data_8S1X
# 
_entry.id   8S1X 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.401 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   8S1X         pdb_00008s1x 10.2210/pdb8s1x/pdb 
WWPDB D_1292136690 ?            ?                   
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2024-10-30 
2 'Structure model' 1 1 2025-01-15 
3 'Structure model' 1 2 2025-01-29 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Database references' 
2 3 'Structure model' 'Database references' 
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 2 'Structure model' citation        
2 3 'Structure model' citation        
3 3 'Structure model' citation_author 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  2 'Structure model' '_citation.country'                 
2  2 'Structure model' '_citation.journal_abbrev'          
3  2 'Structure model' '_citation.journal_id_ASTM'         
4  2 'Structure model' '_citation.journal_id_CSD'          
5  2 'Structure model' '_citation.journal_id_ISSN'         
6  2 'Structure model' '_citation.pdbx_database_id_DOI'    
7  2 'Structure model' '_citation.title'                   
8  2 'Structure model' '_citation.year'                    
9  3 'Structure model' '_citation.pdbx_database_id_PubMed' 
10 3 'Structure model' '_citation.title'                   
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        8S1X 
_pdbx_database_status.recvd_initial_deposition_date   2024-02-16 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
_pdbx_contact_author.id                 3 
_pdbx_contact_author.email              bruno.correia@epfl.ch 
_pdbx_contact_author.name_first         Bruno 
_pdbx_contact_author.name_last          Correia 
_pdbx_contact_author.name_mi            E. 
_pdbx_contact_author.role               'principal investigator/group leader' 
_pdbx_contact_author.identifier_ORCID   0000-0002-7377-8636 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Marchand, A.'  1 ? 
'Pacesa, M.'    2 ? 
'Correia, B.E.' 3 ? 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   UK 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            Nature 
_citation.journal_id_ASTM           NATUAS 
_citation.journal_id_CSD            0006 
_citation.journal_id_ISSN           1476-4687 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            ? 
_citation.language                  ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.title                     'Targeting protein-ligand neosurfaces with a generalizable deep learning tool.' 
_citation.year                      2025 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1038/s41586-024-08435-4 
_citation.pdbx_database_id_PubMed   39814890 
_citation.pdbx_database_id_patent   ? 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Marchand, A.'  1  ? 
primary 'Buckley, S.'   2  ? 
primary 'Schneuing, A.' 3  ? 
primary 'Pacesa, M.'    4  ? 
primary 'Elia, M.'      5  ? 
primary 'Gainza, P.'    6  ? 
primary 'Elizarova, E.' 7  ? 
primary 'Neeser, R.M.'  8  ? 
primary 'Lee, P.W.'     9  ? 
primary 'Reymond, L.'   10 ? 
primary 'Miao, Y.'      11 ? 
primary 'Scheller, L.'  12 ? 
primary 'Georgeon, S.'  13 ? 
primary 'Schmidt, J.'   14 ? 
primary 'Schwaller, P.' 15 ? 
primary 'Maerkl, S.J.'  16 ? 
primary 'Bronstein, M.' 17 ? 
primary 'Correia, B.E.' 18 ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Peptide deformylase' 19391.156 1  3.5.1.88 ? ? Actionin 
2 polymer     man DBAct553_1            8152.354  1  ?        ? ? Actionin 
3 non-polymer syn 'ZINC ION'            65.409    1  ?        ? ? ?        
4 non-polymer syn ACTINONIN             385.498   1  ?        ? ? ?        
5 non-polymer syn 'FORMIC ACID'         46.025    8  ?        ? ? ?        
6 non-polymer syn 'PHOSPHATE ION'       94.971    4  ?        ? ? ?        
7 non-polymer syn 'POTASSIUM ION'       39.098    1  ?        ? ? ?        
8 water       nat water                 18.015    76 ?        ? ? ?        
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'PDF,Polypeptide deformylase' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;MAILNILEFPDPRLRTIAKPVEVVDDAVRQLIDDMFETMYEAPGIGLAATQVNVHKRIVVMDLSEDKSEPRVFINPEFEP
LTEDMDQYQEGCLSVPGFYENVDRPQKVRIKALDRDGNPFEEVAEGLLAVCIQHECDHLNGKLFVDYLSTLKRDRIRKKL
EKQHRQQA
;
;MAILNILEFPDPRLRTIAKPVEVVDDAVRQLIDDMFETMYEAPGIGLAATQVNVHKRIVVMDLSEDKSEPRVFINPEFEP
LTEDMDQYQEGCLSVPGFYENVDRPQKVRIKALDRDGNPFEEVAEGLLAVCIQHECDHLNGKLFVDYLSTLKRDRIRKKL
EKQHRQQA
;
A ? 
2 'polypeptide(L)' no no DYIRELRAALILLALKKQHAEDPDAQRVADELMKKLFDAAHRNDKDKVKKVVEEAKKVVSTYGSHHHHHH 
DYIRELRAALILLALKKQHAEDPDAQRVADELMKKLFDAAHRNDKDKVKKVVEEAKKVVSTYGSHHHHHH B ? 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
3 'ZINC ION'      ZN  
4 ACTINONIN       BB2 
5 'FORMIC ACID'   FMT 
6 'PHOSPHATE ION' PO4 
7 'POTASSIUM ION' K   
8 water           HOH 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   ALA n 
1 3   ILE n 
1 4   LEU n 
1 5   ASN n 
1 6   ILE n 
1 7   LEU n 
1 8   GLU n 
1 9   PHE n 
1 10  PRO n 
1 11  ASP n 
1 12  PRO n 
1 13  ARG n 
1 14  LEU n 
1 15  ARG n 
1 16  THR n 
1 17  ILE n 
1 18  ALA n 
1 19  LYS n 
1 20  PRO n 
1 21  VAL n 
1 22  GLU n 
1 23  VAL n 
1 24  VAL n 
1 25  ASP n 
1 26  ASP n 
1 27  ALA n 
1 28  VAL n 
1 29  ARG n 
1 30  GLN n 
1 31  LEU n 
1 32  ILE n 
1 33  ASP n 
1 34  ASP n 
1 35  MET n 
1 36  PHE n 
1 37  GLU n 
1 38  THR n 
1 39  MET n 
1 40  TYR n 
1 41  GLU n 
1 42  ALA n 
1 43  PRO n 
1 44  GLY n 
1 45  ILE n 
1 46  GLY n 
1 47  LEU n 
1 48  ALA n 
1 49  ALA n 
1 50  THR n 
1 51  GLN n 
1 52  VAL n 
1 53  ASN n 
1 54  VAL n 
1 55  HIS n 
1 56  LYS n 
1 57  ARG n 
1 58  ILE n 
1 59  VAL n 
1 60  VAL n 
1 61  MET n 
1 62  ASP n 
1 63  LEU n 
1 64  SER n 
1 65  GLU n 
1 66  ASP n 
1 67  LYS n 
1 68  SER n 
1 69  GLU n 
1 70  PRO n 
1 71  ARG n 
1 72  VAL n 
1 73  PHE n 
1 74  ILE n 
1 75  ASN n 
1 76  PRO n 
1 77  GLU n 
1 78  PHE n 
1 79  GLU n 
1 80  PRO n 
1 81  LEU n 
1 82  THR n 
1 83  GLU n 
1 84  ASP n 
1 85  MET n 
1 86  ASP n 
1 87  GLN n 
1 88  TYR n 
1 89  GLN n 
1 90  GLU n 
1 91  GLY n 
1 92  CYS n 
1 93  LEU n 
1 94  SER n 
1 95  VAL n 
1 96  PRO n 
1 97  GLY n 
1 98  PHE n 
1 99  TYR n 
1 100 GLU n 
1 101 ASN n 
1 102 VAL n 
1 103 ASP n 
1 104 ARG n 
1 105 PRO n 
1 106 GLN n 
1 107 LYS n 
1 108 VAL n 
1 109 ARG n 
1 110 ILE n 
1 111 LYS n 
1 112 ALA n 
1 113 LEU n 
1 114 ASP n 
1 115 ARG n 
1 116 ASP n 
1 117 GLY n 
1 118 ASN n 
1 119 PRO n 
1 120 PHE n 
1 121 GLU n 
1 122 GLU n 
1 123 VAL n 
1 124 ALA n 
1 125 GLU n 
1 126 GLY n 
1 127 LEU n 
1 128 LEU n 
1 129 ALA n 
1 130 VAL n 
1 131 CYS n 
1 132 ILE n 
1 133 GLN n 
1 134 HIS n 
1 135 GLU n 
1 136 CYS n 
1 137 ASP n 
1 138 HIS n 
1 139 LEU n 
1 140 ASN n 
1 141 GLY n 
1 142 LYS n 
1 143 LEU n 
1 144 PHE n 
1 145 VAL n 
1 146 ASP n 
1 147 TYR n 
1 148 LEU n 
1 149 SER n 
1 150 THR n 
1 151 LEU n 
1 152 LYS n 
1 153 ARG n 
1 154 ASP n 
1 155 ARG n 
1 156 ILE n 
1 157 ARG n 
1 158 LYS n 
1 159 LYS n 
1 160 LEU n 
1 161 GLU n 
1 162 LYS n 
1 163 GLN n 
1 164 HIS n 
1 165 ARG n 
1 166 GLN n 
1 167 GLN n 
1 168 ALA n 
2 1   ASP n 
2 2   TYR n 
2 3   ILE n 
2 4   ARG n 
2 5   GLU n 
2 6   LEU n 
2 7   ARG n 
2 8   ALA n 
2 9   ALA n 
2 10  LEU n 
2 11  ILE n 
2 12  LEU n 
2 13  LEU n 
2 14  ALA n 
2 15  LEU n 
2 16  LYS n 
2 17  LYS n 
2 18  GLN n 
2 19  HIS n 
2 20  ALA n 
2 21  GLU n 
2 22  ASP n 
2 23  PRO n 
2 24  ASP n 
2 25  ALA n 
2 26  GLN n 
2 27  ARG n 
2 28  VAL n 
2 29  ALA n 
2 30  ASP n 
2 31  GLU n 
2 32  LEU n 
2 33  MET n 
2 34  LYS n 
2 35  LYS n 
2 36  LEU n 
2 37  PHE n 
2 38  ASP n 
2 39  ALA n 
2 40  ALA n 
2 41  HIS n 
2 42  ARG n 
2 43  ASN n 
2 44  ASP n 
2 45  LYS n 
2 46  ASP n 
2 47  LYS n 
2 48  VAL n 
2 49  LYS n 
2 50  LYS n 
2 51  VAL n 
2 52  VAL n 
2 53  GLU n 
2 54  GLU n 
2 55  ALA n 
2 56  LYS n 
2 57  LYS n 
2 58  VAL n 
2 59  VAL n 
2 60  SER n 
2 61  THR n 
2 62  TYR n 
2 63  GLY n 
2 64  SER n 
2 65  HIS n 
2 66  HIS n 
2 67  HIS n 
2 68  HIS n 
2 69  HIS n 
2 70  HIS n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample 'Biological sequence' 1 168 ? ? 'def, PA0019' ? ? ? ? ? ? 'Pseudomonas aeruginosa' 287   ? ? ? ? ? ? ? ? 
'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2 1 sample 'Biological sequence' 1 70  ? ? ?             ? ? ? ? ? ? 'synthetic construct'    32630 ? ? ? ? ? ? ? ? 
'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
BB2 non-polymer         . ACTINONIN       
'2-[(FORMYL-HYDROXY-AMINO)-METHYL]-HEPTANOIC ACID [1-(2-HYDROXYMETHYL-PYRROLIDINE-1-CARBONYL)-2-METHYL-PROPYL]-AMIDE' 
'C19 H35 N3 O5'  385.498 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
FMT non-polymer         . 'FORMIC ACID'   ? 'C H2 O2'        46.025  
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
K   non-polymer         . 'POTASSIUM ION' ? 'K 1'            39.098  
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PO4 non-polymer         . 'PHOSPHATE ION' ? 'O4 P -3'        94.971  
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
ZN  non-polymer         . 'ZINC ION'      ? 'Zn 2'           65.409  
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   ?   ?   ?   A . n 
A 1 2   ALA 2   2   2   ALA ALA A . n 
A 1 3   ILE 3   3   3   ILE ILE A . n 
A 1 4   LEU 4   4   4   LEU LEU A . n 
A 1 5   ASN 5   5   5   ASN ASN A . n 
A 1 6   ILE 6   6   6   ILE ILE A . n 
A 1 7   LEU 7   7   7   LEU LEU A . n 
A 1 8   GLU 8   8   8   GLU GLU A . n 
A 1 9   PHE 9   9   9   PHE PHE A . n 
A 1 10  PRO 10  10  10  PRO PRO A . n 
A 1 11  ASP 11  11  11  ASP ASP A . n 
A 1 12  PRO 12  12  12  PRO PRO A . n 
A 1 13  ARG 13  13  13  ARG ARG A . n 
A 1 14  LEU 14  14  14  LEU LEU A . n 
A 1 15  ARG 15  15  15  ARG ARG A . n 
A 1 16  THR 16  16  16  THR THR A . n 
A 1 17  ILE 17  17  17  ILE ILE A . n 
A 1 18  ALA 18  18  18  ALA ALA A . n 
A 1 19  LYS 19  19  19  LYS LYS A . n 
A 1 20  PRO 20  20  20  PRO PRO A . n 
A 1 21  VAL 21  21  21  VAL VAL A . n 
A 1 22  GLU 22  22  22  GLU GLU A . n 
A 1 23  VAL 23  23  23  VAL VAL A . n 
A 1 24  VAL 24  24  24  VAL VAL A . n 
A 1 25  ASP 25  25  25  ASP ASP A . n 
A 1 26  ASP 26  26  26  ASP ASP A . n 
A 1 27  ALA 27  27  27  ALA ALA A . n 
A 1 28  VAL 28  28  28  VAL VAL A . n 
A 1 29  ARG 29  29  29  ARG ARG A . n 
A 1 30  GLN 30  30  30  GLN GLN A . n 
A 1 31  LEU 31  31  31  LEU LEU A . n 
A 1 32  ILE 32  32  32  ILE ILE A . n 
A 1 33  ASP 33  33  33  ASP ASP A . n 
A 1 34  ASP 34  34  34  ASP ASP A . n 
A 1 35  MET 35  35  35  MET MET A . n 
A 1 36  PHE 36  36  36  PHE PHE A . n 
A 1 37  GLU 37  37  37  GLU GLU A . n 
A 1 38  THR 38  38  38  THR THR A . n 
A 1 39  MET 39  39  39  MET MET A . n 
A 1 40  TYR 40  40  40  TYR TYR A . n 
A 1 41  GLU 41  41  41  GLU GLU A . n 
A 1 42  ALA 42  42  42  ALA ALA A . n 
A 1 43  PRO 43  43  43  PRO PRO A . n 
A 1 44  GLY 44  44  44  GLY GLY A . n 
A 1 45  ILE 45  45  45  ILE ILE A . n 
A 1 46  GLY 46  46  46  GLY GLY A . n 
A 1 47  LEU 47  47  47  LEU LEU A . n 
A 1 48  ALA 48  48  48  ALA ALA A . n 
A 1 49  ALA 49  49  49  ALA ALA A . n 
A 1 50  THR 50  50  50  THR THR A . n 
A 1 51  GLN 51  51  51  GLN GLN A . n 
A 1 52  VAL 52  52  52  VAL VAL A . n 
A 1 53  ASN 53  53  53  ASN ASN A . n 
A 1 54  VAL 54  54  54  VAL VAL A . n 
A 1 55  HIS 55  55  55  HIS HIS A . n 
A 1 56  LYS 56  56  56  LYS LYS A . n 
A 1 57  ARG 57  57  57  ARG ARG A . n 
A 1 58  ILE 58  58  58  ILE ILE A . n 
A 1 59  VAL 59  59  59  VAL VAL A . n 
A 1 60  VAL 60  60  60  VAL VAL A . n 
A 1 61  MET 61  61  61  MET MET A . n 
A 1 62  ASP 62  62  62  ASP ASP A . n 
A 1 63  LEU 63  63  63  LEU LEU A . n 
A 1 64  SER 64  64  64  SER SER A . n 
A 1 65  GLU 65  65  65  GLU GLU A . n 
A 1 66  ASP 66  66  66  ASP ASP A . n 
A 1 67  LYS 67  67  67  LYS LYS A . n 
A 1 68  SER 68  68  68  SER SER A . n 
A 1 69  GLU 69  69  69  GLU GLU A . n 
A 1 70  PRO 70  70  70  PRO PRO A . n 
A 1 71  ARG 71  71  71  ARG ARG A . n 
A 1 72  VAL 72  72  72  VAL VAL A . n 
A 1 73  PHE 73  73  73  PHE PHE A . n 
A 1 74  ILE 74  74  74  ILE ILE A . n 
A 1 75  ASN 75  75  75  ASN ASN A . n 
A 1 76  PRO 76  76  76  PRO PRO A . n 
A 1 77  GLU 77  77  77  GLU GLU A . n 
A 1 78  PHE 78  78  78  PHE PHE A . n 
A 1 79  GLU 79  79  79  GLU GLU A . n 
A 1 80  PRO 80  80  80  PRO PRO A . n 
A 1 81  LEU 81  81  81  LEU LEU A . n 
A 1 82  THR 82  82  82  THR THR A . n 
A 1 83  GLU 83  83  83  GLU GLU A . n 
A 1 84  ASP 84  84  84  ASP ASP A . n 
A 1 85  MET 85  85  85  MET MET A . n 
A 1 86  ASP 86  86  86  ASP ASP A . n 
A 1 87  GLN 87  87  87  GLN GLN A . n 
A 1 88  TYR 88  88  88  TYR TYR A . n 
A 1 89  GLN 89  89  89  GLN GLN A . n 
A 1 90  GLU 90  90  90  GLU GLU A . n 
A 1 91  GLY 91  91  91  GLY GLY A . n 
A 1 92  CYS 92  92  92  CYS CYS A . n 
A 1 93  LEU 93  93  93  LEU LEU A . n 
A 1 94  SER 94  94  94  SER SER A . n 
A 1 95  VAL 95  95  95  VAL VAL A . n 
A 1 96  PRO 96  96  96  PRO PRO A . n 
A 1 97  GLY 97  97  97  GLY GLY A . n 
A 1 98  PHE 98  98  98  PHE PHE A . n 
A 1 99  TYR 99  99  99  TYR TYR A . n 
A 1 100 GLU 100 100 100 GLU GLU A . n 
A 1 101 ASN 101 101 101 ASN ASN A . n 
A 1 102 VAL 102 102 102 VAL VAL A . n 
A 1 103 ASP 103 103 103 ASP ASP A . n 
A 1 104 ARG 104 104 104 ARG ARG A . n 
A 1 105 PRO 105 105 105 PRO PRO A . n 
A 1 106 GLN 106 106 106 GLN GLN A . n 
A 1 107 LYS 107 107 107 LYS LYS A . n 
A 1 108 VAL 108 108 108 VAL VAL A . n 
A 1 109 ARG 109 109 109 ARG ARG A . n 
A 1 110 ILE 110 110 110 ILE ILE A . n 
A 1 111 LYS 111 111 111 LYS LYS A . n 
A 1 112 ALA 112 112 112 ALA ALA A . n 
A 1 113 LEU 113 113 113 LEU LEU A . n 
A 1 114 ASP 114 114 114 ASP ASP A . n 
A 1 115 ARG 115 115 115 ARG ARG A . n 
A 1 116 ASP 116 116 116 ASP ASP A . n 
A 1 117 GLY 117 117 117 GLY GLY A . n 
A 1 118 ASN 118 118 118 ASN ASN A . n 
A 1 119 PRO 119 119 119 PRO PRO A . n 
A 1 120 PHE 120 120 120 PHE PHE A . n 
A 1 121 GLU 121 121 121 GLU GLU A . n 
A 1 122 GLU 122 122 122 GLU GLU A . n 
A 1 123 VAL 123 123 123 VAL VAL A . n 
A 1 124 ALA 124 124 124 ALA ALA A . n 
A 1 125 GLU 125 125 125 GLU GLU A . n 
A 1 126 GLY 126 126 126 GLY GLY A . n 
A 1 127 LEU 127 127 127 LEU LEU A . n 
A 1 128 LEU 128 128 128 LEU LEU A . n 
A 1 129 ALA 129 129 129 ALA ALA A . n 
A 1 130 VAL 130 130 130 VAL VAL A . n 
A 1 131 CYS 131 131 131 CYS CYS A . n 
A 1 132 ILE 132 132 132 ILE ILE A . n 
A 1 133 GLN 133 133 133 GLN GLN A . n 
A 1 134 HIS 134 134 134 HIS HIS A . n 
A 1 135 GLU 135 135 135 GLU GLU A . n 
A 1 136 CYS 136 136 136 CYS CYS A . n 
A 1 137 ASP 137 137 137 ASP ASP A . n 
A 1 138 HIS 138 138 138 HIS HIS A . n 
A 1 139 LEU 139 139 139 LEU LEU A . n 
A 1 140 ASN 140 140 140 ASN ASN A . n 
A 1 141 GLY 141 141 141 GLY GLY A . n 
A 1 142 LYS 142 142 142 LYS LYS A . n 
A 1 143 LEU 143 143 143 LEU LEU A . n 
A 1 144 PHE 144 144 144 PHE PHE A . n 
A 1 145 VAL 145 145 145 VAL VAL A . n 
A 1 146 ASP 146 146 146 ASP ASP A . n 
A 1 147 TYR 147 147 147 TYR TYR A . n 
A 1 148 LEU 148 148 148 LEU LEU A . n 
A 1 149 SER 149 149 149 SER SER A . n 
A 1 150 THR 150 150 150 THR THR A . n 
A 1 151 LEU 151 151 151 LEU LEU A . n 
A 1 152 LYS 152 152 152 LYS LYS A . n 
A 1 153 ARG 153 153 153 ARG ARG A . n 
A 1 154 ASP 154 154 154 ASP ASP A . n 
A 1 155 ARG 155 155 155 ARG ARG A . n 
A 1 156 ILE 156 156 156 ILE ILE A . n 
A 1 157 ARG 157 157 157 ARG ARG A . n 
A 1 158 LYS 158 158 158 LYS LYS A . n 
A 1 159 LYS 159 159 159 LYS LYS A . n 
A 1 160 LEU 160 160 160 LEU LEU A . n 
A 1 161 GLU 161 161 161 GLU GLU A . n 
A 1 162 LYS 162 162 162 LYS LYS A . n 
A 1 163 GLN 163 163 163 GLN GLN A . n 
A 1 164 HIS 164 164 164 HIS HIS A . n 
A 1 165 ARG 165 165 165 ARG ARG A . n 
A 1 166 GLN 166 166 166 GLN GLN A . n 
A 1 167 GLN 167 167 167 GLN GLN A . n 
A 1 168 ALA 168 168 168 ALA ALA A . n 
B 2 1   ASP 1   1   1   ASP ASP B . n 
B 2 2   TYR 2   2   2   TYR TYR B . n 
B 2 3   ILE 3   3   3   ILE ILE B . n 
B 2 4   ARG 4   4   4   ARG ARG B . n 
B 2 5   GLU 5   5   5   GLU GLU B . n 
B 2 6   LEU 6   6   6   LEU LEU B . n 
B 2 7   ARG 7   7   7   ARG ARG B . n 
B 2 8   ALA 8   8   8   ALA ALA B . n 
B 2 9   ALA 9   9   9   ALA ALA B . n 
B 2 10  LEU 10  10  10  LEU LEU B . n 
B 2 11  ILE 11  11  11  ILE ILE B . n 
B 2 12  LEU 12  12  12  LEU LEU B . n 
B 2 13  LEU 13  13  13  LEU LEU B . n 
B 2 14  ALA 14  14  14  ALA ALA B . n 
B 2 15  LEU 15  15  15  LEU LEU B . n 
B 2 16  LYS 16  16  16  LYS LYS B . n 
B 2 17  LYS 17  17  17  LYS LYS B . n 
B 2 18  GLN 18  18  18  GLN GLN B . n 
B 2 19  HIS 19  19  19  HIS HIS B . n 
B 2 20  ALA 20  20  20  ALA ALA B . n 
B 2 21  GLU 21  21  21  GLU GLU B . n 
B 2 22  ASP 22  22  22  ASP ASP B . n 
B 2 23  PRO 23  23  23  PRO PRO B . n 
B 2 24  ASP 24  24  24  ASP ASP B . n 
B 2 25  ALA 25  25  25  ALA ALA B . n 
B 2 26  GLN 26  26  26  GLN GLN B . n 
B 2 27  ARG 27  27  27  ARG ARG B . n 
B 2 28  VAL 28  28  28  VAL VAL B . n 
B 2 29  ALA 29  29  29  ALA ALA B . n 
B 2 30  ASP 30  30  30  ASP ASP B . n 
B 2 31  GLU 31  31  31  GLU GLU B . n 
B 2 32  LEU 32  32  32  LEU LEU B . n 
B 2 33  MET 33  33  33  MET MET B . n 
B 2 34  LYS 34  34  34  LYS LYS B . n 
B 2 35  LYS 35  35  35  LYS LYS B . n 
B 2 36  LEU 36  36  36  LEU LEU B . n 
B 2 37  PHE 37  37  37  PHE PHE B . n 
B 2 38  ASP 38  38  38  ASP ASP B . n 
B 2 39  ALA 39  39  39  ALA ALA B . n 
B 2 40  ALA 40  40  40  ALA ALA B . n 
B 2 41  HIS 41  41  41  HIS HIS B . n 
B 2 42  ARG 42  42  42  ARG ARG B . n 
B 2 43  ASN 43  43  43  ASN ASN B . n 
B 2 44  ASP 44  44  44  ASP ASP B . n 
B 2 45  LYS 45  45  45  LYS LYS B . n 
B 2 46  ASP 46  46  46  ASP ASP B . n 
B 2 47  LYS 47  47  47  LYS LYS B . n 
B 2 48  VAL 48  48  48  VAL VAL B . n 
B 2 49  LYS 49  49  49  LYS LYS B . n 
B 2 50  LYS 50  50  50  LYS LYS B . n 
B 2 51  VAL 51  51  51  VAL VAL B . n 
B 2 52  VAL 52  52  52  VAL VAL B . n 
B 2 53  GLU 53  53  53  GLU GLU B . n 
B 2 54  GLU 54  54  54  GLU GLU B . n 
B 2 55  ALA 55  55  55  ALA ALA B . n 
B 2 56  LYS 56  56  56  LYS LYS B . n 
B 2 57  LYS 57  57  57  LYS LYS B . n 
B 2 58  VAL 58  58  58  VAL VAL B . n 
B 2 59  VAL 59  59  59  VAL VAL B . n 
B 2 60  SER 60  60  60  SER SER B . n 
B 2 61  THR 61  61  61  THR THR B . n 
B 2 62  TYR 62  62  ?   ?   ?   B . n 
B 2 63  GLY 63  63  ?   ?   ?   B . n 
B 2 64  SER 64  64  ?   ?   ?   B . n 
B 2 65  HIS 65  65  ?   ?   ?   B . n 
B 2 66  HIS 66  66  ?   ?   ?   B . n 
B 2 67  HIS 67  67  ?   ?   ?   B . n 
B 2 68  HIS 68  68  ?   ?   ?   B . n 
B 2 69  HIS 69  69  ?   ?   ?   B . n 
B 2 70  HIS 70  70  ?   ?   ?   B . n 
# 
_pdbx_entity_instance_feature.ordinal        1 
_pdbx_entity_instance_feature.comp_id        BB2 
_pdbx_entity_instance_feature.asym_id        ? 
_pdbx_entity_instance_feature.seq_num        ? 
_pdbx_entity_instance_feature.auth_comp_id   BB2 
_pdbx_entity_instance_feature.auth_asym_id   ? 
_pdbx_entity_instance_feature.auth_seq_num   ? 
_pdbx_entity_instance_feature.feature_type   'SUBJECT OF INVESTIGATION' 
_pdbx_entity_instance_feature.details        ? 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 3 ZN  1  201 197 ZN  ZN  A . 
D 4 BB2 1  202 199 BB2 BB2 A . 
E 5 FMT 1  203 200 FMT FMT A . 
F 5 FMT 1  204 201 FMT FMT A . 
G 5 FMT 1  205 202 FMT FMT A . 
H 5 FMT 1  206 203 FMT FMT A . 
I 5 FMT 1  207 204 FMT FMT A . 
J 5 FMT 1  208 205 FMT FMT A . 
K 5 FMT 1  209 206 FMT FMT A . 
L 5 FMT 1  210 101 FMT FMT A . 
M 6 PO4 1  211 1   PO4 PO4 A . 
N 6 PO4 1  212 2   PO4 PO4 A . 
O 6 PO4 1  213 3   PO4 PO4 A . 
P 6 PO4 1  214 4   PO4 PO4 A . 
Q 7 K   1  101 1   K   K   B . 
R 8 HOH 1  301 76  HOH HOH A . 
R 8 HOH 2  302 49  HOH HOH A . 
R 8 HOH 3  303 23  HOH HOH A . 
R 8 HOH 4  304 70  HOH HOH A . 
R 8 HOH 5  305 6   HOH HOH A . 
R 8 HOH 6  306 71  HOH HOH A . 
R 8 HOH 7  307 7   HOH HOH A . 
R 8 HOH 8  308 75  HOH HOH A . 
R 8 HOH 9  309 39  HOH HOH A . 
R 8 HOH 10 310 66  HOH HOH A . 
R 8 HOH 11 311 37  HOH HOH A . 
R 8 HOH 12 312 25  HOH HOH A . 
R 8 HOH 13 313 41  HOH HOH A . 
R 8 HOH 14 314 65  HOH HOH A . 
R 8 HOH 15 315 53  HOH HOH A . 
R 8 HOH 16 316 1   HOH HOH A . 
R 8 HOH 17 317 24  HOH HOH A . 
R 8 HOH 18 318 5   HOH HOH A . 
R 8 HOH 19 319 63  HOH HOH A . 
R 8 HOH 20 320 11  HOH HOH A . 
R 8 HOH 21 321 47  HOH HOH A . 
R 8 HOH 22 322 46  HOH HOH A . 
R 8 HOH 23 323 19  HOH HOH A . 
R 8 HOH 24 324 60  HOH HOH A . 
R 8 HOH 25 325 40  HOH HOH A . 
R 8 HOH 26 326 3   HOH HOH A . 
R 8 HOH 27 327 64  HOH HOH A . 
R 8 HOH 28 328 22  HOH HOH A . 
R 8 HOH 29 329 2   HOH HOH A . 
R 8 HOH 30 330 30  HOH HOH A . 
R 8 HOH 31 331 20  HOH HOH A . 
R 8 HOH 32 332 61  HOH HOH A . 
R 8 HOH 33 333 9   HOH HOH A . 
R 8 HOH 34 334 59  HOH HOH A . 
R 8 HOH 35 335 15  HOH HOH A . 
R 8 HOH 36 336 33  HOH HOH A . 
R 8 HOH 37 337 43  HOH HOH A . 
R 8 HOH 38 338 55  HOH HOH A . 
R 8 HOH 39 339 42  HOH HOH A . 
R 8 HOH 40 340 69  HOH HOH A . 
R 8 HOH 41 341 12  HOH HOH A . 
R 8 HOH 42 342 44  HOH HOH A . 
R 8 HOH 43 343 32  HOH HOH A . 
R 8 HOH 44 344 38  HOH HOH A . 
R 8 HOH 45 345 57  HOH HOH A . 
R 8 HOH 46 346 18  HOH HOH A . 
R 8 HOH 47 347 4   HOH HOH A . 
R 8 HOH 48 348 73  HOH HOH A . 
R 8 HOH 49 349 17  HOH HOH A . 
R 8 HOH 50 350 13  HOH HOH A . 
R 8 HOH 51 351 8   HOH HOH A . 
R 8 HOH 52 352 21  HOH HOH A . 
R 8 HOH 53 353 27  HOH HOH A . 
R 8 HOH 54 354 28  HOH HOH A . 
R 8 HOH 55 355 34  HOH HOH A . 
R 8 HOH 56 356 58  HOH HOH A . 
R 8 HOH 57 357 56  HOH HOH A . 
R 8 HOH 58 358 74  HOH HOH A . 
R 8 HOH 59 359 10  HOH HOH A . 
R 8 HOH 60 360 36  HOH HOH A . 
R 8 HOH 61 361 14  HOH HOH A . 
R 8 HOH 62 362 67  HOH HOH A . 
R 8 HOH 63 363 16  HOH HOH A . 
R 8 HOH 64 364 54  HOH HOH A . 
R 8 HOH 65 365 45  HOH HOH A . 
R 8 HOH 66 366 48  HOH HOH A . 
R 8 HOH 67 367 62  HOH HOH A . 
R 8 HOH 68 368 35  HOH HOH A . 
S 8 HOH 1  201 52  HOH HOH B . 
S 8 HOH 2  202 51  HOH HOH B . 
S 8 HOH 3  203 31  HOH HOH B . 
S 8 HOH 4  204 72  HOH HOH B . 
S 8 HOH 5  205 29  HOH HOH B . 
S 8 HOH 6  206 26  HOH HOH B . 
S 8 HOH 7  207 68  HOH HOH B . 
S 8 HOH 8  208 50  HOH HOH B . 
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? refinement       ? ? ? ? ? ? ? ? ? ? ? PHENIX   ? ? ? 1.21_5184 1 
? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? autoPROC ? ? ? .         2 
? 'data scaling'   ? ? ? ? ? ? ? ? ? ? ? autoPROC ? ? ? .         3 
? phasing          ? ? ? ? ? ? ? ? ? ? ? PHASER   ? ? ? .         4 
# 
_cell.angle_alpha                  90.000 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.000 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.000 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     8S1X 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     49.440 
_cell.length_a_esd                 ? 
_cell.length_b                     75.010 
_cell.length_b_esd                 ? 
_cell.length_c                     83.160 
_cell.length_c_esd                 ? 
_cell.volume                       308398.394 
_cell.volume_esd                   ? 
_cell.Z_PDB                        4 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
_cell.pdbx_esd_method              ? 
# 
_symmetry.entry_id                         8S1X 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            'P 2ac 2ab' 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   8S1X 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                       ? 
_exptl_crystal.density_diffrn               ? 
_exptl_crystal.density_Matthews             2.80 
_exptl_crystal.density_method               ? 
_exptl_crystal.density_percent_sol          56.06 
_exptl_crystal.description                  ? 
_exptl_crystal.F_000                        ? 
_exptl_crystal.id                           1 
_exptl_crystal.preparation                  ? 
_exptl_crystal.size_max                     ? 
_exptl_crystal.size_mid                     ? 
_exptl_crystal.size_min                     ? 
_exptl_crystal.size_rad                     ? 
_exptl_crystal.colour_lustre                ? 
_exptl_crystal.colour_modifier              ? 
_exptl_crystal.colour_primary               ? 
_exptl_crystal.density_meas                 ? 
_exptl_crystal.density_meas_esd             ? 
_exptl_crystal.density_meas_gt              ? 
_exptl_crystal.density_meas_lt              ? 
_exptl_crystal.density_meas_temp            ? 
_exptl_crystal.density_meas_temp_esd        ? 
_exptl_crystal.density_meas_temp_gt         ? 
_exptl_crystal.density_meas_temp_lt         ? 
_exptl_crystal.pdbx_crystal_image_url       ? 
_exptl_crystal.pdbx_crystal_image_format    ? 
_exptl_crystal.pdbx_mosaicity               ? 
_exptl_crystal.pdbx_mosaicity_esd           ? 
_exptl_crystal.pdbx_mosaic_method           ? 
_exptl_crystal.pdbx_mosaic_block_size       ? 
_exptl_crystal.pdbx_mosaic_block_size_esd   ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              6.2 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '0.2 M Sodium Formate, 0.1 M Sodium Phosphate pH 6.2, 20% (v/v) PEG smear, 10% (v/v) glycerol' 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.temp            291.15 
# 
_diffrn.ambient_environment              ? 
_diffrn.ambient_temp                     100 
_diffrn.ambient_temp_details             ? 
_diffrn.ambient_temp_esd                 ? 
_diffrn.crystal_id                       1 
_diffrn.crystal_support                  ? 
_diffrn.crystal_treatment                ? 
_diffrn.details                          ? 
_diffrn.id                               1 
_diffrn.ambient_pressure                 ? 
_diffrn.ambient_pressure_esd             ? 
_diffrn.ambient_pressure_gt              ? 
_diffrn.ambient_pressure_lt              ? 
_diffrn.ambient_temp_gt                  ? 
_diffrn.ambient_temp_lt                  ? 
_diffrn.pdbx_serial_crystal_experiment   N 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     PIXEL 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'DECTRIS PILATUS3 2M' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2024-02-11 
_diffrn_detector.pdbx_frequency               ? 
_diffrn_detector.id                           ? 
_diffrn_detector.number_of_axes               ? 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.87313 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'ESRF BEAMLINE MASSIF-1' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.87313 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   MASSIF-1 
_diffrn_source.pdbx_synchrotron_site       ESRF 
# 
_reflns.B_iso_Wilson_estimate                          44.77 
_reflns.entry_id                                       8S1X 
_reflns.data_reduction_details                         ? 
_reflns.data_reduction_method                          ? 
_reflns.d_resolution_high                              1.88 
_reflns.d_resolution_low                               55.7 
_reflns.details                                        ? 
_reflns.limit_h_max                                    ? 
_reflns.limit_h_min                                    ? 
_reflns.limit_k_max                                    ? 
_reflns.limit_k_min                                    ? 
_reflns.limit_l_max                                    ? 
_reflns.limit_l_min                                    ? 
_reflns.number_all                                     ? 
_reflns.number_obs                                     24990 
_reflns.observed_criterion                             ? 
_reflns.observed_criterion_F_max                       ? 
_reflns.observed_criterion_F_min                       ? 
_reflns.observed_criterion_I_max                       ? 
_reflns.observed_criterion_I_min                       ? 
_reflns.observed_criterion_sigma_F                     ? 
_reflns.observed_criterion_sigma_I                     ? 
_reflns.percent_possible_obs                           96.9 
_reflns.R_free_details                                 ? 
_reflns.Rmerge_F_all                                   ? 
_reflns.Rmerge_F_obs                                   ? 
_reflns.Friedel_coverage                               ? 
_reflns.number_gt                                      ? 
_reflns.threshold_expression                           ? 
_reflns.pdbx_redundancy                                4.3 
_reflns.pdbx_netI_over_av_sigmaI                       ? 
_reflns.pdbx_netI_over_sigmaI                          15.0 
_reflns.pdbx_res_netI_over_av_sigmaI_2                 ? 
_reflns.pdbx_res_netI_over_sigmaI_2                    ? 
_reflns.pdbx_chi_squared                               ? 
_reflns.pdbx_scaling_rejects                           ? 
_reflns.pdbx_d_res_high_opt                            ? 
_reflns.pdbx_d_res_low_opt                             ? 
_reflns.pdbx_d_res_opt_method                          ? 
_reflns.phase_calculation_details                      ? 
_reflns.pdbx_Rrim_I_all                                ? 
_reflns.pdbx_Rpim_I_all                                ? 
_reflns.pdbx_d_opt                                     ? 
_reflns.pdbx_number_measured_all                       ? 
_reflns.pdbx_diffrn_id                                 1 
_reflns.pdbx_ordinal                                   1 
_reflns.pdbx_CC_half                                   0.999 
_reflns.pdbx_CC_star                                   ? 
_reflns.pdbx_R_split                                   ? 
_reflns.pdbx_Rmerge_I_obs                              0.044 
_reflns.pdbx_Rmerge_I_all                              ? 
_reflns.pdbx_Rsym_value                                ? 
_reflns.pdbx_CC_split_method                           ? 
_reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1]   ? 
_reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2]   ? 
_reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3]   ? 
_reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1]   ? 
_reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2]   ? 
_reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3]   ? 
_reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1]   ? 
_reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2]   ? 
_reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3]   ? 
_reflns.pdbx_aniso_diffraction_limit_1                 ? 
_reflns.pdbx_aniso_diffraction_limit_2                 ? 
_reflns.pdbx_aniso_diffraction_limit_3                 ? 
_reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1]     ? 
_reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2]     ? 
_reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3]     ? 
_reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1]     ? 
_reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2]     ? 
_reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3]     ? 
_reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1]     ? 
_reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2]     ? 
_reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3]     ? 
_reflns.pdbx_aniso_B_tensor_eigenvalue_1               ? 
_reflns.pdbx_aniso_B_tensor_eigenvalue_2               ? 
_reflns.pdbx_aniso_B_tensor_eigenvalue_3               ? 
_reflns.pdbx_orthogonalization_convention              ? 
_reflns.pdbx_percent_possible_ellipsoidal              ? 
_reflns.pdbx_percent_possible_spherical                ? 
_reflns.pdbx_percent_possible_ellipsoidal_anomalous    ? 
_reflns.pdbx_percent_possible_spherical_anomalous      ? 
_reflns.pdbx_redundancy_anomalous                      ? 
_reflns.pdbx_CC_half_anomalous                         ? 
_reflns.pdbx_absDiff_over_sigma_anomalous              ? 
_reflns.pdbx_percent_possible_anomalous                ? 
_reflns.pdbx_observed_signal_threshold                 ? 
_reflns.pdbx_signal_type                               ? 
_reflns.pdbx_signal_details                            ? 
_reflns.pdbx_signal_software_id                        ? 
# 
_reflns_shell.d_res_high                                    1.88 
_reflns_shell.d_res_low                                     1.91 
_reflns_shell.meanI_over_sigI_all                           ? 
_reflns_shell.meanI_over_sigI_obs                           1.3 
_reflns_shell.number_measured_all                           ? 
_reflns_shell.number_measured_obs                           ? 
_reflns_shell.number_possible                               ? 
_reflns_shell.number_unique_all                             ? 
_reflns_shell.number_unique_obs                             1266 
_reflns_shell.percent_possible_obs                          ? 
_reflns_shell.Rmerge_F_all                                  ? 
_reflns_shell.Rmerge_F_obs                                  ? 
_reflns_shell.meanI_over_sigI_gt                            ? 
_reflns_shell.meanI_over_uI_all                             ? 
_reflns_shell.meanI_over_uI_gt                              ? 
_reflns_shell.number_measured_gt                            ? 
_reflns_shell.number_unique_gt                              ? 
_reflns_shell.percent_possible_gt                           ? 
_reflns_shell.Rmerge_F_gt                                   ? 
_reflns_shell.Rmerge_I_gt                                   ? 
_reflns_shell.pdbx_redundancy                               4.4 
_reflns_shell.pdbx_chi_squared                              ? 
_reflns_shell.pdbx_netI_over_sigmaI_all                     ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs                     ? 
_reflns_shell.pdbx_Rrim_I_all                               ? 
_reflns_shell.pdbx_Rpim_I_all                               ? 
_reflns_shell.pdbx_rejects                                  ? 
_reflns_shell.pdbx_ordinal                                  1 
_reflns_shell.pdbx_diffrn_id                                1 
_reflns_shell.pdbx_CC_half                                  0.426 
_reflns_shell.pdbx_CC_star                                  ? 
_reflns_shell.pdbx_R_split                                  ? 
_reflns_shell.percent_possible_all                          99.6 
_reflns_shell.Rmerge_I_all                                  ? 
_reflns_shell.Rmerge_I_obs                                  1.125 
_reflns_shell.pdbx_Rsym_value                               ? 
_reflns_shell.pdbx_percent_possible_ellipsoidal             ? 
_reflns_shell.pdbx_percent_possible_spherical               ? 
_reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous   ? 
_reflns_shell.pdbx_percent_possible_spherical_anomalous     ? 
_reflns_shell.pdbx_redundancy_anomalous                     ? 
_reflns_shell.pdbx_CC_half_anomalous                        ? 
_reflns_shell.pdbx_absDiff_over_sigma_anomalous             ? 
_reflns_shell.pdbx_percent_possible_anomalous               ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               57.21 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 8S1X 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            1.88 
_refine.ls_d_res_low                             55.70 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     24982 
_refine.ls_number_reflns_R_free                  1255 
_refine.ls_number_reflns_R_work                  23727 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    96.83 
_refine.ls_percent_reflns_R_free                 5.02 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.1846 
_refine.ls_R_factor_R_free                       0.2027 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.1837 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.pdbx_R_complete                          ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.34 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_stereochemistry_target_values       'GeoStd + Monomer Library + CDL v1.2' 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.1000 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.9000 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 21.4881 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.2366 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.details                          ? 
_refine_hist.d_res_high                       1.88 
_refine_hist.d_res_low                        55.70 
_refine_hist.number_atoms_solvent             76 
_refine_hist.number_atoms_total               1991 
_refine_hist.number_reflns_all                ? 
_refine_hist.number_reflns_obs                ? 
_refine_hist.number_reflns_R_free             ? 
_refine_hist.number_reflns_R_work             ? 
_refine_hist.R_factor_all                     ? 
_refine_hist.R_factor_obs                     ? 
_refine_hist.R_factor_R_free                  ? 
_refine_hist.R_factor_R_work                  ? 
_refine_hist.pdbx_number_residues_total       ? 
_refine_hist.pdbx_B_iso_mean_ligand           ? 
_refine_hist.pdbx_B_iso_mean_solvent          ? 
_refine_hist.pdbx_number_atoms_protein        1842 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         73 
_refine_hist.pdbx_number_atoms_lipid          ? 
_refine_hist.pdbx_number_atoms_carb           ? 
_refine_hist.pdbx_pseudo_atom_details         ? 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.0064  ? 1939 ? f_bond_d           ? ? 
'X-RAY DIFFRACTION' ? 0.7791  ? 2604 ? f_angle_d          ? ? 
'X-RAY DIFFRACTION' ? 0.0509  ? 289  ? f_chiral_restr     ? ? 
'X-RAY DIFFRACTION' ? 0.0093  ? 339  ? f_plane_restr      ? ? 
'X-RAY DIFFRACTION' ? 15.6309 ? 777  ? f_dihedral_angle_d ? ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_R_complete 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
_refine_ls_shell.pdbx_fsc_work 
_refine_ls_shell.pdbx_fsc_free 
_refine_ls_shell.R_factor_R_free 
'X-RAY DIFFRACTION' 1.88 1.96  . . 149 2652 99.26 . . . . 0.3037 . . . . . . . . . . . 0.3416 
'X-RAY DIFFRACTION' 1.96 2.05  . . 133 2642 98.44 . . . . 0.2772 . . . . . . . . . . . 0.2812 
'X-RAY DIFFRACTION' 2.05 2.15  . . 145 2647 98.52 . . . . 0.2319 . . . . . . . . . . . 0.2773 
'X-RAY DIFFRACTION' 2.15 2.29  . . 147 2598 97.90 . . . . 0.1979 . . . . . . . . . . . 0.2435 
'X-RAY DIFFRACTION' 2.29 2.46  . . 146 2638 98.10 . . . . 0.1906 . . . . . . . . . . . 0.1866 
'X-RAY DIFFRACTION' 2.46 2.71  . . 134 2646 97.17 . . . . 0.1961 . . . . . . . . . . . 0.2393 
'X-RAY DIFFRACTION' 2.71 3.11  . . 139 2626 95.84 . . . . 0.1896 . . . . . . . . . . . 0.2045 
'X-RAY DIFFRACTION' 3.11 3.91  . . 151 2557 93.70 . . . . 0.1723 . . . . . . . . . . . 0.1775 
'X-RAY DIFFRACTION' 3.91 55.70 . . 111 2721 92.97 . . . . 0.1675 . . . . . . . . . . . 0.1874 
# 
_struct.entry_id                     8S1X 
_struct.title                        
'Crystal structure of Actinonin-bound PDF1 and the computationally designed DBAct553_1 protein binder' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        8S1X 
_struct_keywords.text            'Actinonin, de novo, computational, binder, CID, switch, deformylase, DE NOVO PROTEIN' 
_struct_keywords.pdbx_keywords   'DE NOVO PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
F N N 5 ? 
G N N 5 ? 
H N N 5 ? 
I N N 5 ? 
J N N 5 ? 
K N N 5 ? 
L N N 5 ? 
M N N 6 ? 
N N N 6 ? 
O N N 6 ? 
P N N 6 ? 
Q N N 7 ? 
R N N 8 ? 
S N N 8 ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP DEF_PSEAE Q9I7A8 ? 1 
;MAILNILEFPDPRLRTIAKPVEVVDDAVRQLIDDMFETMYEAPGIGLAATQVNVHKRIVVMDLSEDKSEPRVFINPEFEP
LTEDMDQYQEGCLSVPGFYENVDRPQKVRIKALDRDGNPFEEVAEGLLAVCIQHECDHLNGKLFVDYLSTLKRDRIRKKL
EKQHRQQA
;
1 
2 PDB 8S1X      8S1X   ? 2 ? 1 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 8S1X A 1 ? 168 ? Q9I7A8 1 ? 168 ? 1 168 
2 2 8S1X B 1 ? 70  ? 8S1X   1 ? 70  ? 1 70  
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 4730  ? 
1 MORE         -67   ? 
1 'SSA (A^2)'  11590 ? 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J,K,L,M,N,O,P,Q,R,S 
# 
_pdbx_struct_assembly_auth_evidence.id                     1 
_pdbx_struct_assembly_auth_evidence.assembly_id            1 
_pdbx_struct_assembly_auth_evidence.experimental_support   'gel filtration' 
_pdbx_struct_assembly_auth_evidence.details                ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 AA1 ASP A 11  ? THR A 16  ? ASP A 11  THR A 16  5 ? 6  
HELX_P HELX_P2 AA2 ASP A 25  ? ALA A 42  ? ASP A 25  ALA A 42  1 ? 18 
HELX_P HELX_P3 AA3 THR A 50  ? ASN A 53  ? THR A 50  ASN A 53  5 ? 4  
HELX_P HELX_P4 AA4 GLY A 126 ? ASN A 140 ? GLY A 126 ASN A 140 1 ? 15 
HELX_P HELX_P5 AA5 LEU A 143 ? LEU A 148 ? LEU A 143 LEU A 148 5 ? 6  
HELX_P HELX_P6 AA6 SER A 149 ? ALA A 168 ? SER A 149 ALA A 168 1 ? 20 
HELX_P HELX_P7 AA7 TYR B 2   ? ALA B 20  ? TYR B 2   ALA B 20  1 ? 19 
HELX_P HELX_P8 AA8 ASP B 22  ? ARG B 42  ? ASP B 22  ARG B 42  1 ? 21 
HELX_P HELX_P9 AA9 ASP B 44  ? SER B 60  ? ASP B 44  SER B 60  1 ? 17 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
metalc1 metalc ? ? A CYS 92  SG  ? ? ? 1_555 C ZN  . ZN ? ? A CYS 92  A ZN  201 1_555 ? ? ? ? ? ? ? 2.274 ? ? 
metalc2 metalc ? ? A TYR 99  O   ? ? ? 1_555 Q K   . K  ? ? A TYR 99  B K   101 1_555 ? ? ? ? ? ? ? 3.275 ? ? 
metalc3 metalc ? ? A HIS 134 NE2 ? ? ? 1_555 C ZN  . ZN ? ? A HIS 134 A ZN  201 1_555 ? ? ? ? ? ? ? 2.172 ? ? 
metalc4 metalc ? ? A HIS 138 NE2 ? ? ? 1_555 C ZN  . ZN ? ? A HIS 138 A ZN  201 1_555 ? ? ? ? ? ? ? 2.215 ? ? 
metalc5 metalc ? ? C ZN  .   ZN  ? ? ? 1_555 D BB2 . O2 ? ? A ZN  201 A BB2 202 1_555 ? ? ? ? ? ? ? 2.200 ? ? 
metalc6 metalc ? ? C ZN  .   ZN  ? ? ? 1_555 D BB2 . O4 ? ? A ZN  201 A BB2 202 1_555 ? ? ? ? ? ? ? 2.200 ? ? 
metalc7 metalc ? ? R HOH .   O   ? ? ? 1_555 Q K   . K  ? ? A HOH 314 B K   101 1_555 ? ? ? ? ? ? ? 3.085 ? ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  SG  ? A CYS 92  ? A CYS 92  ? 1_555 ZN ? C ZN . ? A ZN 201 ? 1_555 NE2 ? A HIS 134 ? A HIS 134 ? 1_555 104.4 ? 
2  SG  ? A CYS 92  ? A CYS 92  ? 1_555 ZN ? C ZN . ? A ZN 201 ? 1_555 NE2 ? A HIS 138 ? A HIS 138 ? 1_555 91.6  ? 
3  NE2 ? A HIS 134 ? A HIS 134 ? 1_555 ZN ? C ZN . ? A ZN 201 ? 1_555 NE2 ? A HIS 138 ? A HIS 138 ? 1_555 98.9  ? 
4  SG  ? A CYS 92  ? A CYS 92  ? 1_555 ZN ? C ZN . ? A ZN 201 ? 1_555 O2  ? D BB2 .   ? A BB2 202 ? 1_555 158.8 ? 
5  NE2 ? A HIS 134 ? A HIS 134 ? 1_555 ZN ? C ZN . ? A ZN 201 ? 1_555 O2  ? D BB2 .   ? A BB2 202 ? 1_555 95.8  ? 
6  NE2 ? A HIS 138 ? A HIS 138 ? 1_555 ZN ? C ZN . ? A ZN 201 ? 1_555 O2  ? D BB2 .   ? A BB2 202 ? 1_555 91.5  ? 
7  SG  ? A CYS 92  ? A CYS 92  ? 1_555 ZN ? C ZN . ? A ZN 201 ? 1_555 O4  ? D BB2 .   ? A BB2 202 ? 1_555 91.2  ? 
8  NE2 ? A HIS 134 ? A HIS 134 ? 1_555 ZN ? C ZN . ? A ZN 201 ? 1_555 O4  ? D BB2 .   ? A BB2 202 ? 1_555 111.8 ? 
9  NE2 ? A HIS 138 ? A HIS 138 ? 1_555 ZN ? C ZN . ? A ZN 201 ? 1_555 O4  ? D BB2 .   ? A BB2 202 ? 1_555 147.4 ? 
10 O2  ? D BB2 .   ? A BB2 202 ? 1_555 ZN ? C ZN . ? A ZN 201 ? 1_555 O4  ? D BB2 .   ? A BB2 202 ? 1_555 75.2  ? 
11 O   ? A TYR 99  ? A TYR 99  ? 1_555 K  ? Q K  . ? B K  101 ? 1_555 O   ? R HOH .   ? A HOH 314 ? 1_555 67.8  ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 PHE 9  A . ? PHE 9  A PRO 10 A ? PRO 10 A 1 5.34  
2 ALA 42 A . ? ALA 42 A PRO 43 A ? PRO 43 A 1 -7.64 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 5 ? 
AA2 ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA1 3 4 ? anti-parallel 
AA1 4 5 ? anti-parallel 
AA2 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 GLY A 46  ? ALA A 48  ? GLY A 46  ALA A 48  
AA1 2 ILE A 58  ? ASP A 62  ? ILE A 58  ASP A 62  
AA1 3 PRO A 70  ? PRO A 80  ? PRO A 70  PRO A 80  
AA1 4 LYS A 107 ? LEU A 113 ? LYS A 107 LEU A 113 
AA1 5 PRO A 119 ? GLU A 125 ? PRO A 119 GLU A 125 
AA2 1 ASP A 86  ? GLU A 90  ? ASP A 86  GLU A 90  
AA2 2 GLU A 100 ? ARG A 104 ? GLU A 100 ARG A 104 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N LEU A 47  ? N LEU A 47  O VAL A 60  ? O VAL A 60  
AA1 2 3 N MET A 61  ? N MET A 61  O ARG A 71  ? O ARG A 71  
AA1 3 4 N GLU A 79  ? N GLU A 79  O ARG A 109 ? O ARG A 109 
AA1 4 5 N ILE A 110 ? N ILE A 110 O GLU A 122 ? O GLU A 122 
AA2 1 2 N ASP A 86  ? N ASP A 86  O ARG A 104 ? O ARG A 104 
# 
_pdbx_entry_details.entry_id                   8S1X 
_pdbx_entry_details.has_ligand_of_interest     Y 
_pdbx_entry_details.compound_details           ? 
_pdbx_entry_details.source_details             ? 
_pdbx_entry_details.nonpolymer_details         ? 
_pdbx_entry_details.sequence_details           ? 
_pdbx_entry_details.has_protein_modification   N 
# 
_pdbx_validate_torsion.id              1 
_pdbx_validate_torsion.PDB_model_num   1 
_pdbx_validate_torsion.auth_comp_id    PRO 
_pdbx_validate_torsion.auth_asym_id    A 
_pdbx_validate_torsion.auth_seq_id     10 
_pdbx_validate_torsion.PDB_ins_code    ? 
_pdbx_validate_torsion.label_alt_id    ? 
_pdbx_validate_torsion.phi             -95.62 
_pdbx_validate_torsion.psi             34.49 
# 
loop_
_space_group_symop.id 
_space_group_symop.operation_xyz 
1 x,y,z           
2 x+1/2,-y+1/2,-z 
3 -x,y+1/2,-z+1/2 
4 -x+1/2,-y,z+1/2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET 1  ? A MET 1  
2  1 Y 1 B TYR 62 ? B TYR 62 
3  1 Y 1 B GLY 63 ? B GLY 63 
4  1 Y 1 B SER 64 ? B SER 64 
5  1 Y 1 B HIS 65 ? B HIS 65 
6  1 Y 1 B HIS 66 ? B HIS 66 
7  1 Y 1 B HIS 67 ? B HIS 67 
8  1 Y 1 B HIS 68 ? B HIS 68 
9  1 Y 1 B HIS 69 ? B HIS 69 
10 1 Y 1 B HIS 70 ? B HIS 70 
# 
loop_
_chem_comp_atom.comp_id 
_chem_comp_atom.atom_id 
_chem_comp_atom.type_symbol 
_chem_comp_atom.pdbx_aromatic_flag 
_chem_comp_atom.pdbx_stereo_config 
_chem_comp_atom.pdbx_ordinal 
ALA N    N  N N 1   
ALA CA   C  N S 2   
ALA C    C  N N 3   
ALA O    O  N N 4   
ALA CB   C  N N 5   
ALA OXT  O  N N 6   
ALA H    H  N N 7   
ALA H2   H  N N 8   
ALA HA   H  N N 9   
ALA HB1  H  N N 10  
ALA HB2  H  N N 11  
ALA HB3  H  N N 12  
ALA HXT  H  N N 13  
ARG N    N  N N 14  
ARG CA   C  N S 15  
ARG C    C  N N 16  
ARG O    O  N N 17  
ARG CB   C  N N 18  
ARG CG   C  N N 19  
ARG CD   C  N N 20  
ARG NE   N  N N 21  
ARG CZ   C  N N 22  
ARG NH1  N  N N 23  
ARG NH2  N  N N 24  
ARG OXT  O  N N 25  
ARG H    H  N N 26  
ARG H2   H  N N 27  
ARG HA   H  N N 28  
ARG HB2  H  N N 29  
ARG HB3  H  N N 30  
ARG HG2  H  N N 31  
ARG HG3  H  N N 32  
ARG HD2  H  N N 33  
ARG HD3  H  N N 34  
ARG HE   H  N N 35  
ARG HH11 H  N N 36  
ARG HH12 H  N N 37  
ARG HH21 H  N N 38  
ARG HH22 H  N N 39  
ARG HXT  H  N N 40  
ASN N    N  N N 41  
ASN CA   C  N S 42  
ASN C    C  N N 43  
ASN O    O  N N 44  
ASN CB   C  N N 45  
ASN CG   C  N N 46  
ASN OD1  O  N N 47  
ASN ND2  N  N N 48  
ASN OXT  O  N N 49  
ASN H    H  N N 50  
ASN H2   H  N N 51  
ASN HA   H  N N 52  
ASN HB2  H  N N 53  
ASN HB3  H  N N 54  
ASN HD21 H  N N 55  
ASN HD22 H  N N 56  
ASN HXT  H  N N 57  
ASP N    N  N N 58  
ASP CA   C  N S 59  
ASP C    C  N N 60  
ASP O    O  N N 61  
ASP CB   C  N N 62  
ASP CG   C  N N 63  
ASP OD1  O  N N 64  
ASP OD2  O  N N 65  
ASP OXT  O  N N 66  
ASP H    H  N N 67  
ASP H2   H  N N 68  
ASP HA   H  N N 69  
ASP HB2  H  N N 70  
ASP HB3  H  N N 71  
ASP HD2  H  N N 72  
ASP HXT  H  N N 73  
BB2 C5   C  N N 74  
BB2 C3   C  N N 75  
BB2 O4   O  N N 76  
BB2 N1   N  N N 77  
BB2 O2   O  N N 78  
BB2 C6   C  N R 79  
BB2 C12  C  N N 80  
BB2 O13  O  N N 81  
BB2 C7   C  N N 82  
BB2 C8   C  N N 83  
BB2 C9   C  N N 84  
BB2 C10  C  N N 85  
BB2 C11  C  N N 86  
BB2 N14  N  N N 87  
BB2 C15  C  N S 88  
BB2 C16  C  N N 89  
BB2 C18  C  N N 90  
BB2 C17  C  N N 91  
BB2 C19  C  N N 92  
BB2 O20  O  N N 93  
BB2 N21  N  N N 94  
BB2 C22  C  N S 95  
BB2 C23  C  N N 96  
BB2 C24  C  N N 97  
BB2 C25  C  N N 98  
BB2 C26  C  N N 99  
BB2 O27  O  N N 100 
BB2 H51  H  N N 101 
BB2 H52  H  N N 102 
BB2 HN1  H  N N 103 
BB2 HO2  H  N N 104 
BB2 H6   H  N N 105 
BB2 H71  H  N N 106 
BB2 H72  H  N N 107 
BB2 H81  H  N N 108 
BB2 H82  H  N N 109 
BB2 H91  H  N N 110 
BB2 H92  H  N N 111 
BB2 H101 H  N N 112 
BB2 H102 H  N N 113 
BB2 H111 H  N N 114 
BB2 H112 H  N N 115 
BB2 H113 H  N N 116 
BB2 H14  H  N N 117 
BB2 H15  H  N N 118 
BB2 H16  H  N N 119 
BB2 H181 H  N N 120 
BB2 H182 H  N N 121 
BB2 H183 H  N N 122 
BB2 H171 H  N N 123 
BB2 H172 H  N N 124 
BB2 H173 H  N N 125 
BB2 H22  H  N N 126 
BB2 H231 H  N N 127 
BB2 H232 H  N N 128 
BB2 H241 H  N N 129 
BB2 H242 H  N N 130 
BB2 H251 H  N N 131 
BB2 H252 H  N N 132 
BB2 H261 H  N N 133 
BB2 H262 H  N N 134 
BB2 H27  H  N N 135 
CYS N    N  N N 136 
CYS CA   C  N R 137 
CYS C    C  N N 138 
CYS O    O  N N 139 
CYS CB   C  N N 140 
CYS SG   S  N N 141 
CYS OXT  O  N N 142 
CYS H    H  N N 143 
CYS H2   H  N N 144 
CYS HA   H  N N 145 
CYS HB2  H  N N 146 
CYS HB3  H  N N 147 
CYS HG   H  N N 148 
CYS HXT  H  N N 149 
FMT C    C  N N 150 
FMT O1   O  N N 151 
FMT O2   O  N N 152 
FMT H    H  N N 153 
FMT HO2  H  N N 154 
GLN N    N  N N 155 
GLN CA   C  N S 156 
GLN C    C  N N 157 
GLN O    O  N N 158 
GLN CB   C  N N 159 
GLN CG   C  N N 160 
GLN CD   C  N N 161 
GLN OE1  O  N N 162 
GLN NE2  N  N N 163 
GLN OXT  O  N N 164 
GLN H    H  N N 165 
GLN H2   H  N N 166 
GLN HA   H  N N 167 
GLN HB2  H  N N 168 
GLN HB3  H  N N 169 
GLN HG2  H  N N 170 
GLN HG3  H  N N 171 
GLN HE21 H  N N 172 
GLN HE22 H  N N 173 
GLN HXT  H  N N 174 
GLU N    N  N N 175 
GLU CA   C  N S 176 
GLU C    C  N N 177 
GLU O    O  N N 178 
GLU CB   C  N N 179 
GLU CG   C  N N 180 
GLU CD   C  N N 181 
GLU OE1  O  N N 182 
GLU OE2  O  N N 183 
GLU OXT  O  N N 184 
GLU H    H  N N 185 
GLU H2   H  N N 186 
GLU HA   H  N N 187 
GLU HB2  H  N N 188 
GLU HB3  H  N N 189 
GLU HG2  H  N N 190 
GLU HG3  H  N N 191 
GLU HE2  H  N N 192 
GLU HXT  H  N N 193 
GLY N    N  N N 194 
GLY CA   C  N N 195 
GLY C    C  N N 196 
GLY O    O  N N 197 
GLY OXT  O  N N 198 
GLY H    H  N N 199 
GLY H2   H  N N 200 
GLY HA2  H  N N 201 
GLY HA3  H  N N 202 
GLY HXT  H  N N 203 
HIS N    N  N N 204 
HIS CA   C  N S 205 
HIS C    C  N N 206 
HIS O    O  N N 207 
HIS CB   C  N N 208 
HIS CG   C  Y N 209 
HIS ND1  N  Y N 210 
HIS CD2  C  Y N 211 
HIS CE1  C  Y N 212 
HIS NE2  N  Y N 213 
HIS OXT  O  N N 214 
HIS H    H  N N 215 
HIS H2   H  N N 216 
HIS HA   H  N N 217 
HIS HB2  H  N N 218 
HIS HB3  H  N N 219 
HIS HD1  H  N N 220 
HIS HD2  H  N N 221 
HIS HE1  H  N N 222 
HIS HE2  H  N N 223 
HIS HXT  H  N N 224 
HOH O    O  N N 225 
HOH H1   H  N N 226 
HOH H2   H  N N 227 
ILE N    N  N N 228 
ILE CA   C  N S 229 
ILE C    C  N N 230 
ILE O    O  N N 231 
ILE CB   C  N S 232 
ILE CG1  C  N N 233 
ILE CG2  C  N N 234 
ILE CD1  C  N N 235 
ILE OXT  O  N N 236 
ILE H    H  N N 237 
ILE H2   H  N N 238 
ILE HA   H  N N 239 
ILE HB   H  N N 240 
ILE HG12 H  N N 241 
ILE HG13 H  N N 242 
ILE HG21 H  N N 243 
ILE HG22 H  N N 244 
ILE HG23 H  N N 245 
ILE HD11 H  N N 246 
ILE HD12 H  N N 247 
ILE HD13 H  N N 248 
ILE HXT  H  N N 249 
K   K    K  N N 250 
LEU N    N  N N 251 
LEU CA   C  N S 252 
LEU C    C  N N 253 
LEU O    O  N N 254 
LEU CB   C  N N 255 
LEU CG   C  N N 256 
LEU CD1  C  N N 257 
LEU CD2  C  N N 258 
LEU OXT  O  N N 259 
LEU H    H  N N 260 
LEU H2   H  N N 261 
LEU HA   H  N N 262 
LEU HB2  H  N N 263 
LEU HB3  H  N N 264 
LEU HG   H  N N 265 
LEU HD11 H  N N 266 
LEU HD12 H  N N 267 
LEU HD13 H  N N 268 
LEU HD21 H  N N 269 
LEU HD22 H  N N 270 
LEU HD23 H  N N 271 
LEU HXT  H  N N 272 
LYS N    N  N N 273 
LYS CA   C  N S 274 
LYS C    C  N N 275 
LYS O    O  N N 276 
LYS CB   C  N N 277 
LYS CG   C  N N 278 
LYS CD   C  N N 279 
LYS CE   C  N N 280 
LYS NZ   N  N N 281 
LYS OXT  O  N N 282 
LYS H    H  N N 283 
LYS H2   H  N N 284 
LYS HA   H  N N 285 
LYS HB2  H  N N 286 
LYS HB3  H  N N 287 
LYS HG2  H  N N 288 
LYS HG3  H  N N 289 
LYS HD2  H  N N 290 
LYS HD3  H  N N 291 
LYS HE2  H  N N 292 
LYS HE3  H  N N 293 
LYS HZ1  H  N N 294 
LYS HZ2  H  N N 295 
LYS HZ3  H  N N 296 
LYS HXT  H  N N 297 
MET N    N  N N 298 
MET CA   C  N S 299 
MET C    C  N N 300 
MET O    O  N N 301 
MET CB   C  N N 302 
MET CG   C  N N 303 
MET SD   S  N N 304 
MET CE   C  N N 305 
MET OXT  O  N N 306 
MET H    H  N N 307 
MET H2   H  N N 308 
MET HA   H  N N 309 
MET HB2  H  N N 310 
MET HB3  H  N N 311 
MET HG2  H  N N 312 
MET HG3  H  N N 313 
MET HE1  H  N N 314 
MET HE2  H  N N 315 
MET HE3  H  N N 316 
MET HXT  H  N N 317 
PHE N    N  N N 318 
PHE CA   C  N S 319 
PHE C    C  N N 320 
PHE O    O  N N 321 
PHE CB   C  N N 322 
PHE CG   C  Y N 323 
PHE CD1  C  Y N 324 
PHE CD2  C  Y N 325 
PHE CE1  C  Y N 326 
PHE CE2  C  Y N 327 
PHE CZ   C  Y N 328 
PHE OXT  O  N N 329 
PHE H    H  N N 330 
PHE H2   H  N N 331 
PHE HA   H  N N 332 
PHE HB2  H  N N 333 
PHE HB3  H  N N 334 
PHE HD1  H  N N 335 
PHE HD2  H  N N 336 
PHE HE1  H  N N 337 
PHE HE2  H  N N 338 
PHE HZ   H  N N 339 
PHE HXT  H  N N 340 
PO4 P    P  N N 341 
PO4 O1   O  N N 342 
PO4 O2   O  N N 343 
PO4 O3   O  N N 344 
PO4 O4   O  N N 345 
PRO N    N  N N 346 
PRO CA   C  N S 347 
PRO C    C  N N 348 
PRO O    O  N N 349 
PRO CB   C  N N 350 
PRO CG   C  N N 351 
PRO CD   C  N N 352 
PRO OXT  O  N N 353 
PRO H    H  N N 354 
PRO HA   H  N N 355 
PRO HB2  H  N N 356 
PRO HB3  H  N N 357 
PRO HG2  H  N N 358 
PRO HG3  H  N N 359 
PRO HD2  H  N N 360 
PRO HD3  H  N N 361 
PRO HXT  H  N N 362 
SER N    N  N N 363 
SER CA   C  N S 364 
SER C    C  N N 365 
SER O    O  N N 366 
SER CB   C  N N 367 
SER OG   O  N N 368 
SER OXT  O  N N 369 
SER H    H  N N 370 
SER H2   H  N N 371 
SER HA   H  N N 372 
SER HB2  H  N N 373 
SER HB3  H  N N 374 
SER HG   H  N N 375 
SER HXT  H  N N 376 
THR N    N  N N 377 
THR CA   C  N S 378 
THR C    C  N N 379 
THR O    O  N N 380 
THR CB   C  N R 381 
THR OG1  O  N N 382 
THR CG2  C  N N 383 
THR OXT  O  N N 384 
THR H    H  N N 385 
THR H2   H  N N 386 
THR HA   H  N N 387 
THR HB   H  N N 388 
THR HG1  H  N N 389 
THR HG21 H  N N 390 
THR HG22 H  N N 391 
THR HG23 H  N N 392 
THR HXT  H  N N 393 
TYR N    N  N N 394 
TYR CA   C  N S 395 
TYR C    C  N N 396 
TYR O    O  N N 397 
TYR CB   C  N N 398 
TYR CG   C  Y N 399 
TYR CD1  C  Y N 400 
TYR CD2  C  Y N 401 
TYR CE1  C  Y N 402 
TYR CE2  C  Y N 403 
TYR CZ   C  Y N 404 
TYR OH   O  N N 405 
TYR OXT  O  N N 406 
TYR H    H  N N 407 
TYR H2   H  N N 408 
TYR HA   H  N N 409 
TYR HB2  H  N N 410 
TYR HB3  H  N N 411 
TYR HD1  H  N N 412 
TYR HD2  H  N N 413 
TYR HE1  H  N N 414 
TYR HE2  H  N N 415 
TYR HH   H  N N 416 
TYR HXT  H  N N 417 
VAL N    N  N N 418 
VAL CA   C  N S 419 
VAL C    C  N N 420 
VAL O    O  N N 421 
VAL CB   C  N N 422 
VAL CG1  C  N N 423 
VAL CG2  C  N N 424 
VAL OXT  O  N N 425 
VAL H    H  N N 426 
VAL H2   H  N N 427 
VAL HA   H  N N 428 
VAL HB   H  N N 429 
VAL HG11 H  N N 430 
VAL HG12 H  N N 431 
VAL HG13 H  N N 432 
VAL HG21 H  N N 433 
VAL HG22 H  N N 434 
VAL HG23 H  N N 435 
VAL HXT  H  N N 436 
ZN  ZN   ZN N N 437 
# 
loop_
_chem_comp_bond.comp_id 
_chem_comp_bond.atom_id_1 
_chem_comp_bond.atom_id_2 
_chem_comp_bond.value_order 
_chem_comp_bond.pdbx_aromatic_flag 
_chem_comp_bond.pdbx_stereo_config 
_chem_comp_bond.pdbx_ordinal 
ALA N   CA   sing N N 1   
ALA N   H    sing N N 2   
ALA N   H2   sing N N 3   
ALA CA  C    sing N N 4   
ALA CA  CB   sing N N 5   
ALA CA  HA   sing N N 6   
ALA C   O    doub N N 7   
ALA C   OXT  sing N N 8   
ALA CB  HB1  sing N N 9   
ALA CB  HB2  sing N N 10  
ALA CB  HB3  sing N N 11  
ALA OXT HXT  sing N N 12  
ARG N   CA   sing N N 13  
ARG N   H    sing N N 14  
ARG N   H2   sing N N 15  
ARG CA  C    sing N N 16  
ARG CA  CB   sing N N 17  
ARG CA  HA   sing N N 18  
ARG C   O    doub N N 19  
ARG C   OXT  sing N N 20  
ARG CB  CG   sing N N 21  
ARG CB  HB2  sing N N 22  
ARG CB  HB3  sing N N 23  
ARG CG  CD   sing N N 24  
ARG CG  HG2  sing N N 25  
ARG CG  HG3  sing N N 26  
ARG CD  NE   sing N N 27  
ARG CD  HD2  sing N N 28  
ARG CD  HD3  sing N N 29  
ARG NE  CZ   sing N N 30  
ARG NE  HE   sing N N 31  
ARG CZ  NH1  sing N N 32  
ARG CZ  NH2  doub N N 33  
ARG NH1 HH11 sing N N 34  
ARG NH1 HH12 sing N N 35  
ARG NH2 HH21 sing N N 36  
ARG NH2 HH22 sing N N 37  
ARG OXT HXT  sing N N 38  
ASN N   CA   sing N N 39  
ASN N   H    sing N N 40  
ASN N   H2   sing N N 41  
ASN CA  C    sing N N 42  
ASN CA  CB   sing N N 43  
ASN CA  HA   sing N N 44  
ASN C   O    doub N N 45  
ASN C   OXT  sing N N 46  
ASN CB  CG   sing N N 47  
ASN CB  HB2  sing N N 48  
ASN CB  HB3  sing N N 49  
ASN CG  OD1  doub N N 50  
ASN CG  ND2  sing N N 51  
ASN ND2 HD21 sing N N 52  
ASN ND2 HD22 sing N N 53  
ASN OXT HXT  sing N N 54  
ASP N   CA   sing N N 55  
ASP N   H    sing N N 56  
ASP N   H2   sing N N 57  
ASP CA  C    sing N N 58  
ASP CA  CB   sing N N 59  
ASP CA  HA   sing N N 60  
ASP C   O    doub N N 61  
ASP C   OXT  sing N N 62  
ASP CB  CG   sing N N 63  
ASP CB  HB2  sing N N 64  
ASP CB  HB3  sing N N 65  
ASP CG  OD1  doub N N 66  
ASP CG  OD2  sing N N 67  
ASP OD2 HD2  sing N N 68  
ASP OXT HXT  sing N N 69  
BB2 C5  C3   sing N N 70  
BB2 C5  C6   sing N N 71  
BB2 C5  H51  sing N N 72  
BB2 C5  H52  sing N N 73  
BB2 C3  O4   doub N N 74  
BB2 C3  N1   sing N N 75  
BB2 N1  O2   sing N N 76  
BB2 N1  HN1  sing N N 77  
BB2 O2  HO2  sing N N 78  
BB2 C6  C12  sing N N 79  
BB2 C6  C7   sing N N 80  
BB2 C6  H6   sing N N 81  
BB2 C12 O13  doub N N 82  
BB2 C12 N14  sing N N 83  
BB2 C7  C8   sing N N 84  
BB2 C7  H71  sing N N 85  
BB2 C7  H72  sing N N 86  
BB2 C8  C9   sing N N 87  
BB2 C8  H81  sing N N 88  
BB2 C8  H82  sing N N 89  
BB2 C9  C10  sing N N 90  
BB2 C9  H91  sing N N 91  
BB2 C9  H92  sing N N 92  
BB2 C10 C11  sing N N 93  
BB2 C10 H101 sing N N 94  
BB2 C10 H102 sing N N 95  
BB2 C11 H111 sing N N 96  
BB2 C11 H112 sing N N 97  
BB2 C11 H113 sing N N 98  
BB2 N14 C15  sing N N 99  
BB2 N14 H14  sing N N 100 
BB2 C15 C16  sing N N 101 
BB2 C15 C19  sing N N 102 
BB2 C15 H15  sing N N 103 
BB2 C16 C18  sing N N 104 
BB2 C16 C17  sing N N 105 
BB2 C16 H16  sing N N 106 
BB2 C18 H181 sing N N 107 
BB2 C18 H182 sing N N 108 
BB2 C18 H183 sing N N 109 
BB2 C17 H171 sing N N 110 
BB2 C17 H172 sing N N 111 
BB2 C17 H173 sing N N 112 
BB2 C19 O20  doub N N 113 
BB2 C19 N21  sing N N 114 
BB2 N21 C22  sing N N 115 
BB2 N21 C23  sing N N 116 
BB2 C22 C25  sing N N 117 
BB2 C22 C26  sing N N 118 
BB2 C22 H22  sing N N 119 
BB2 C23 C24  sing N N 120 
BB2 C23 H231 sing N N 121 
BB2 C23 H232 sing N N 122 
BB2 C24 C25  sing N N 123 
BB2 C24 H241 sing N N 124 
BB2 C24 H242 sing N N 125 
BB2 C25 H251 sing N N 126 
BB2 C25 H252 sing N N 127 
BB2 C26 O27  sing N N 128 
BB2 C26 H261 sing N N 129 
BB2 C26 H262 sing N N 130 
BB2 O27 H27  sing N N 131 
CYS N   CA   sing N N 132 
CYS N   H    sing N N 133 
CYS N   H2   sing N N 134 
CYS CA  C    sing N N 135 
CYS CA  CB   sing N N 136 
CYS CA  HA   sing N N 137 
CYS C   O    doub N N 138 
CYS C   OXT  sing N N 139 
CYS CB  SG   sing N N 140 
CYS CB  HB2  sing N N 141 
CYS CB  HB3  sing N N 142 
CYS SG  HG   sing N N 143 
CYS OXT HXT  sing N N 144 
FMT C   O1   doub N N 145 
FMT C   O2   sing N N 146 
FMT C   H    sing N N 147 
FMT O2  HO2  sing N N 148 
GLN N   CA   sing N N 149 
GLN N   H    sing N N 150 
GLN N   H2   sing N N 151 
GLN CA  C    sing N N 152 
GLN CA  CB   sing N N 153 
GLN CA  HA   sing N N 154 
GLN C   O    doub N N 155 
GLN C   OXT  sing N N 156 
GLN CB  CG   sing N N 157 
GLN CB  HB2  sing N N 158 
GLN CB  HB3  sing N N 159 
GLN CG  CD   sing N N 160 
GLN CG  HG2  sing N N 161 
GLN CG  HG3  sing N N 162 
GLN CD  OE1  doub N N 163 
GLN CD  NE2  sing N N 164 
GLN NE2 HE21 sing N N 165 
GLN NE2 HE22 sing N N 166 
GLN OXT HXT  sing N N 167 
GLU N   CA   sing N N 168 
GLU N   H    sing N N 169 
GLU N   H2   sing N N 170 
GLU CA  C    sing N N 171 
GLU CA  CB   sing N N 172 
GLU CA  HA   sing N N 173 
GLU C   O    doub N N 174 
GLU C   OXT  sing N N 175 
GLU CB  CG   sing N N 176 
GLU CB  HB2  sing N N 177 
GLU CB  HB3  sing N N 178 
GLU CG  CD   sing N N 179 
GLU CG  HG2  sing N N 180 
GLU CG  HG3  sing N N 181 
GLU CD  OE1  doub N N 182 
GLU CD  OE2  sing N N 183 
GLU OE2 HE2  sing N N 184 
GLU OXT HXT  sing N N 185 
GLY N   CA   sing N N 186 
GLY N   H    sing N N 187 
GLY N   H2   sing N N 188 
GLY CA  C    sing N N 189 
GLY CA  HA2  sing N N 190 
GLY CA  HA3  sing N N 191 
GLY C   O    doub N N 192 
GLY C   OXT  sing N N 193 
GLY OXT HXT  sing N N 194 
HIS N   CA   sing N N 195 
HIS N   H    sing N N 196 
HIS N   H2   sing N N 197 
HIS CA  C    sing N N 198 
HIS CA  CB   sing N N 199 
HIS CA  HA   sing N N 200 
HIS C   O    doub N N 201 
HIS C   OXT  sing N N 202 
HIS CB  CG   sing N N 203 
HIS CB  HB2  sing N N 204 
HIS CB  HB3  sing N N 205 
HIS CG  ND1  sing Y N 206 
HIS CG  CD2  doub Y N 207 
HIS ND1 CE1  doub Y N 208 
HIS ND1 HD1  sing N N 209 
HIS CD2 NE2  sing Y N 210 
HIS CD2 HD2  sing N N 211 
HIS CE1 NE2  sing Y N 212 
HIS CE1 HE1  sing N N 213 
HIS NE2 HE2  sing N N 214 
HIS OXT HXT  sing N N 215 
HOH O   H1   sing N N 216 
HOH O   H2   sing N N 217 
ILE N   CA   sing N N 218 
ILE N   H    sing N N 219 
ILE N   H2   sing N N 220 
ILE CA  C    sing N N 221 
ILE CA  CB   sing N N 222 
ILE CA  HA   sing N N 223 
ILE C   O    doub N N 224 
ILE C   OXT  sing N N 225 
ILE CB  CG1  sing N N 226 
ILE CB  CG2  sing N N 227 
ILE CB  HB   sing N N 228 
ILE CG1 CD1  sing N N 229 
ILE CG1 HG12 sing N N 230 
ILE CG1 HG13 sing N N 231 
ILE CG2 HG21 sing N N 232 
ILE CG2 HG22 sing N N 233 
ILE CG2 HG23 sing N N 234 
ILE CD1 HD11 sing N N 235 
ILE CD1 HD12 sing N N 236 
ILE CD1 HD13 sing N N 237 
ILE OXT HXT  sing N N 238 
LEU N   CA   sing N N 239 
LEU N   H    sing N N 240 
LEU N   H2   sing N N 241 
LEU CA  C    sing N N 242 
LEU CA  CB   sing N N 243 
LEU CA  HA   sing N N 244 
LEU C   O    doub N N 245 
LEU C   OXT  sing N N 246 
LEU CB  CG   sing N N 247 
LEU CB  HB2  sing N N 248 
LEU CB  HB3  sing N N 249 
LEU CG  CD1  sing N N 250 
LEU CG  CD2  sing N N 251 
LEU CG  HG   sing N N 252 
LEU CD1 HD11 sing N N 253 
LEU CD1 HD12 sing N N 254 
LEU CD1 HD13 sing N N 255 
LEU CD2 HD21 sing N N 256 
LEU CD2 HD22 sing N N 257 
LEU CD2 HD23 sing N N 258 
LEU OXT HXT  sing N N 259 
LYS N   CA   sing N N 260 
LYS N   H    sing N N 261 
LYS N   H2   sing N N 262 
LYS CA  C    sing N N 263 
LYS CA  CB   sing N N 264 
LYS CA  HA   sing N N 265 
LYS C   O    doub N N 266 
LYS C   OXT  sing N N 267 
LYS CB  CG   sing N N 268 
LYS CB  HB2  sing N N 269 
LYS CB  HB3  sing N N 270 
LYS CG  CD   sing N N 271 
LYS CG  HG2  sing N N 272 
LYS CG  HG3  sing N N 273 
LYS CD  CE   sing N N 274 
LYS CD  HD2  sing N N 275 
LYS CD  HD3  sing N N 276 
LYS CE  NZ   sing N N 277 
LYS CE  HE2  sing N N 278 
LYS CE  HE3  sing N N 279 
LYS NZ  HZ1  sing N N 280 
LYS NZ  HZ2  sing N N 281 
LYS NZ  HZ3  sing N N 282 
LYS OXT HXT  sing N N 283 
MET N   CA   sing N N 284 
MET N   H    sing N N 285 
MET N   H2   sing N N 286 
MET CA  C    sing N N 287 
MET CA  CB   sing N N 288 
MET CA  HA   sing N N 289 
MET C   O    doub N N 290 
MET C   OXT  sing N N 291 
MET CB  CG   sing N N 292 
MET CB  HB2  sing N N 293 
MET CB  HB3  sing N N 294 
MET CG  SD   sing N N 295 
MET CG  HG2  sing N N 296 
MET CG  HG3  sing N N 297 
MET SD  CE   sing N N 298 
MET CE  HE1  sing N N 299 
MET CE  HE2  sing N N 300 
MET CE  HE3  sing N N 301 
MET OXT HXT  sing N N 302 
PHE N   CA   sing N N 303 
PHE N   H    sing N N 304 
PHE N   H2   sing N N 305 
PHE CA  C    sing N N 306 
PHE CA  CB   sing N N 307 
PHE CA  HA   sing N N 308 
PHE C   O    doub N N 309 
PHE C   OXT  sing N N 310 
PHE CB  CG   sing N N 311 
PHE CB  HB2  sing N N 312 
PHE CB  HB3  sing N N 313 
PHE CG  CD1  doub Y N 314 
PHE CG  CD2  sing Y N 315 
PHE CD1 CE1  sing Y N 316 
PHE CD1 HD1  sing N N 317 
PHE CD2 CE2  doub Y N 318 
PHE CD2 HD2  sing N N 319 
PHE CE1 CZ   doub Y N 320 
PHE CE1 HE1  sing N N 321 
PHE CE2 CZ   sing Y N 322 
PHE CE2 HE2  sing N N 323 
PHE CZ  HZ   sing N N 324 
PHE OXT HXT  sing N N 325 
PO4 P   O1   doub N N 326 
PO4 P   O2   sing N N 327 
PO4 P   O3   sing N N 328 
PO4 P   O4   sing N N 329 
PRO N   CA   sing N N 330 
PRO N   CD   sing N N 331 
PRO N   H    sing N N 332 
PRO CA  C    sing N N 333 
PRO CA  CB   sing N N 334 
PRO CA  HA   sing N N 335 
PRO C   O    doub N N 336 
PRO C   OXT  sing N N 337 
PRO CB  CG   sing N N 338 
PRO CB  HB2  sing N N 339 
PRO CB  HB3  sing N N 340 
PRO CG  CD   sing N N 341 
PRO CG  HG2  sing N N 342 
PRO CG  HG3  sing N N 343 
PRO CD  HD2  sing N N 344 
PRO CD  HD3  sing N N 345 
PRO OXT HXT  sing N N 346 
SER N   CA   sing N N 347 
SER N   H    sing N N 348 
SER N   H2   sing N N 349 
SER CA  C    sing N N 350 
SER CA  CB   sing N N 351 
SER CA  HA   sing N N 352 
SER C   O    doub N N 353 
SER C   OXT  sing N N 354 
SER CB  OG   sing N N 355 
SER CB  HB2  sing N N 356 
SER CB  HB3  sing N N 357 
SER OG  HG   sing N N 358 
SER OXT HXT  sing N N 359 
THR N   CA   sing N N 360 
THR N   H    sing N N 361 
THR N   H2   sing N N 362 
THR CA  C    sing N N 363 
THR CA  CB   sing N N 364 
THR CA  HA   sing N N 365 
THR C   O    doub N N 366 
THR C   OXT  sing N N 367 
THR CB  OG1  sing N N 368 
THR CB  CG2  sing N N 369 
THR CB  HB   sing N N 370 
THR OG1 HG1  sing N N 371 
THR CG2 HG21 sing N N 372 
THR CG2 HG22 sing N N 373 
THR CG2 HG23 sing N N 374 
THR OXT HXT  sing N N 375 
TYR N   CA   sing N N 376 
TYR N   H    sing N N 377 
TYR N   H2   sing N N 378 
TYR CA  C    sing N N 379 
TYR CA  CB   sing N N 380 
TYR CA  HA   sing N N 381 
TYR C   O    doub N N 382 
TYR C   OXT  sing N N 383 
TYR CB  CG   sing N N 384 
TYR CB  HB2  sing N N 385 
TYR CB  HB3  sing N N 386 
TYR CG  CD1  doub Y N 387 
TYR CG  CD2  sing Y N 388 
TYR CD1 CE1  sing Y N 389 
TYR CD1 HD1  sing N N 390 
TYR CD2 CE2  doub Y N 391 
TYR CD2 HD2  sing N N 392 
TYR CE1 CZ   doub Y N 393 
TYR CE1 HE1  sing N N 394 
TYR CE2 CZ   sing Y N 395 
TYR CE2 HE2  sing N N 396 
TYR CZ  OH   sing N N 397 
TYR OH  HH   sing N N 398 
TYR OXT HXT  sing N N 399 
VAL N   CA   sing N N 400 
VAL N   H    sing N N 401 
VAL N   H2   sing N N 402 
VAL CA  C    sing N N 403 
VAL CA  CB   sing N N 404 
VAL CA  HA   sing N N 405 
VAL C   O    doub N N 406 
VAL C   OXT  sing N N 407 
VAL CB  CG1  sing N N 408 
VAL CB  CG2  sing N N 409 
VAL CB  HB   sing N N 410 
VAL CG1 HG11 sing N N 411 
VAL CG1 HG12 sing N N 412 
VAL CG1 HG13 sing N N 413 
VAL CG2 HG21 sing N N 414 
VAL CG2 HG22 sing N N 415 
VAL CG2 HG23 sing N N 416 
VAL OXT HXT  sing N N 417 
# 
loop_
_pdbx_audit_support.funding_organization 
_pdbx_audit_support.country 
_pdbx_audit_support.grant_number 
_pdbx_audit_support.ordinal 
'European Research Council (ERC)'   'European Union' 716058        1 
'Swiss National Science Foundation' Switzerland      310030_197724 2 
# 
_pdbx_initial_refinement_model.id               1 
_pdbx_initial_refinement_model.entity_id_list   ? 
_pdbx_initial_refinement_model.type             'in silico model' 
_pdbx_initial_refinement_model.source_name      Other 
_pdbx_initial_refinement_model.accession_code   ? 
_pdbx_initial_refinement_model.details          Rosetta 
# 
_space_group.name_H-M_alt     'P 21 21 21' 
_space_group.name_Hall        'P 2ac 2ab' 
_space_group.IT_number        19 
_space_group.crystal_system   orthorhombic 
_space_group.id               1 
# 
_atom_sites.entry_id                    8S1X 
_atom_sites.Cartn_transf_matrix[1][1]   ? 
_atom_sites.Cartn_transf_matrix[1][2]   ? 
_atom_sites.Cartn_transf_matrix[1][3]   ? 
_atom_sites.Cartn_transf_matrix[2][1]   ? 
_atom_sites.Cartn_transf_matrix[2][2]   ? 
_atom_sites.Cartn_transf_matrix[2][3]   ? 
_atom_sites.Cartn_transf_matrix[3][1]   ? 
_atom_sites.Cartn_transf_matrix[3][2]   ? 
_atom_sites.Cartn_transf_matrix[3][3]   ? 
_atom_sites.Cartn_transf_vector[1]      ? 
_atom_sites.Cartn_transf_vector[2]      ? 
_atom_sites.Cartn_transf_vector[3]      ? 
_atom_sites.Cartn_transform_axes        ? 
_atom_sites.fract_transf_matrix[1][1]   0.020227 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.013332 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.012025 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
_atom_sites.solution_primary            ? 
_atom_sites.solution_secondary          ? 
_atom_sites.solution_hydrogens          ? 
_atom_sites.special_details             ? 
# 
loop_
_atom_type.symbol 
_atom_type.scat_dispersion_real 
_atom_type.scat_dispersion_imag 
_atom_type.scat_Cromer_Mann_a1 
_atom_type.scat_Cromer_Mann_a2 
_atom_type.scat_Cromer_Mann_a3 
_atom_type.scat_Cromer_Mann_a4 
_atom_type.scat_Cromer_Mann_b1 
_atom_type.scat_Cromer_Mann_b2 
_atom_type.scat_Cromer_Mann_b3 
_atom_type.scat_Cromer_Mann_b4 
_atom_type.scat_Cromer_Mann_c 
_atom_type.scat_source 
_atom_type.scat_dispersion_source 
C  ? ? 3.54356  2.42580 ? ? 25.62398 1.50364  ? ? 0.0 
;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31.
;
? 
H  ? ? 0.51345  0.48472 ? ? 24.73122 6.32584  ? ? 0.0 
;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31.
;
? 
K  ? ? 16.37977 2.54835 ? ? 4.54127  84.28225 ? ? 0.0 
;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31.
;
? 
N  ? ? 4.01032  2.96436 ? ? 19.97189 1.75589  ? ? 0.0 
;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31.
;
? 
O  ? ? 4.49882  3.47563 ? ? 15.80542 1.70748  ? ? 0.0 
;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31.
;
? 
P  ? ? 9.51135  5.44231 ? ? 1.42069  35.72801 ? ? 0.0 
;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31.
;
? 
S  ? ? 9.55732  6.39887 ? ? 1.23737  29.19336 ? ? 0.0 
;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31.
;
? 
ZN ? ? 24.64596 5.25405 ? ? 2.14387  29.76375 ? ? 0.0 
;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31.
;
? 
# 
loop_