A GLU 73 ? ? HZ1 A LYS 76 ? ? 1.59 41 16 OD2 A ASP 27 ? ? HZ1 A LYS 57 ? ? 1.60 42 18 OE2 A GLU 154 ? ? HZ2 A LYS 158 ? ? 1.52 43 18 OD1 A ASP 27 ? ? HZ3 A LYS 57 ? ? 1.52 44 19 OE1 A GLU 113 ? ? HZ3 A LYS 117 ? ? 1.51 45 20 HZ1 A LYS 46 ? ? OE2 A GLU 66 ? ? 1.50 46 20 OE2 A GLU 1 ? ? H A ASN 2 ? ? 1.56 47 20 OE1 A GLU 9 ? ? H A SER 10 ? ? 1.57 48 20 HZ3 A LYS 34 ? ? O A GLU 82 ? ? 1.58 49 20 OE2 A GLU 1 ? ? HD21 A ASN 2 ? ? 1.58 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ALA A 4 ? ? -127.94 -52.99 2 1 GLN A 5 ? ? 63.43 -165.72 3 1 SER A 17 ? ? -159.85 74.21 4 1 MET A 26 ? ? -153.20 80.57 5 1 ASP A 27 ? ? -127.54 -69.25 6 1 GLU A 98 ? ? -107.10 -162.38 7 1 VAL A 124 ? ? -58.62 109.27 8 2 THR A 6 ? ? -162.38 115.80 9 2 SER A 10 ? ? -100.02 61.70 10 2 ASN A 20 ? ? -165.35 -58.60 11 2 LYS A 21 ? ? 56.32 81.84 12 2 PHE A 25 ? ? -148.77 -64.81 13 2 ASP A 27 ? ? 74.03 -66.13 14 2 ALA A 96 ? ? -65.77 -72.06 15 2 LYS A 97 ? ? 62.60 -81.09 16 3 ASN A 2 ? ? -127.60 -59.54 17 3 ASN A 3 ? ? 179.30 -12.59 18 3 THR A 6 ? ? 68.44 94.09 19 3 GLU A 9 ? ? -110.00 -165.03 20 3 ASN A 24 ? ? -145.82 -159.91 21 3 ASP A 27 ? ? -95.47 -78.84 22 3 LYS A 97 ? ? -63.48 79.54 23 3 LYS A 102 ? ? -158.99 79.59 24 3 VAL A 124 ? ? -57.29 109.21 25 4 THR A 6 ? ? -127.33 -75.05 26 4 ASN A 8 ? ? -155.77 11.05 27 4 GLN A 13 ? ? -107.55 -161.63 28 4 SER A 17 ? ? -119.38 -75.96 29 4 SER A 18 ? ? 67.10 101.86 30 4 ASN A 20 ? ? -170.50 144.57 31 4 PHE A 25 ? ? -152.38 -63.51 32 4 MET A 26 ? ? -160.27 66.81 33 4 ASP A 27 ? ? -90.42 -82.11 34 4 LYS A 97 ? ? -92.04 46.37 35 4 SER A 100 ? ? -130.81 -66.10 36 4 VAL A 101 ? ? 66.69 100.01 37 4 ALA A 105 ? ? -141.11 -87.14 38 4 VAL A 124 ? ? -57.51 109.96 39 5 SER A 10 ? ? -161.27 113.68 40 5 ALA A 11 ? ? -163.33 -96.24 41 5 PHE A 25 ? ? -163.07 -65.17 42 5 ASP A 27 ? ? 73.80 -59.39 43 5 GLU A 98 ? ? -99.22 -70.00 44 5 ASP A 107 ? ? -80.72 49.38 45 6 LYS A 21 ? ? -179.52 -45.47 46 6 PHE A 25 ? ? -85.53 49.84 47 6 MET A 26 ? ? -164.38 109.56 48 6 GLU A 98 ? ? 58.10 -159.17 49 6 ALA A 105 ? ? -72.24 -76.68 50 6 VAL A 124 ? ? -55.35 109.65 51 7 ASN A 2 ? ? 62.81 -165.46 52 7 ASN A 8 ? ? 73.76 176.06 53 7 SER A 10 ? ? 51.66 75.84 54 7 GLN A 13 ? ? 68.67 113.32 55 7 ASN A 24 ? ? 55.93 -139.65 56 7 PHE A 25 ? ? -114.11 -83.73 57 7 MET A 26 ? ? -156.90 38.73 58 7 ASP A 27 ? ? -105.05 -75.15 59 7 GLU A 98 ? ? -111.56 -101.07 60 7 ALA A 105 ? ? -94.37 -94.27 61 8 ASN A 2 ? ? 62.91 78.36 62 8 ALA A 11 ? ? -139.90 -32.68 63 8 SER A 17 ? ? -157.16 62.60 64 8 MET A 19 ? ? 62.84 -169.21 65 8 ASP A 27 ? ? -105.64 -80.86 66 8 GLU A 98 ? ? 46.20 -139.00 67 8 LYS A 102 ? ? -169.33 -62.18 68 9 GLU A 9 ? ? -99.52 46.96 69 9 SER A 10 ? ? -94.35 59.18 70 9 SER A 17 ? ? -107.08 53.75 71 9 ASN A 24 ? ? -108.08 -70.01 72 9 PHE A 25 ? ? 60.94 -155.01 73 9 ASP A 27 ? ? -74.45 -82.31 74 9 LYS A 97 ? ? -99.40 51.61 75 9 ASP A 107 ? ? -141.78 -35.22 76 9 VAL A 124 ? ? -56.51 109.14 77 10 GLU A 9 ? ? -117.27 -160.30 78 10 MET A 19 ? ? -93.92 -154.50 79 10 VAL A 22 ? ? 78.20 129.17 80 10 ASN A 24 ? ? 64.62 -162.20 81 10 PHE A 25 ? ? 58.05 -136.57 82 10 MET A 26 ? ? -177.98 87.39 83 10 ASP A 27 ? ? -106.53 -72.75 84 10 ALA A 96 ? ? 64.67 -167.81 85 10 ALA A 105 ? ? -87.86 -81.09 86 11 ALA A 4 ? ? -176.13 -44.63 87 11 GLN A 5 ? ? 66.86 -154.65 88 11 GLU A 9 ? ? -122.63 -168.82 89 11 ALA A 11 ? ? -80.65 -76.38 90 11 ASN A 24 ? ? -174.91 -76.05 91 11 PHE A 25 ? ? 58.75 71.57 92 11 ASP A 27 ? ? -102.44 -85.94 93 11 VAL A 101 ? ? 70.54 96.58 94 11 ALA A 105 ? ? 76.22 138.86 95 11 VAL A 124 ? ? -59.62 109.58 96 12 SER A 10 ? ? -172.04 87.69 97 12 SER A 17 ? ? -164.19 89.16 98 12 ASN A 24 ? ? 58.79 -141.62 99 12 MET A 26 ? ? -128.52 -80.38 100 12 ASP A 27 ? ? 68.47 -89.88 101 12 GLU A 98 ? ? 66.06 85.73 102 12 VAL A 124 ? ? -57.34 108.77 103 13 ALA A 4 ? ? 61.63 63.13 104 13 SER A 10 ? ? -163.13 119.06 105 13 GLN A 13 ? ? -136.07 -47.66 106 13 LYS A 14 ? ? 65.46 94.52 107 13 VAL A 15 ? ? -107.26 73.36 108 13 SER A 17 ? ? -103.41 -63.69 109 13 SER A 18 ? ? 70.96 173.38 110 13 ASN A 24 ? ? -168.17 -58.96 111 13 MET A 26 ? ? -105.25 -71.37 112 13 ASP A 27 ? ? 59.42 -100.23 113 13 ASP A 107 ? ? -105.50 53.35 114 13 THR A 108 ? ? -48.98 -18.49 115 13 VAL A 124 ? ? -59.43 109.21 116 14 THR A 7 ? ? -162.59 92.05 117 14 SER A 17 ? ? -151.27 20.85 118 14 ASN A 20 ? ? -155.84 -71.29 119 14 LYS A 21 ? ? 61.37 75.18 120 14 PHE A 25 ? ? -140.38 20.38 121 14 ASP A 27 ? ? -115.70 -83.55 122 15 ASN A 3 ? ? -173.42 144.87 123 15 ASN A 8 ? ? -169.39 85.53 124 15 SER A 17 ? ? -157.01 62.59 125 15 PHE A 25 ? ? 69.93 -70.87 126 15 ASP A 27 ? ? -105.10 -70.90 127 15 SER A 100 ? ? 66.47 -175.78 128 15 VAL A 101 ? ? 68.57 107.43 129 15 ILE A 123 ? ? -134.48 -53.78 130 16 ASN A 2 ? ? 65.73 -169.84 131 16 ASN A 3 ? ? -164.95 -63.58 132 16 THR A 6 ? ? 68.98 96.23 133 16 ASN A 8 ? ? 66.49 -177.22 134 16 GLU A 9 ? ? 61.97 87.55 135 16 VAL A 15 ? ? 71.17 94.17 136 16 MET A 19 ? ? 57.55 79.89 137 16 ASN A 24 ? ? -133.85 -62.14 138 16 ASP A 27 ? ? -100.89 -73.71 139 16 SER A 100 ? ? 63.00 -165.39 140 16 VAL A 101 ? ? 34.78 42.61 141 16 ALA A 105 ? ? -154.30 -79.90 142 16 VAL A 124 ? ? -57.71 109.69 143 17 ASN A 2 ? ? 70.14 -174.37 144 17 THR A 7 ? ? 66.97 99.25 145 17 SER A 10 ? ? 165.42 -18.80 146 17 MET A 19 ? ? 67.28 -171.51 147 17 ASP A 27 ? ? -104.81 -61.24 148 17 ALA A 96 ? ? -89.17 -144.72 149 17 GLU A 98 ? ? 63.51 -153.39 150 17 VAL A 124 ? ? -59.31 109.90 151 18 GLN A 5 ? ? 63.16 89.35 152 18 ASN A 24 ? ? 56.64 77.88 153 18 ASP A 27 ? ? -111.89 -77.09 154 18 ARG A 94 ? ? -58.52 -70.49 155 18 LYS A 97 ? ? -95.35 59.67 156 18 ASP A 107 ? ? -152.41 -37.11 157 18 THR A 108 ? ? -47.57 -18.76 158 19 ASN A 2 ? ? 69.37 165.39 159 19 ASN A 3 ? ? -151.56 57.83 160 19 ALA A 4 ? ? 65.30 -156.32 161 19 ASN A 8 ? ? -114.56 -71.82 162 19 GLU A 9 ? ? 64.45 -174.26 163 19 SER A 10 ? ? 55.50 75.81 164 19 GLN A 13 ? ? -170.75 -77.16 165 19 ASN A 20 ? ? 71.64 -72.10 166 19 ASN A 24 ? ? 67.25 -75.58 167 19 ASP A 27 ? ? -110.90 -72.08 168 20 ASN A 3 ? ? 64.14 172.74 169 20 ALA A 4 ? ? 60.74 -162.51 170 20 GLN A 5 ? ? -163.96 -51.57 171 20 THR A 6 ? ? 69.49 173.53 172 20 THR A 7 ? ? -146.87 -61.28 173 20 ASN A 8 ? ? 70.08 -172.61 174 20 LYS A 14 ? ? 102.56 162.21 175 20 MET A 19 ? ? 61.44 -173.04 176 20 GLU A 98 ? ? 73.82 126.79 177 20 ALA A 105 ? ? -160.06 -62.22 # _pdbx_nmr_ensemble.entry_id 8RJX _pdbx_nmr_ensemble.conformers_calculated_total_number 200 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 8RJX _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'closest to mean' # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '0.73 mM [U-100% 13C; U-100% 15N] Osmotically-inducible protein Y (OsmY), 50 mM NA KPi, 100 mM NA NaCl, 90% H2O/10% D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' _pdbx_nmr_sample_details.label 13C_15N_sample _pdbx_nmr_sample_details.type solution _pdbx_nmr_sample_details.details ? # loop_ _pdbx_nmr_exptl_sample.solution_id _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling 1 'Osmotically-inducible protein Y (OsmY)' 0.73 ? mM '[U-100% 13C; U-100% 15N]' 1 KPi 50 ? mM NA 1 NaCl 100 ? mM NA # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 7.4 _pdbx_nmr_exptl_sample_conditions.ionic_strength 100 _pdbx_nmr_exptl_sample_conditions.details ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_err ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units 'Not defined' _pdbx_nmr_exptl_sample_conditions.label conditions_1 _pdbx_nmr_exptl_sample_conditions.pH_err ? _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 '3D 1H-13C NOESY aliphatic' 1 isotropic 2 1 1 '3D 1H-15N NOESY' 1 isotropic 3 1 1 '3D HNCA' 2 isotropic 4 1 1 '3D HNCACB' 2 isotropic 5 1 1 '3D CBCA(CO)NH' 2 isotropic # _pdbx_nmr_refine.entry_id 8RJX _pdbx_nmr_refine.method 'molecular dynamics' _pdbx_nmr_refine.details 'explicit solvent' _pdbx_nmr_refine.software_ordinal 3 # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 'chemical shift assignment' NMRFAM-SPARKY ? 'Lee, W.' 2 'structure calculation' CYANA ? 'Guntert, Mumenthaler and Wuthrich' 3 refinement CNS ? 'Brunger, Adams, Clore, Gros, Nilges and Read' # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 174 ? A GLY 174 2 1 Y 1 A GLY 175 ? A GLY 175 3 1 Y 1 A GLY 176 ? A GLY 176 4 1 Y 1 A HIS 177 ? A HIS 177 5 1 Y 1 A HIS 178 ? A HIS 178 6 1 Y 1 A HIS 179 ? A HIS 179 7 1 Y 1 A HIS 180 ? A HIS 180 8 1 Y 1 A HIS 181 ? A HIS 181 9 1 Y 1 A HIS 182 ? A HIS 182 10 2 Y 1 A GLY 174 ? A GLY 174 11 2 Y 1 A GLY 175 ? A GLY 175 12 2 Y 1 A GLY 176 ? A GLY 176 13 2 Y 1 A HIS 177 ? A HIS 177 14 2 Y 1 A HIS 178 ? A HIS 178 15 2 Y 1 A HIS 179 ? A HIS 179 16 2 Y 1 A HIS 180 ? A HIS 180 17 2 Y 1 A HIS 181 ? A HIS 181 18 2 Y 1 A HIS 182 ? A HIS 182 19 3 Y 1 A GLY 174 ? A GLY 174 20 3 Y 1 A GLY 175 ? A GLY 175 21 3 Y 1 A GLY 176 ? A GLY 176 22 3 Y 1 A HIS 177 ? A HIS 177 23 3 Y 1 A HIS 178 ? A HIS 178 24 3 Y 1 A HIS 179 ? A HIS 179 25 3 Y 1 A HIS 180 ? A HIS 180 26 3 Y 1 A HIS 181 ? A HIS 181 27 3 Y 1 A HIS 182 ? A HIS 182 28 4 Y 1 A GLY 174 ? A GLY 174 29 4 Y 1 A GLY 175 ? A GLY 175 30 4 Y 1 A GLY 176 ? A GLY 176 31 4 Y 1 A HIS 177 ? A HIS 177 32 4 Y 1 A HIS 178 ? A HIS 178 33 4 Y 1 A HIS 179 ? A HIS 179 34 4 Y 1 A HIS 180 ? A HIS 180 35 4 Y 1 A HIS 181 ? A HIS 181 36 4 Y 1 A HIS 182 ? A HIS 182 37 5 Y 1 A GLY 174 ? A GLY 174 38 5 Y 1 A GLY 175 ? A GLY 175 39 5 Y 1 A GLY 176 ? A GLY 176 40 5 Y 1 A HIS 177 ? A HIS 177 41 5 Y 1 A HIS 178 ? A HIS 178 42 5 Y 1 A HIS 179 ? A HIS 179 43 5 Y 1 A HIS 180 ? A HIS 180 44 5 Y 1 A HIS 181 ? A HIS 181 45 5 Y 1 A HIS 182 ? A HIS 182 46 6 Y 1 A GLY 174 ? A GLY 174 47 6 Y 1 A GLY 175 ? A GLY 175 48 6 Y 1 A GLY 176 ? A GLY 176 49 6 Y 1 A HIS 177 ? A HIS 177 50 6 Y 1 A HIS 178 ? A HIS 178 51 6 Y 1 A HIS 179 ? A HIS 179 52 6 Y 1 A HIS 180 ? A HIS 180 53 6 Y 1 A HIS 181 ? A HIS 181 54 6 Y 1 A HIS 182 ? A HIS 182 55 7 Y 1 A GLY 174 ? A GLY 174 56 7 Y 1 A GLY 175 ? A GLY 175 57 7 Y 1 A GLY 176 ? A GLY 176 58 7 Y 1 A HIS 177 ? A HIS 177 59 7 Y 1 A HIS 178 ? A HIS 178 60 7 Y 1 A HIS 179 ? A HIS 179 61 7 Y 1 A HIS 180 ? A HIS 180 62 7 Y 1 A HIS 181 ? A HIS 181 63 7 Y 1 A HIS 182 ? A HIS 182 64 8 Y 1 A GLY 174 ? A GLY 174 65 8 Y 1 A GLY 175 ? A GLY 175 66 8 Y 1 A GLY 176 ? A GLY 176 67 8 Y 1 A HIS 177 ? A HIS 177 68 8 Y 1 A HIS 178 ? A HIS 178 69 8 Y 1 A HIS 179 ? A HIS 179 70 8 Y 1 A HIS 180 ? A HIS 180 71 8 Y 1 A HIS 181 ? A HIS 181 72 8 Y 1 A HIS 182 ? A HIS 182 73 9 Y 1 A GLY 174 ? A GLY 174 74 9 Y 1 A GLY 175 ? A GLY 175 75 9 Y 1 A GLY 176 ? A GLY 176 76 9 Y 1 A HIS 177 ? A HIS 177 77 9 Y 1 A HIS 178 ? A HIS 178 78 9 Y 1 A HIS 179 ? A HIS 179 79 9 Y 1 A HIS 180 ? A HIS 180 80 9 Y 1 A HIS 181 ? A HIS 181 81 9 Y 1 A HIS 182 ? A HIS 182 82 10 Y 1 A GLY 174 ? A GLY 174 83 10 Y 1 A GLY 175 ? A GLY 175 84 10 Y 1 A GLY 176 ? A GLY 176 85 10 Y 1 A HIS 177 ? A HIS 177 86 10 Y 1 A HIS 178 ? A HIS 178 87 10 Y 1 A HIS 179 ? A HIS 179 88 10 Y 1 A HIS 180 ? A HIS 180 89 10 Y 1 A HIS 181 ? A HIS 181 90 10 Y 1 A HIS 182 ? A HIS 182 91 11 Y 1 A GLY 174 ? A GLY 174 92 11 Y 1 A GLY 175 ? A GLY 175 93 11 Y 1 A GLY 176 ? A GLY 176 94 11 Y 1 A HIS 177 ? A HIS 177 95 11 Y 1 A HIS 178 ? A HIS 178 96 11 Y 1 A HIS 179 ? A HIS 179 97 11 Y 1 A HIS 180 ? A HIS 180 98 11 Y 1 A HIS 181 ? A HIS 181 99 11 Y 1 A HIS 182 ? A HIS 182 100 12 Y 1 A GLY 174 ? A GLY 174 101 12 Y 1 A GLY 175 ? A GLY 175 102 12 Y 1 A GLY 176 ? A GLY 176 103 12 Y 1 A HIS 177 ? A HIS 177 104 12 Y 1 A HIS 178 ? A HIS 178 105 12 Y 1 A HIS 179 ? A HIS 179 106 12 Y 1 A HIS 180 ? A HIS 180 107 12 Y 1 A HIS 181 ? A HIS 181 108 12 Y 1 A HIS 182 ? A HIS 182 109 13 Y 1 A GLY 174 ? A GLY 174 110 13 Y 1 A GLY 175 ? A GLY 175 111 13 Y 1 A GLY 176 ? A GLY 176 112 13 Y 1 A HIS 177 ? A HIS 177 113 13 Y 1 A HIS 178 ? A HIS 178 114 13 Y 1 A HIS 179 ? A HIS 179 115 13 Y 1 A HIS 180 ? A HIS 180 116 13 Y 1 A HIS 181 ? A HIS 181 117 13 Y 1 A HIS 182 ? A HIS 182 118 14 Y 1 A GLY 174 ? A GLY 174 119 14 Y 1 A GLY 175 ? A GLY 175 120 14 Y 1 A GLY 176 ? A GLY 176 121 14 Y 1 A HIS 177 ? A HIS 177 122 14 Y 1 A HIS 178 ? A HIS 178 123 14 Y 1 A HIS 179 ? A HIS 179 124 14 Y 1 A HIS 180 ? A HIS 180 125 14 Y 1 A HIS 181 ? A HIS 181 126 14 Y 1 A HIS 182 ? A HIS 182 127 15 Y 1 A GLY 174 ? A GLY 174 128 15 Y 1 A GLY 175 ? A GLY 175 129 15 Y 1 A GLY 176 ? A GLY 176 130 15 Y 1 A HIS 177 ? A HIS 177 131 15 Y 1 A HIS 178 ? A HIS 178 132 15 Y 1 A HIS 179 ? A HIS 179 133 15 Y 1 A HIS 180 ? A HIS 180 134 15 Y 1 A HIS 181 ? A HIS 181 135 15 Y 1 A HIS 182 ? A HIS 182 136 16 Y 1 A GLY 174 ? A GLY 174 137 16 Y 1 A GLY 175 ? A GLY 175 138 16 Y 1 A GLY 176 ? A GLY 176 139 16 Y 1 A HIS 177 ? A HIS 177 140 16 Y 1 A HIS 178 ? A HIS 178 141 16 Y 1 A HIS 179 ? A HIS 179 142 16 Y 1 A HIS 180 ? A HIS 180 143 16 Y 1 A HIS 181 ? A HIS 181 144 16 Y 1 A HIS 182 ? A HIS 182 145 17 Y 1 A GLY 174 ? A GLY 174 146 17 Y 1 A GLY 175 ? A GLY 175 147 17 Y 1 A GLY 176 ? A GLY 176 148 17 Y 1 A HIS 177 ? A HIS 177 149 17 Y 1 A HIS 178 ? A HIS 178 150 17 Y 1 A HIS 179 ? A HIS 179 151 17 Y 1 A HIS 180 ? A HIS 180 152 17 Y 1 A HIS 181 ? A HIS 181 153 17 Y 1 A HIS 182 ? A HIS 182 154 18 Y 1 A GLY 174 ? A GLY 174 155 18 Y 1 A GLY 175 ? A GLY 175 156 18 Y 1 A GLY 176 ? A GLY 176 157 18 Y 1 A HIS 177 ? A HIS 177 158 18 Y 1 A HIS 178 ? A HIS 178 159 18 Y 1 A HIS 179 ? A HIS 179 160 18 Y 1 A HIS 180 ? A HIS 180 161 18 Y 1 A HIS 181 ? A HIS 181 162 18 Y 1 A HIS 182 ? A HIS 182 163 19 Y 1 A GLY 174 ? A GLY 174 164 19 Y 1 A GLY 175 ? A GLY 175 165 19 Y 1 A GLY 176 ? A GLY 176 166 19 Y 1 A HIS 177 ? A HIS 177 167 19 Y 1 A HIS 178 ? A HIS 178 168 19 Y 1 A HIS 179 ? A HIS 179 169 19 Y 1 A HIS 180 ? A HIS 180 170 19 Y 1 A HIS 181 ? A HIS 181 171 19 Y 1 A HIS 182 ? A HIS 182 172 20 Y 1 A GLY 174 ? A GLY 174 173 20 Y 1 A GLY 175 ? A GLY 175 174 20 Y 1 A GLY 176 ? A GLY 176 175 20 Y 1 A HIS 177 ? A HIS 177 176 20 Y 1 A HIS 178 ? A HIS 178 177 20 Y 1 A HIS 179 ? A HIS 179 178 20 Y 1 A HIS 180 ? A HIS 180 179 20 Y 1 A HIS 181 ? A HIS 181 180 20 Y 1 A HIS 182 ? A HIS 182 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 GLU N N N N 94 GLU CA C N S 95 GLU C C N N 96 GLU O O N N 97 GLU CB C N N 98 GLU CG C N N 99 GLU CD C N N 100 GLU OE1 O N N 101 GLU OE2 O N N 102 GLU OXT O N N 103 GLU H H N N 104 GLU H2 H N N 105 GLU HA H N N 106 GLU HB2 H N N 107 GLU HB3 H N N 108 GLU HG2 H N N 109 GLU HG3 H N N 110 GLU HE2 H N N 111 GLU HXT H N N 112 GLY N N N N 113 GLY CA C N N 114 GLY C C N N 115 GLY O O N N 116 GLY OXT O N N 117 GLY H H N N 118 GLY H2 H N N 119 GLY HA2 H N N 120 GLY HA3 H N N 121 GLY HXT H N N 122 HIS N N N N 123 HIS CA C N S 124 HIS C C N N 125 HIS O O N N 126 HIS CB C N N 127 HIS CG C Y N 128 HIS ND1 N Y N 129 HIS CD2 C Y N 130 HIS CE1 C Y N 131 HIS NE2 N Y N 132 HIS OXT O N N 133 HIS H H N N 134 HIS H2 H N N 135 HIS HA H N N 136 HIS HB2 H N N 137 HIS HB3 H N N 138 HIS HD1 H N N 139 HIS HD2 H N N 140 HIS HE1 H N N 141 HIS HE2 H N N 142 HIS HXT H N N 143 ILE N N N N 144 ILE CA C N S 145 ILE C C N N 146 ILE O O N N 147 ILE CB C N S 148 ILE CG1 C N N 149 ILE CG2 C N N 150 ILE CD1 C N N 151 ILE OXT O N N 152 ILE H H N N 153 ILE H2 H N N 154 ILE HA H N N 155 ILE HB H N N 156 ILE HG12 H N N 157 ILE HG13 H N N 158 ILE HG21 H N N 159 ILE HG22 H N N 160 ILE HG23 H N N 161 ILE HD11 H N N 162 ILE HD12 H N N 163 ILE HD13 H N N 164 ILE HXT H N N 165 LEU N N N N 166 LEU CA C N S 167 LEU C C N N 168 LEU O O N N 169 LEU CB C N N 170 LEU CG C N N 171 LEU CD1 C N N 172 LEU CD2 C N N 173 LEU OXT O N N 174 LEU H H N N 175 LEU H2 H N N 176 LEU HA H N N 177 LEU HB2 H N N 178 LEU HB3 H N N 179 LEU HG H N N 180 LEU HD11 H N N 181 LEU HD12 H N N 182 LEU HD13 H N N 183 LEU HD21 H N N 184 LEU HD22 H N N 185 LEU HD23 H N N 186 LEU HXT H N N 187 LYS N N N N 188 LYS CA C N S 189 LYS C C N N 190 LYS O O N N 191 LYS CB C N N 192 LYS CG C N N 193 LYS CD C N N 194 LYS CE C N N 195 LYS NZ N N N 196 LYS OXT O N N 197 LYS H H N N 198 LYS H2 H N N 199 LYS HA H N N 200 LYS HB2 H N N 201 LYS HB3 H N N 202 LYS HG2 H N N 203 LYS HG3 H N N 204 LYS HD2 H N N 205 LYS HD3 H N N 206 LYS HE2 H N N 207 LYS HE3 H N N 208 LYS HZ1 H N N 209 LYS HZ2 H N N 210 LYS HZ3 H N N 211 LYS HXT H N N 212 MET N N N N 213 MET CA C N S 214 MET C C N N 215 MET O O N N 216 MET CB C N N 217 MET CG C N N 218 MET SD S N N 219 MET CE C N N 220 MET OXT O N N 221 MET H H N N 222 MET H2 H N N 223 MET HA H N N 224 MET HB2 H N N 225 MET HB3 H N N 226 MET HG2 H N N 227 MET HG3 H N N 228 MET HE1 H N N 229 MET HE2 H N N 230 MET HE3 H N N 231 MET HXT H N N 232 PHE N N N N 233 PHE CA C N S 234 PHE C C N N 235 PHE O O N N 236 PHE CB C N N 237 PHE CG C Y N 238 PHE CD1 C Y N 239 PHE CD2 C Y N 240 PHE CE1 C Y N 241 PHE CE2 C Y N 242 PHE CZ C Y N 243 PHE OXT O N N 244 PHE H H N N 245 PHE H2 H N N 246 PHE HA H N N 247 PHE HB2 H N N 248 PHE HB3 H N N 249 PHE HD1 H N N 250 PHE HD2 H N N 251 PHE HE1 H N N 252 PHE HE2 H N N 253 PHE HZ H N N 254 PHE HXT H N N 255 PRO N N N N 256 PRO CA C N S 257 PRO C C N N 258 PRO O O N N 259 PRO CB C N N 260 PRO CG C N N 261 PRO CD C N N 262 PRO OXT O N N 263 PRO H H N N 264 PRO HA H N N 265 PRO HB2 H N N 266 PRO HB3 H N N 267 PRO HG2 H N N 268 PRO HG3 H N N 269 PRO HD2 H N N 270 PRO HD3 H N N 271 PRO HXT H N N 272 SER N N N N 273 SER CA C N S 274 SER C C N N 275 SER O O N N 276 SER CB C N N 277 SER OG O N N 278 SER OXT O N N 279 SER H H N N 280 SER H2 H N N 281 SER HA H N N 282 SER HB2 H N N 283 SER HB3 H N N 284 SER HG H N N 285 SER HXT H N N 286 THR N N N N 287 THR CA C N S 288 THR C C N N 289 THR O O N N 290 THR CB C N R 291 THR OG1 O N N 292 THR CG2 C N N 293 THR OXT O N N 294 THR H H N N 295 THR H2 H N N 296 THR HA H N N 297 THR HB H N N 298 THR HG1 H N N 299 THR HG21 H N N 300 THR HG22 H N N 301 THR HG23 H N N 302 THR HXT H N N 303 TYR N N N N 304 TYR CA C N S 305 TYR C C N N 306 TYR O O N N 307 TYR CB C N N 308 TYR CG C Y N 309 TYR CD1 C Y N 310 TYR CD2 C Y N 311 TYR CE1 C Y N 312 TYR CE2 C Y N 313 TYR CZ C Y N 314 TYR OH O N N 315 TYR OXT O N N 316 TYR H H N N 317 TYR H2 H N N 318 TYR HA H N N 319 TYR HB2 H N N 320 TYR HB3 H N N 321 TYR HD1 H N N 322 TYR HD2 H N N 323 TYR HE1 H N N 324 TYR HE2 H N N 325 TYR HH H N N 326 TYR HXT H N N 327 VAL N N N N 328 VAL CA C N S 329 VAL C C N N 330 VAL O O N N 331 VAL CB C N N 332 VAL CG1 C N N 333 VAL CG2 C N N 334 VAL OXT O N N 335 VAL H H N N 336 VAL H2 H N N 337 VAL HA H N N 338 VAL HB H N N 339 VAL HG11 H N N 340 VAL HG12 H N N 341 VAL HG13 H N N 342 VAL HG21 H N N 343 VAL HG22 H N N 344 VAL HG23 H N N 345 VAL HXT H N N 346 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 HIS N CA sing N N 116 HIS N H sing N N 117 HIS N H2 sing N N 118 HIS CA C sing N N 119 HIS CA CB sing N N 120 HIS CA HA sing N N 121 HIS C O doub N N 122 HIS C OXT sing N N 123 HIS CB CG sing N N 124 HIS CB HB2 sing N N 125 HIS CB HB3 sing N N 126 HIS CG ND1 sing Y N 127 HIS CG CD2 doub Y N 128 HIS ND1 CE1 doub Y N 129 HIS ND1 HD1 sing N N 130 HIS CD2 NE2 sing Y N 131 HIS CD2 HD2 sing N N 132 HIS CE1 NE2 sing Y N 133 HIS CE1 HE1 sing N N 134 HIS NE2 HE2 sing N N 135 HIS OXT HXT sing N N 136 ILE N CA sing N N 137 ILE N H sing N N 138 ILE N H2 sing N N 139 ILE CA C sing N N 140 ILE CA CB sing N N 141 ILE CA HA sing N N 142 ILE C O doub N N 143 ILE C OXT sing N N 144 ILE CB CG1 sing N N 145 ILE CB CG2 sing N N 146 ILE CB HB sing N N 147 ILE CG1 CD1 sing N N 148 ILE CG1 HG12 sing N N 149 ILE CG1 HG13 sing N N 150 ILE CG2 HG21 sing N N 151 ILE CG2 HG22 sing N N 152 ILE CG2 HG23 sing N N 153 ILE CD1 HD11 sing N N 154 ILE CD1 HD12 sing N N 155 ILE CD1 HD13 sing N N 156 ILE OXT HXT sing N N 157 LEU N CA sing N N 158 LEU N H sing N N 159 LEU N H2 sing N N 160 LEU CA C sing N N 161 LEU CA CB sing N N 162 LEU CA HA sing N N 163 LEU C O doub N N 164 LEU C OXT sing N N 165 LEU CB CG sing N N 166 LEU CB HB2 sing N N 167 LEU CB HB3 sing N N 168 LEU CG CD1 sing N N 169 LEU CG CD2 sing N N 170 LEU CG HG sing N N 171 LEU CD1 HD11 sing N N 172 LEU CD1 HD12 sing N N 173 LEU CD1 HD13 sing N N 174 LEU CD2 HD21 sing N N 175 LEU CD2 HD22 sing N N 176 LEU CD2 HD23 sing N N 177 LEU OXT HXT sing N N 178 LYS N CA sing N N 179 LYS N H sing N N 180 LYS N H2 sing N N 181 LYS CA C sing N N 182 LYS CA CB sing N N 183 LYS CA HA sing N N 184 LYS C O doub N N 185 LYS C OXT sing N N 186 LYS CB CG sing N N 187 LYS CB HB2 sing N N 188 LYS CB HB3 sing N N 189 LYS CG CD sing N N 190 LYS CG HG2 sing N N 191 LYS CG HG3 sing N N 192 LYS CD CE sing N N 193 LYS CD HD2 sing N N 194 LYS CD HD3 sing N N 195 LYS CE NZ sing N N 196 LYS CE HE2 sing N N 197 LYS CE HE3 sing N N 198 LYS NZ HZ1 sing N N 199 LYS NZ HZ2 sing N N 200 LYS NZ HZ3 sing N N 201 LYS OXT HXT sing N N 202 MET N CA sing N N 203 MET N H sing N N 204 MET N H2 sing N N 205 MET CA C sing N N 206 MET CA CB sing N N 207 MET CA HA sing N N 208 MET C O doub N N 209 MET C OXT sing N N 210 MET CB CG sing N N 211 MET CB HB2 sing N N 212 MET CB HB3 sing N N 213 MET CG SD sing N N 214 MET CG HG2 sing N N 215 MET CG HG3 sing N N 216 MET SD CE sing N N 217 MET CE HE1 sing N N 218 MET CE HE2 sing N N 219 MET CE HE3 sing N N 220 MET OXT HXT sing N N 221 PHE N CA sing N N 222 PHE N H sing N N 223 PHE N H2 sing N N 224 PHE CA C sing N N 225 PHE CA CB sing N N 226 PHE CA HA sing N N 227 PHE C O doub N N 228 PHE C OXT sing N N 229 PHE CB CG sing N N 230 PHE CB HB2 sing N N 231 PHE CB HB3 sing N N 232 PHE CG CD1 doub Y N 233 PHE CG CD2 sing Y N 234 PHE CD1 CE1 sing Y N 235 PHE CD1 HD1 sing N N 236 PHE CD2 CE2 doub Y N 237 PHE CD2 HD2 sing N N 238 PHE CE1 CZ doub Y N 239 PHE CE1 HE1 sing N N 240 PHE CE2 CZ sing Y N 241 PHE CE2 HE2 sing N N 242 PHE CZ HZ sing N N 243 PHE OXT HXT sing N N 244 PRO N CA sing N N 245 PRO N CD sing N N 246 PRO N H sing N N 247 PRO CA C sing N N 248 PRO CA CB sing N N 249 PRO CA HA sing N N 250 PRO C O doub N N 251 PRO C OXT sing N N 252 PRO CB CG sing N N 253 PRO CB HB2 sing N N 254 PRO CB HB3 sing N N 255 PRO CG CD sing N N 256 PRO CG HG2 sing N N 257 PRO CG HG3 sing N N 258 PRO CD HD2 sing N N 259 PRO CD HD3 sing N N 260 PRO OXT HXT sing N N 261 SER N CA sing N N 262 SER N H sing N N 263 SER N H2 sing N N 264 SER CA C sing N N 265 SER CA CB sing N N 266 SER CA HA sing N N 267 SER C O doub N N 268 SER C OXT sing N N 269 SER CB OG sing N N 270 SER CB HB2 sing N N 271 SER CB HB3 sing N N 272 SER OG HG sing N N 273 SER OXT HXT sing N N 274 THR N CA sing N N 275 THR N H sing N N 276 THR N H2 sing N N 277 THR CA C sing N N 278 THR CA CB sing N N 279 THR CA HA sing N N 280 THR C O doub N N 281 THR C OXT sing N N 282 THR CB OG1 sing N N 283 THR CB CG2 sing N N 284 THR CB HB sing N N 285 THR OG1 HG1 sing N N 286 THR CG2 HG21 sing N N 287 THR CG2 HG22 sing N N 288 THR CG2 HG23 sing N N 289 THR OXT HXT sing N N 290 TYR N CA sing N N 291 TYR N H sing N N 292 TYR N H2 sing N N 293 TYR CA C sing N N 294 TYR CA CB sing N N 295 TYR CA HA sing N N 296 TYR C O doub N N 297 TYR C OXT sing N N 298 TYR CB CG sing N N 299 TYR CB HB2 sing N N 300 TYR CB HB3 sing N N 301 TYR CG CD1 doub Y N 302 TYR CG CD2 sing Y N 303 TYR CD1 CE1 sing Y N 304 TYR CD1 HD1 sing N N 305 TYR CD2 CE2 doub Y N 306 TYR CD2 HD2 sing N N 307 TYR CE1 CZ doub Y N 308 TYR CE1 HE1 sing N N 309 TYR CE2 CZ sing Y N 310 TYR CE2 HE2 sing N N 311 TYR CZ OH sing N N 312 TYR OH HH sing N N 313 TYR OXT HXT sing N N 314 VAL N CA sing N N 315 VAL N H sing N N 316 VAL N H2 sing N N 317 VAL CA C sing N N 318 VAL CA CB sing N N 319 VAL CA HA sing N N 320 VAL C O doub N N 321 VAL C OXT sing N N 322 VAL CB CG1 sing N N 323 VAL CB CG2 sing N N 324 VAL CB HB sing N N 325 VAL CG1 HG11 sing N N 326 VAL CG1 HG12 sing N N 327 VAL CG1 HG13 sing N N 328 VAL CG2 HG21 sing N N 329 VAL CG2 HG22 sing N N 330 VAL CG2 HG23 sing N N 331 VAL OXT HXT sing N N 332 # _pdbx_audit_support.funding_organization 'Not funded' _pdbx_audit_support.country ? _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.type _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.details 1 'AVANCE III HD' ? Bruker 900 ? 2 'AVANCE III' ? Bruker 600 ? # _atom_sites.entry_id 8RJX _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C H N O S # loop_