data_8S1X # _entry.id 8S1X # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.397 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 8S1X pdb_00008s1x 10.2210/pdb8s1x/pdb WWPDB D_1292136690 ? ? # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2024-10-30 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 8S1X _pdbx_database_status.recvd_initial_deposition_date 2024-02-16 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_contact_author.id 3 _pdbx_contact_author.email bruno.correia@epfl.ch _pdbx_contact_author.name_first Bruno _pdbx_contact_author.name_last Correia _pdbx_contact_author.name_mi E. _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-7377-8636 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Marchand, A.' 1 ? 'Pacesa, M.' 2 ? 'Correia, B.E.' 3 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Targeting hybrid neosurface fingerprints for the design of de novo drug-induced protein interactions' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Marchand, A.' 1 0000-0003-2864-0408 primary 'Buckley, S.' 2 ? primary 'Schneuing, A.' 3 ? primary 'Pacesa, M.' 4 0000-0003-1560-5769 primary 'Gainza, P.' 5 ? primary 'Elizarova, E.' 6 ? primary 'Neeser, R.' 7 ? primary 'Reymond, L.' 8 ? primary 'Georgeon, S.' 9 ? primary 'Schmidt, J.' 10 ? primary 'Correia, B.E.' 11 0000-0002-7377-8636 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Peptide deformylase' 19391.156 1 3.5.1.88 ? ? Actionin 2 polymer man DBAct553_1 8152.354 1 ? ? ? Actionin 3 non-polymer syn 'ZINC ION' 65.409 1 ? ? ? ? 4 non-polymer syn ACTINONIN 385.498 1 ? ? ? ? 5 non-polymer syn 'FORMIC ACID' 46.025 8 ? ? ? ? 6 non-polymer syn 'PHOSPHATE ION' 94.971 4 ? ? ? ? 7 non-polymer syn 'POTASSIUM ION' 39.098 1 ? ? ? ? 8 water nat water 18.015 76 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'PDF,Polypeptide deformylase' # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no ;MAILNILEFPDPRLRTIAKPVEVVDDAVRQLIDDMFETMYEAPGIGLAATQVNVHKRIVVMDLSEDKSEPRVFINPEFEP LTEDMDQYQEGCLSVPGFYENVDRPQKVRIKALDRDGNPFEEVAEGLLAVCIQHECDHLNGKLFVDYLSTLKRDRIRKKL EKQHRQQA ; ;MAILNILEFPDPRLRTIAKPVEVVDDAVRQLIDDMFETMYEAPGIGLAATQVNVHKRIVVMDLSEDKSEPRVFINPEFEP LTEDMDQYQEGCLSVPGFYENVDRPQKVRIKALDRDGNPFEEVAEGLLAVCIQHECDHLNGKLFVDYLSTLKRDRIRKKL EKQHRQQA ; A ? 2 'polypeptide(L)' no no DYIRELRAALILLALKKQHAEDPDAQRVADELMKKLFDAAHRNDKDKVKKVVEEAKKVVSTYGSHHHHHH DYIRELRAALILLALKKQHAEDPDAQRVADELMKKLFDAAHRNDKDKVKKVVEEAKKVVSTYGSHHHHHH B ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 3 'ZINC ION' ZN 4 ACTINONIN BB2 5 'FORMIC ACID' FMT 6 'PHOSPHATE ION' PO4 7 'POTASSIUM ION' K 8 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ALA n 1 3 ILE n 1 4 LEU n 1 5 ASN n 1 6 ILE n 1 7 LEU n 1 8 GLU n 1 9 PHE n 1 10 PRO n 1 11 ASP n 1 12 PRO n 1 13 ARG n 1 14 LEU n 1 15 ARG n 1 16 THR n 1 17 ILE n 1 18 ALA n 1 19 LYS n 1 20 PRO n 1 21 VAL n 1 22 GLU n 1 23 VAL n 1 24 VAL n 1 25 ASP n 1 26 ASP n 1 27 ALA n 1 28 VAL n 1 29 ARG n 1 30 GLN n 1 31 LEU n 1 32 ILE n 1 33 ASP n 1 34 ASP n 1 35 MET n 1 36 PHE n 1 37 GLU n 1 38 THR n 1 39 MET n 1 40 TYR n 1 41 GLU n 1 42 ALA n 1 43 PRO n 1 44 GLY n 1 45 ILE n 1 46 GLY n 1 47 LEU n 1 48 ALA n 1 49 ALA n 1 50 THR n 1 51 GLN n 1 52 VAL n 1 53 ASN n 1 54 VAL n 1 55 HIS n 1 56 LYS n 1 57 ARG n 1 58 ILE n 1 59 VAL n 1 60 VAL n 1 61 MET n 1 62 ASP n 1 63 LEU n 1 64 SER n 1 65 GLU n 1 66 ASP n 1 67 LYS n 1 68 SER n 1 69 GLU n 1 70 PRO n 1 71 ARG n 1 72 VAL n 1 73 PHE n 1 74 ILE n 1 75 ASN n 1 76 PRO n 1 77 GLU n 1 78 PHE n 1 79 GLU n 1 80 PRO n 1 81 LEU n 1 82 THR n 1 83 GLU n 1 84 ASP n 1 85 MET n 1 86 ASP n 1 87 GLN n 1 88 TYR n 1 89 GLN n 1 90 GLU n 1 91 GLY n 1 92 CYS n 1 93 LEU n 1 94 SER n 1 95 VAL n 1 96 PRO n 1 97 GLY n 1 98 PHE n 1 99 TYR n 1 100 GLU n 1 101 ASN n 1 102 VAL n 1 103 ASP n 1 104 ARG n 1 105 PRO n 1 106 GLN n 1 107 LYS n 1 108 VAL n 1 109 ARG n 1 110 ILE n 1 111 LYS n 1 112 ALA n 1 113 LEU n 1 114 ASP n 1 115 ARG n 1 116 ASP n 1 117 GLY n 1 118 ASN n 1 119 PRO n 1 120 PHE n 1 121 GLU n 1 122 GLU n 1 123 VAL n 1 124 ALA n 1 125 GLU n 1 126 GLY n 1 127 LEU n 1 128 LEU n 1 129 ALA n 1 130 VAL n 1 131 CYS n 1 132 ILE n 1 133 GLN n 1 134 HIS n 1 135 GLU n 1 136 CYS n 1 137 ASP n 1 138 HIS n 1 139 LEU n 1 140 ASN n 1 141 GLY n 1 142 LYS n 1 143 LEU n 1 144 PHE n 1 145 VAL n 1 146 ASP n 1 147 TYR n 1 148 LEU n 1 149 SER n 1 150 THR n 1 151 LEU n 1 152 LYS n 1 153 ARG n 1 154 ASP n 1 155 ARG n 1 156 ILE n 1 157 ARG n 1 158 LYS n 1 159 LYS n 1 160 LEU n 1 161 GLU n 1 162 LYS n 1 163 GLN n 1 164 HIS n 1 165 ARG n 1 166 GLN n 1 167 GLN n 1 168 ALA n 2 1 ASP n 2 2 TYR n 2 3 ILE n 2 4 ARG n 2 5 GLU n 2 6 LEU n 2 7 ARG n 2 8 ALA n 2 9 ALA n 2 10 LEU n 2 11 ILE n 2 12 LEU n 2 13 LEU n 2 14 ALA n 2 15 LEU n 2 16 LYS n 2 17 LYS n 2 18 GLN n 2 19 HIS n 2 20 ALA n 2 21 GLU n 2 22 ASP n 2 23 PRO n 2 24 ASP n 2 25 ALA n 2 26 GLN n 2 27 ARG n 2 28 VAL n 2 29 ALA n 2 30 ASP n 2 31 GLU n 2 32 LEU n 2 33 MET n 2 34 LYS n 2 35 LYS n 2 36 LEU n 2 37 PHE n 2 38 ASP n 2 39 ALA n 2 40 ALA n 2 41 HIS n 2 42 ARG n 2 43 ASN n 2 44 ASP n 2 45 LYS n 2 46 ASP n 2 47 LYS n 2 48 VAL n 2 49 LYS n 2 50 LYS n 2 51 VAL n 2 52 VAL n 2 53 GLU n 2 54 GLU n 2 55 ALA n 2 56 LYS n 2 57 LYS n 2 58 VAL n 2 59 VAL n 2 60 SER n 2 61 THR n 2 62 TYR n 2 63 GLY n 2 64 SER n 2 65 HIS n 2 66 HIS n 2 67 HIS n 2 68 HIS n 2 69 HIS n 2 70 HIS n # loop_ _entity_src_gen.entity_id _entity_src_gen.pdbx_src_id _entity_src_gen.pdbx_alt_source_flag _entity_src_gen.pdbx_seq_type _entity_src_gen.pdbx_beg_seq_num _entity_src_gen.pdbx_end_seq_num _entity_src_gen.gene_src_common_name _entity_src_gen.gene_src_genus _entity_src_gen.pdbx_gene_src_gene _entity_src_gen.gene_src_species _entity_src_gen.gene_src_strain _entity_src_gen.gene_src_tissue _entity_src_gen.gene_src_tissue_fraction _entity_src_gen.gene_src_details _entity_src_gen.pdbx_gene_src_fragment _entity_src_gen.pdbx_gene_src_scientific_name _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id _entity_src_gen.pdbx_gene_src_variant _entity_src_gen.pdbx_gene_src_cell_line _entity_src_gen.pdbx_gene_src_atcc _entity_src_gen.pdbx_gene_src_organ _entity_src_gen.pdbx_gene_src_organelle _entity_src_gen.pdbx_gene_src_cell _entity_src_gen.pdbx_gene_src_cellular_location _entity_src_gen.host_org_common_name _entity_src_gen.pdbx_host_org_scientific_name _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id _entity_src_gen.host_org_genus _entity_src_gen.pdbx_host_org_gene _entity_src_gen.pdbx_host_org_organ _entity_src_gen.host_org_species _entity_src_gen.pdbx_host_org_tissue _entity_src_gen.pdbx_host_org_tissue_fraction _entity_src_gen.pdbx_host_org_strain _entity_src_gen.pdbx_host_org_variant _entity_src_gen.pdbx_host_org_cell_line _entity_src_gen.pdbx_host_org_atcc _entity_src_gen.pdbx_host_org_culture_collection _entity_src_gen.pdbx_host_org_cell _entity_src_gen.pdbx_host_org_organelle _entity_src_gen.pdbx_host_org_cellular_location _entity_src_gen.pdbx_host_org_vector_type _entity_src_gen.pdbx_host_org_vector _entity_src_gen.host_org_details _entity_src_gen.expression_system_id _entity_src_gen.plasmid_name _entity_src_gen.plasmid_details _entity_src_gen.pdbx_description 1 1 sample 'Biological sequence' 1 168 ? ? 'def, PA0019' ? ? ? ? ? ? 'Pseudomonas aeruginosa' 287 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 2 1 sample 'Biological sequence' 1 70 ? ? ? ? ? ? ? ? ? 'synthetic construct' 32630 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 BB2 non-polymer . ACTINONIN '2-[(FORMYL-HYDROXY-AMINO)-METHYL]-HEPTANOIC ACID [1-(2-HYDROXYMETHYL-PYRROLIDINE-1-CARBONYL)-2-METHYL-PROPYL]-AMIDE' 'C19 H35 N3 O5' 385.498 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 FMT non-polymer . 'FORMIC ACID' ? 'C H2 O2' 46.025 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 K non-polymer . 'POTASSIUM ION' ? 'K 1' 39.098 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PO4 non-polymer . 'PHOSPHATE ION' ? 'O4 P -3' 94.971 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 ALA 2 2 2 ALA ALA A . n A 1 3 ILE 3 3 3 ILE ILE A . n A 1 4 LEU 4 4 4 LEU LEU A . n A 1 5 ASN 5 5 5 ASN ASN A . n A 1 6 ILE 6 6 6 ILE ILE A . n A 1 7 LEU 7 7 7 LEU LEU A . n A 1 8 GLU 8 8 8 GLU GLU A . n A 1 9 PHE 9 9 9 PHE PHE A . n A 1 10 PRO 10 10 10 PRO PRO A . n A 1 11 ASP 11 11 11 ASP ASP A . n A 1 12 PRO 12 12 12 PRO PRO A . n A 1 13 ARG 13 13 13 ARG ARG A . n A 1 14 LEU 14 14 14 LEU LEU A . n A 1 15 ARG 15 15 15 ARG ARG A . n A 1 16 THR 16 16 16 THR THR A . n A 1 17 ILE 17 17 17 ILE ILE A . n A 1 18 ALA 18 18 18 ALA ALA A . n A 1 19 LYS 19 19 19 LYS LYS A . n A 1 20 PRO 20 20 20 PRO PRO A . n A 1 21 VAL 21 21 21 VAL VAL A . n A 1 22 GLU 22 22 22 GLU GLU A . n A 1 23 VAL 23 23 23 VAL VAL A . n A 1 24 VAL 24 24 24 VAL VAL A . n A 1 25 ASP 25 25 25 ASP ASP A . n A 1 26 ASP 26 26 26 ASP ASP A . n A 1 27 ALA 27 27 27 ALA ALA A . n A 1 28 VAL 28 28 28 VAL VAL A . n A 1 29 ARG 29 29 29 ARG ARG A . n A 1 30 GLN 30 30 30 GLN GLN A . n A 1 31 LEU 31 31 31 LEU LEU A . n A 1 32 ILE 32 32 32 ILE ILE A . n A 1 33 ASP 33 33 33 ASP ASP A . n A 1 34 ASP 34 34 34 ASP ASP A . n A 1 35 MET 35 35 35 MET MET A . n A 1 36 PHE 36 36 36 PHE PHE A . n A 1 37 GLU 37 37 37 GLU GLU A . n A 1 38 THR 38 38 38 THR THR A . n A 1 39 MET 39 39 39 MET MET A . n A 1 40 TYR 40 40 40 TYR TYR A . n A 1 41 GLU 41 41 41 GLU GLU A . n A 1 42 ALA 42 42 42 ALA ALA A . n A 1 43 PRO 43 43 43 PRO PRO A . n A 1 44 GLY 44 44 44 GLY GLY A . n A 1 45 ILE 45 45 45 ILE ILE A . n A 1 46 GLY 46 46 46 GLY GLY A . n A 1 47 LEU 47 47 47 LEU LEU A . n A 1 48 ALA 48 48 48 ALA ALA A . n A 1 49 ALA 49 49 49 ALA ALA A . n A 1 50 THR 50 50 50 THR THR A . n A 1 51 GLN 51 51 51 GLN GLN A . n A 1 52 VAL 52 52 52 VAL VAL A . n A 1 53 ASN 53 53 53 ASN ASN A . n A 1 54 VAL 54 54 54 VAL VAL A . n A 1 55 HIS 55 55 55 HIS HIS A . n A 1 56 LYS 56 56 56 LYS LYS A . n A 1 57 ARG 57 57 57 ARG ARG A . n A 1 58 ILE 58 58 58 ILE ILE A . n A 1 59 VAL 59 59 59 VAL VAL A . n A 1 60 VAL 60 60 60 VAL VAL A . n A 1 61 MET 61 61 61 MET MET A . n A 1 62 ASP 62 62 62 ASP ASP A . n A 1 63 LEU 63 63 63 LEU LEU A . n A 1 64 SER 64 64 64 SER SER A . n A 1 65 GLU 65 65 65 GLU GLU A . n A 1 66 ASP 66 66 66 ASP ASP A . n A 1 67 LYS 67 67 67 LYS LYS A . n A 1 68 SER 68 68 68 SER SER A . n A 1 69 GLU 69 69 69 GLU GLU A . n A 1 70 PRO 70 70 70 PRO PRO A . n A 1 71 ARG 71 71 71 ARG ARG A . n A 1 72 VAL 72 72 72 VAL VAL A . n A 1 73 PHE 73 73 73 PHE PHE A . n A 1 74 ILE 74 74 74 ILE ILE A . n A 1 75 ASN 75 75 75 ASN ASN A . n A 1 76 PRO 76 76 76 PRO PRO A . n A 1 77 GLU 77 77 77 GLU GLU A . n A 1 78 PHE 78 78 78 PHE PHE A . n A 1 79 GLU 79 79 79 GLU GLU A . n A 1 80 PRO 80 80 80 PRO PRO A . n A 1 81 LEU 81 81 81 LEU LEU A . n A 1 82 THR 82 82 82 THR THR A . n A 1 83 GLU 83 83 83 GLU GLU A . n A 1 84 ASP 84 84 84 ASP ASP A . n A 1 85 MET 85 85 85 MET MET A . n A 1 86 ASP 86 86 86 ASP ASP A . n A 1 87 GLN 87 87 87 GLN GLN A . n A 1 88 TYR 88 88 88 TYR TYR A . n A 1 89 GLN 89 89 89 GLN GLN A . n A 1 90 GLU 90 90 90 GLU GLU A . n A 1 91 GLY 91 91 91 GLY GLY A . n A 1 92 CYS 92 92 92 CYS CYS A . n A 1 93 LEU 93 93 93 LEU LEU A . n A 1 94 SER 94 94 94 SER SER A . n A 1 95 VAL 95 95 95 VAL VAL A . n A 1 96 PRO 96 96 96 PRO PRO A . n A 1 97 GLY 97 97 97 GLY GLY A . n A 1 98 PHE 98 98 98 PHE PHE A . n A 1 99 TYR 99 99 99 TYR TYR A . n A 1 100 GLU 100 100 100 GLU GLU A . n A 1 101 ASN 101 101 101 ASN ASN A . n A 1 102 VAL 102 102 102 VAL VAL A . n A 1 103 ASP 103 103 103 ASP ASP A . n A 1 104 ARG 104 104 104 ARG ARG A . n A 1 105 PRO 105 105 105 PRO PRO A . n A 1 106 GLN 106 106 106 GLN GLN A . n A 1 107 LYS 107 107 107 LYS LYS A . n A 1 108 VAL 108 108 108 VAL VAL A . n A 1 109 ARG 109 109 109 ARG ARG A . n A 1 110 ILE 110 110 110 ILE ILE A . n A 1 111 LYS 111 111 111 LYS LYS A . n A 1 112 ALA 112 112 112 ALA ALA A . n A 1 113 LEU 113 113 113 LEU LEU A . n A 1 114 ASP 114 114 114 ASP ASP A . n A 1 115 ARG 115 115 115 ARG ARG A . n A 1 116 ASP 116 116 116 ASP ASP A . n A 1 117 GLY 117 117 117 GLY GLY A . n A 1 118 ASN 118 118 118 ASN ASN A . n A 1 119 PRO 119 119 119 PRO PRO A . n A 1 120 PHE 120 120 120 PHE PHE A . n A 1 121 GLU 121 121 121 GLU GLU A . n A 1 122 GLU 122 122 122 GLU GLU A . n A 1 123 VAL 123 123 123 VAL VAL A . n A 1 124 ALA 124 124 124 ALA ALA A . n A 1 125 GLU 125 125 125 GLU GLU A . n A 1 126 GLY 126 126 126 GLY GLY A . n A 1 127 LEU 127 127 127 LEU LEU A . n A 1 128 LEU 128 128 128 LEU LEU A . n A 1 129 ALA 129 129 129 ALA ALA A . n A 1 130 VAL 130 130 130 VAL VAL A . n A 1 131 CYS 131 131 131 CYS CYS A . n A 1 132 ILE 132 132 132 ILE ILE A . n A 1 133 GLN 133 133 133 GLN GLN A . n A 1 134 HIS 134 134 134 HIS HIS A . n A 1 135 GLU 135 135 135 GLU GLU A . n A 1 136 CYS 136 136 136 CYS CYS A . n A 1 137 ASP 137 137 137 ASP ASP A . n A 1 138 HIS 138 138 138 HIS HIS A . n A 1 139 LEU 139 139 139 LEU LEU A . n A 1 140 ASN 140 140 140 ASN ASN A . n A 1 141 GLY 141 141 141 GLY GLY A . n A 1 142 LYS 142 142 142 LYS LYS A . n A 1 143 LEU 143 143 143 LEU LEU A . n A 1 144 PHE 144 144 144 PHE PHE A . n A 1 145 VAL 145 145 145 VAL VAL A . n A 1 146 ASP 146 146 146 ASP ASP A . n A 1 147 TYR 147 147 147 TYR TYR A . n A 1 148 LEU 148 148 148 LEU LEU A . n A 1 149 SER 149 149 149 SER SER A . n A 1 150 THR 150 150 150 THR THR A . n A 1 151 LEU 151 151 151 LEU LEU A . n A 1 152 LYS 152 152 152 LYS LYS A . n A 1 153 ARG 153 153 153 ARG ARG A . n A 1 154 ASP 154 154 154 ASP ASP A . n A 1 155 ARG 155 155 155 ARG ARG A . n A 1 156 ILE 156 156 156 ILE ILE A . n A 1 157 ARG 157 157 157 ARG ARG A . n A 1 158 LYS 158 158 158 LYS LYS A . n A 1 159 LYS 159 159 159 LYS LYS A . n A 1 160 LEU 160 160 160 LEU LEU A . n A 1 161 GLU 161 161 161 GLU GLU A . n A 1 162 LYS 162 162 162 LYS LYS A . n A 1 163 GLN 163 163 163 GLN GLN A . n A 1 164 HIS 164 164 164 HIS HIS A . n A 1 165 ARG 165 165 165 ARG ARG A . n A 1 166 GLN 166 166 166 GLN GLN A . n A 1 167 GLN 167 167 167 GLN GLN A . n A 1 168 ALA 168 168 168 ALA ALA A . n B 2 1 ASP 1 1 1 ASP ASP B . n B 2 2 TYR 2 2 2 TYR TYR B . n B 2 3 ILE 3 3 3 ILE ILE B . n B 2 4 ARG 4 4 4 ARG ARG B . n B 2 5 GLU 5 5 5 GLU GLU B . n B 2 6 LEU 6 6 6 LEU LEU B . n B 2 7 ARG 7 7 7 ARG ARG B . n B 2 8 ALA 8 8 8 ALA ALA B . n B 2 9 ALA 9 9 9 ALA ALA B . n B 2 10 LEU 10 10 10 LEU LEU B . n B 2 11 ILE 11 11 11 ILE ILE B . n B 2 12 LEU 12 12 12 LEU LEU B . n B 2 13 LEU 13 13 13 LEU LEU B . n B 2 14 ALA 14 14 14 ALA ALA B . n B 2 15 LEU 15 15 15 LEU LEU B . n B 2 16 LYS 16 16 16 LYS LYS B . n B 2 17 LYS 17 17 17 LYS LYS B . n B 2 18 GLN 18 18 18 GLN GLN B . n B 2 19 HIS 19 19 19 HIS HIS B . n B 2 20 ALA 20 20 20 ALA ALA B . n B 2 21 GLU 21 21 21 GLU GLU B . n B 2 22 ASP 22 22 22 ASP ASP B . n B 2 23 PRO 23 23 23 PRO PRO B . n B 2 24 ASP 24 24 24 ASP ASP B . n B 2 25 ALA 25 25 25 ALA ALA B . n B 2 26 GLN 26 26 26 GLN GLN B . n B 2 27 ARG 27 27 27 ARG ARG B . n B 2 28 VAL 28 28 28 VAL VAL B . n B 2 29 ALA 29 29 29 ALA ALA B . n B 2 30 ASP 30 30 30 ASP ASP B . n B 2 31 GLU 31 31 31 GLU GLU B . n B 2 32 LEU 32 32 32 LEU LEU B . n B 2 33 MET 33 33 33 MET MET B . n B 2 34 LYS 34 34 34 LYS LYS B . n B 2 35 LYS 35 35 35 LYS LYS B . n B 2 36 LEU 36 36 36 LEU LEU B . n B 2 37 PHE 37 37 37 PHE PHE B . n B 2 38 ASP 38 38 38 ASP ASP B . n B 2 39 ALA 39 39 39 ALA ALA B . n B 2 40 ALA 40 40 40 ALA ALA B . n B 2 41 HIS 41 41 41 HIS HIS B . n B 2 42 ARG 42 42 42 ARG ARG B . n B 2 43 ASN 43 43 43 ASN ASN B . n B 2 44 ASP 44 44 44 ASP ASP B . n B 2 45 LYS 45 45 45 LYS LYS B . n B 2 46 ASP 46 46 46 ASP ASP B . n B 2 47 LYS 47 47 47 LYS LYS B . n B 2 48 VAL 48 48 48 VAL VAL B . n B 2 49 LYS 49 49 49 LYS LYS B . n B 2 50 LYS 50 50 50 LYS LYS B . n B 2 51 VAL 51 51 51 VAL VAL B . n B 2 52 VAL 52 52 52 VAL VAL B . n B 2 53 GLU 53 53 53 GLU GLU B . n B 2 54 GLU 54 54 54 GLU GLU B . n B 2 55 ALA 55 55 55 ALA ALA B . n B 2 56 LYS 56 56 56 LYS LYS B . n B 2 57 LYS 57 57 57 LYS LYS B . n B 2 58 VAL 58 58 58 VAL VAL B . n B 2 59 VAL 59 59 59 VAL VAL B . n B 2 60 SER 60 60 60 SER SER B . n B 2 61 THR 61 61 61 THR THR B . n B 2 62 TYR 62 62 ? ? ? B . n B 2 63 GLY 63 63 ? ? ? B . n B 2 64 SER 64 64 ? ? ? B . n B 2 65 HIS 65 65 ? ? ? B . n B 2 66 HIS 66 66 ? ? ? B . n B 2 67 HIS 67 67 ? ? ? B . n B 2 68 HIS 68 68 ? ? ? B . n B 2 69 HIS 69 69 ? ? ? B . n B 2 70 HIS 70 70 ? ? ? B . n # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id BB2 _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id BB2 _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 3 ZN 1 201 197 ZN ZN A . D 4 BB2 1 202 199 BB2 BB2 A . E 5 FMT 1 203 200 FMT FMT A . F 5 FMT 1 204 201 FMT FMT A . G 5 FMT 1 205 202 FMT FMT A . H 5 FMT 1 206 203 FMT FMT A . I 5 FMT 1 207 204 FMT FMT A . J 5 FMT 1 208 205 FMT FMT A . K 5 FMT 1 209 206 FMT FMT A . L 5 FMT 1 210 101 FMT FMT A . M 6 PO4 1 211 1 PO4 PO4 A . N 6 PO4 1 212 2 PO4 PO4 A . O 6 PO4 1 213 3 PO4 PO4 A . P 6 PO4 1 214 4 PO4 PO4 A . Q 7 K 1 101 1 K K B . R 8 HOH 1 301 76 HOH HOH A . R 8 HOH 2 302 49 HOH HOH A . R 8 HOH 3 303 23 HOH HOH A . R 8 HOH 4 304 70 HOH HOH A . R 8 HOH 5 305 6 HOH HOH A . R 8 HOH 6 306 71 HOH HOH A . R 8 HOH 7 307 7 HOH HOH A . R 8 HOH 8 308 75 HOH HOH A . R 8 HOH 9 309 39 HOH HOH A . R 8 HOH 10 310 66 HOH HOH A . R 8 HOH 11 311 37 HOH HOH A . R 8 HOH 12 312 25 HOH HOH A . R 8 HOH 13 313 41 HOH HOH A . R 8 HOH 14 314 65 HOH HOH A . R 8 HOH 15 315 53 HOH HOH A . R 8 HOH 16 316 1 HOH HOH A . R 8 HOH 17 317 24 HOH HOH A . R 8 HOH 18 318 5 HOH HOH A . R 8 HOH 19 319 63 HOH HOH A . R 8 HOH 20 320 11 HOH HOH A . R 8 HOH 21 321 47 HOH HOH A . R 8 HOH 22 322 46 HOH HOH A . R 8 HOH 23 323 19 HOH HOH A . R 8 HOH 24 324 60 HOH HOH A . R 8 HOH 25 325 40 HOH HOH A . R 8 HOH 26 326 3 HOH HOH A . R 8 HOH 27 327 64 HOH HOH A . R 8 HOH 28 328 22 HOH HOH A . R 8 HOH 29 329 2 HOH HOH A . R 8 HOH 30 330 30 HOH HOH A . R 8 HOH 31 331 20 HOH HOH A . R 8 HOH 32 332 61 HOH HOH A . R 8 HOH 33 333 9 HOH HOH A . R 8 HOH 34 334 59 HOH HOH A . R 8 HOH 35 335 15 HOH HOH A . R 8 HOH 36 336 33 HOH HOH A . R 8 HOH 37 337 43 HOH HOH A . R 8 HOH 38 338 55 HOH HOH A . R 8 HOH 39 339 42 HOH HOH A . R 8 HOH 40 340 69 HOH HOH A . R 8 HOH 41 341 12 HOH HOH A . R 8 HOH 42 342 44 HOH HOH A . R 8 HOH 43 343 32 HOH HOH A . R 8 HOH 44 344 38 HOH HOH A . R 8 HOH 45 345 57 HOH HOH A . R 8 HOH 46 346 18 HOH HOH A . R 8 HOH 47 347 4 HOH HOH A . R 8 HOH 48 348 73 HOH HOH A . R 8 HOH 49 349 17 HOH HOH A . R 8 HOH 50 350 13 HOH HOH A . R 8 HOH 51 351 8 HOH HOH A . R 8 HOH 52 352 21 HOH HOH A . R 8 HOH 53 353 27 HOH HOH A . R 8 HOH 54 354 28 HOH HOH A . R 8 HOH 55 355 34 HOH HOH A . R 8 HOH 56 356 58 HOH HOH A . R 8 HOH 57 357 56 HOH HOH A . R 8 HOH 58 358 74 HOH HOH A . R 8 HOH 59 359 10 HOH HOH A . R 8 HOH 60 360 36 HOH HOH A . R 8 HOH 61 361 14 HOH HOH A . R 8 HOH 62 362 67 HOH HOH A . R 8 HOH 63 363 16 HOH HOH A . R 8 HOH 64 364 54 HOH HOH A . R 8 HOH 65 365 45 HOH HOH A . R 8 HOH 66 366 48 HOH HOH A . R 8 HOH 67 367 62 HOH HOH A . R 8 HOH 68 368 35 HOH HOH A . S 8 HOH 1 201 52 HOH HOH B . S 8 HOH 2 202 51 HOH HOH B . S 8 HOH 3 203 31 HOH HOH B . S 8 HOH 4 204 72 HOH HOH B . S 8 HOH 5 205 29 HOH HOH B . S 8 HOH 6 206 26 HOH HOH B . S 8 HOH 7 207 68 HOH HOH B . S 8 HOH 8 208 50 HOH HOH B . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.21_5184 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? autoPROC ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? autoPROC ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 8S1X _cell.details ? _cell.formula_units_Z ? _cell.length_a 49.440 _cell.length_a_esd ? _cell.length_b 75.010 _cell.length_b_esd ? _cell.length_c 83.160 _cell.length_c_esd ? _cell.volume 308398.394 _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 8S1X _symmetry.cell_setting ? _symmetry.Int_Tables_number 19 _symmetry.space_group_name_Hall 'P 2ac 2ab' _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 8S1X _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.80 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 56.06 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 6.2 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.2 M Sodium Formate, 0.1 M Sodium Phosphate pH 6.2, 20% (v/v) PEG smear, 10% (v/v) glycerol' _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 291.15 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS3 2M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2024-02-11 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.87313 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'ESRF BEAMLINE MASSIF-1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.87313 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline MASSIF-1 _diffrn_source.pdbx_synchrotron_site ESRF # _reflns.B_iso_Wilson_estimate 44.77 _reflns.entry_id 8S1X _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.88 _reflns.d_resolution_low 55.7 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 24990 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 96.9 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 4.3 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 15.0 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.999 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs 0.044 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 1.88 _reflns_shell.d_res_low 1.91 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 1.3 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 1266 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 4.4 _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.426 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.percent_possible_all 99.6 _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 1.125 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 57.21 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 8S1X _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.88 _refine.ls_d_res_low 55.70 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 24982 _refine.ls_number_reflns_R_free 1255 _refine.ls_number_reflns_R_work 23727 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 96.83 _refine.ls_percent_reflns_R_free 5.02 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1846 _refine.ls_R_factor_R_free 0.2027 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1837 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.34 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values 'GeoStd + Monomer Library + CDL v1.2' _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1000 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 21.4881 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.2366 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 1.88 _refine_hist.d_res_low 55.70 _refine_hist.number_atoms_solvent 76 _refine_hist.number_atoms_total 1991 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 1842 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 73 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.0064 ? 1939 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.7791 ? 2604 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.0509 ? 289 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.0093 ? 339 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 15.6309 ? 777 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free _refine_ls_shell.R_factor_R_free 'X-RAY DIFFRACTION' 1.88 1.96 . . 149 2652 99.26 . . . . 0.3037 . . . . . . . . . . . 0.3416 'X-RAY DIFFRACTION' 1.96 2.05 . . 133 2642 98.44 . . . . 0.2772 . . . . . . . . . . . 0.2812 'X-RAY DIFFRACTION' 2.05 2.15 . . 145 2647 98.52 . . . . 0.2319 . . . . . . . . . . . 0.2773 'X-RAY DIFFRACTION' 2.15 2.29 . . 147 2598 97.90 . . . . 0.1979 . . . . . . . . . . . 0.2435 'X-RAY DIFFRACTION' 2.29 2.46 . . 146 2638 98.10 . . . . 0.1906 . . . . . . . . . . . 0.1866 'X-RAY DIFFRACTION' 2.46 2.71 . . 134 2646 97.17 . . . . 0.1961 . . . . . . . . . . . 0.2393 'X-RAY DIFFRACTION' 2.71 3.11 . . 139 2626 95.84 . . . . 0.1896 . . . . . . . . . . . 0.2045 'X-RAY DIFFRACTION' 3.11 3.91 . . 151 2557 93.70 . . . . 0.1723 . . . . . . . . . . . 0.1775 'X-RAY DIFFRACTION' 3.91 55.70 . . 111 2721 92.97 . . . . 0.1675 . . . . . . . . . . . 0.1874 # _struct.entry_id 8S1X _struct.title 'Crystal structure of Actinonin-bound PDF1 and the computationally designed DBAct553_1 protein binder' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 8S1X _struct_keywords.text 'Actinonin, de novo, computational, binder, CID, switch, deformylase, DE NOVO PROTEIN' _struct_keywords.pdbx_keywords 'DE NOVO PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? E N N 5 ? F N N 5 ? G N N 5 ? H N N 5 ? I N N 5 ? J N N 5 ? K N N 5 ? L N N 5 ? M N N 6 ? N N N 6 ? O N N 6 ? P N N 6 ? Q N N 7 ? R N N 8 ? S N N 8 ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP DEF_PSEAE Q9I7A8 ? 1 ;MAILNILEFPDPRLRTIAKPVEVVDDAVRQLIDDMFETMYEAPGIGLAATQVNVHKRIVVMDLSEDKSEPRVFINPEFEP LTEDMDQYQEGCLSVPGFYENVDRPQKVRIKALDRDGNPFEEVAEGLLAVCIQHECDHLNGKLFVDYLSTLKRDRIRKKL EKQHRQQA ; 1 2 PDB 8S1X 8S1X ? 2 ? 1 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 8S1X A 1 ? 168 ? Q9I7A8 1 ? 168 ? 1 168 2 2 8S1X B 1 ? 70 ? 8S1X 1 ? 70 ? 1 70 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 4730 ? 1 MORE -67 ? 1 'SSA (A^2)' 11590 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F,G,H,I,J,K,L,M,N,O,P,Q,R,S # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASP A 11 ? THR A 16 ? ASP A 11 THR A 16 5 ? 6 HELX_P HELX_P2 AA2 ASP A 25 ? ALA A 42 ? ASP A 25 ALA A 42 1 ? 18 HELX_P HELX_P3 AA3 THR A 50 ? ASN A 53 ? THR A 50 ASN A 53 5 ? 4 HELX_P HELX_P4 AA4 GLY A 126 ? ASN A 140 ? GLY A 126 ASN A 140 1 ? 15 HELX_P HELX_P5 AA5 LEU A 143 ? LEU A 148 ? LEU A 143 LEU A 148 5 ? 6 HELX_P HELX_P6 AA6 SER A 149 ? ALA A 168 ? SER A 149 ALA A 168 1 ? 20 HELX_P HELX_P7 AA7 TYR B 2 ? ALA B 20 ? TYR B 2 ALA B 20 1 ? 19 HELX_P HELX_P8 AA8 ASP B 22 ? ARG B 42 ? ASP B 22 ARG B 42 1 ? 21 HELX_P HELX_P9 AA9 ASP B 44 ? SER B 60 ? ASP B 44 SER B 60 1 ? 17 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A CYS 92 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 92 A ZN 201 1_555 ? ? ? ? ? ? ? 2.274 ? ? metalc2 metalc ? ? A TYR 99 O ? ? ? 1_555 Q K . K ? ? A TYR 99 B K 101 1_555 ? ? ? ? ? ? ? 3.275 ? ? metalc3 metalc ? ? A HIS 134 NE2 ? ? ? 1_555 C ZN . ZN ? ? A HIS 134 A ZN 201 1_555 ? ? ? ? ? ? ? 2.172 ? ? metalc4 metalc ? ? A HIS 138 NE2 ? ? ? 1_555 C ZN . ZN ? ? A HIS 138 A ZN 201 1_555 ? ? ? ? ? ? ? 2.215 ? ? metalc5 metalc ? ? C ZN . ZN ? ? ? 1_555 D BB2 . O2 ? ? A ZN 201 A BB2 202 1_555 ? ? ? ? ? ? ? 2.200 ? ? metalc6 metalc ? ? C ZN . ZN ? ? ? 1_555 D BB2 . O4 ? ? A ZN 201 A BB2 202 1_555 ? ? ? ? ? ? ? 2.200 ? ? metalc7 metalc ? ? R HOH . O ? ? ? 1_555 Q K . K ? ? A HOH 314 B K 101 1_555 ? ? ? ? ? ? ? 3.085 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 SG ? A CYS 92 ? A CYS 92 ? 1_555 ZN ? C ZN . ? A ZN 201 ? 1_555 NE2 ? A HIS 134 ? A HIS 134 ? 1_555 104.4 ? 2 SG ? A CYS 92 ? A CYS 92 ? 1_555 ZN ? C ZN . ? A ZN 201 ? 1_555 NE2 ? A HIS 138 ? A HIS 138 ? 1_555 91.6 ? 3 NE2 ? A HIS 134 ? A HIS 134 ? 1_555 ZN ? C ZN . ? A ZN 201 ? 1_555 NE2 ? A HIS 138 ? A HIS 138 ? 1_555 98.9 ? 4 SG ? A CYS 92 ? A CYS 92 ? 1_555 ZN ? C ZN . ? A ZN 201 ? 1_555 O2 ? D BB2 . ? A BB2 202 ? 1_555 158.8 ? 5 NE2 ? A HIS 134 ? A HIS 134 ? 1_555 ZN ? C ZN . ? A ZN 201 ? 1_555 O2 ? D BB2 . ? A BB2 202 ? 1_555 95.8 ? 6 NE2 ? A HIS 138 ? A HIS 138 ? 1_555 ZN ? C ZN . ? A ZN 201 ? 1_555 O2 ? D BB2 . ? A BB2 202 ? 1_555 91.5 ? 7 SG ? A CYS 92 ? A CYS 92 ? 1_555 ZN ? C ZN . ? A ZN 201 ? 1_555 O4 ? D BB2 . ? A BB2 202 ? 1_555 91.2 ? 8 NE2 ? A HIS 134 ? A HIS 134 ? 1_555 ZN ? C ZN . ? A ZN 201 ? 1_555 O4 ? D BB2 . ? A BB2 202 ? 1_555 111.8 ? 9 NE2 ? A HIS 138 ? A HIS 138 ? 1_555 ZN ? C ZN . ? A ZN 201 ? 1_555 O4 ? D BB2 . ? A BB2 202 ? 1_555 147.4 ? 10 O2 ? D BB2 . ? A BB2 202 ? 1_555 ZN ? C ZN . ? A ZN 201 ? 1_555 O4 ? D BB2 . ? A BB2 202 ? 1_555 75.2 ? 11 O ? A TYR 99 ? A TYR 99 ? 1_555 K ? Q K . ? B K 101 ? 1_555 O ? R HOH . ? A HOH 314 ? 1_555 67.8 ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 PHE 9 A . ? PHE 9 A PRO 10 A ? PRO 10 A 1 5.34 2 ALA 42 A . ? ALA 42 A PRO 43 A ? PRO 43 A 1 -7.64 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 5 ? AA2 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA2 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 GLY A 46 ? ALA A 48 ? GLY A 46 ALA A 48 AA1 2 ILE A 58 ? ASP A 62 ? ILE A 58 ASP A 62 AA1 3 PRO A 70 ? PRO A 80 ? PRO A 70 PRO A 80 AA1 4 LYS A 107 ? LEU A 113 ? LYS A 107 LEU A 113 AA1 5 PRO A 119 ? GLU A 125 ? PRO A 119 GLU A 125 AA2 1 ASP A 86 ? GLU A 90 ? ASP A 86 GLU A 90 AA2 2 GLU A 100 ? ARG A 104 ? GLU A 100 ARG A 104 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N LEU A 47 ? N LEU A 47 O VAL A 60 ? O VAL A 60 AA1 2 3 N MET A 61 ? N MET A 61 O ARG A 71 ? O ARG A 71 AA1 3 4 N GLU A 79 ? N GLU A 79 O ARG A 109 ? O ARG A 109 AA1 4 5 N ILE A 110 ? N ILE A 110 O GLU A 122 ? O GLU A 122 AA2 1 2 N ASP A 86 ? N ASP A 86 O ARG A 104 ? O ARG A 104 # _pdbx_entry_details.entry_id 8S1X _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_protein_modification N # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id PRO _pdbx_validate_torsion.auth_asym_id A _pdbx_validate_torsion.auth_seq_id 10 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi -95.62 _pdbx_validate_torsion.psi 34.49 # loop_ _space_group_symop.id _space_group_symop.operation_xyz 1 x,y,z 2 x+1/2,-y+1/2,-z 3 -x,y+1/2,-z+1/2 4 -x+1/2,-y,z+1/2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 B TYR 62 ? B TYR 62 3 1 Y 1 B GLY 63 ? B GLY 63 4 1 Y 1 B SER 64 ? B SER 64 5 1 Y 1 B HIS 65 ? B HIS 65 6 1 Y 1 B HIS 66 ? B HIS 66 7 1 Y 1 B HIS 67 ? B HIS 67 8 1 Y 1 B HIS 68 ? B HIS 68 9 1 Y 1 B HIS 69 ? B HIS 69 10 1 Y 1 B HIS 70 ? B HIS 70 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 BB2 C5 C N N 74 BB2 C3 C N N 75 BB2 O4 O N N 76 BB2 N1 N N N 77 BB2 O2 O N N 78 BB2 C6 C N R 79 BB2 C12 C N N 80 BB2 O13 O N N 81 BB2 C7 C N N 82 BB2 C8 C N N 83 BB2 C9 C N N 84 BB2 C10 C N N 85 BB2 C11 C N N 86 BB2 N14 N N N 87 BB2 C15 C N S 88 BB2 C16 C N N 89 BB2 C18 C N N 90 BB2 C17 C N N 91 BB2 C19 C N N 92 BB2 O20 O N N 93 BB2 N21 N N N 94 BB2 C22 C N S 95 BB2 C23 C N N 96 BB2 C24 C N N 97 BB2 C25 C N N 98 BB2 C26 C N N 99 BB2 O27 O N N 100 BB2 H51 H N N 101 BB2 H52 H N N 102 BB2 HN1 H N N 103 BB2 HO2 H N N 104 BB2 H6 H N N 105 BB2 H71 H N N 106 BB2 H72 H N N 107 BB2 H81 H N N 108 BB2 H82 H N N 109 BB2 H91 H N N 110 BB2 H92 H N N 111 BB2 H101 H N N 112 BB2 H102 H N N 113 BB2 H111 H N N 114 BB2 H112 H N N 115 BB2 H113 H N N 116 BB2 H14 H N N 117 BB2 H15 H N N 118 BB2 H16 H N N 119 BB2 H181 H N N 120 BB2 H182 H N N 121 BB2 H183 H N N 122 BB2 H171 H N N 123 BB2 H172 H N N 124 BB2 H173 H N N 125 BB2 H22 H N N 126 BB2 H231 H N N 127 BB2 H232 H N N 128 BB2 H241 H N N 129 BB2 H242 H N N 130 BB2 H251 H N N 131 BB2 H252 H N N 132 BB2 H261 H N N 133 BB2 H262 H N N 134 BB2 H27 H N N 135 CYS N N N N 136 CYS CA C N R 137 CYS C C N N 138 CYS O O N N 139 CYS CB C N N 140 CYS SG S N N 141 CYS OXT O N N 142 CYS H H N N 143 CYS H2 H N N 144 CYS HA H N N 145 CYS HB2 H N N 146 CYS HB3 H N N 147 CYS HG H N N 148 CYS HXT H N N 149 FMT C C N N 150 FMT O1 O N N 151 FMT O2 O N N 152 FMT H H N N 153 FMT HO2 H N N 154 GLN N N N N 155 GLN CA C N S 156 GLN C C N N 157 GLN O O N N 158 GLN CB C N N 159 GLN CG C N N 160 GLN CD C N N 161 GLN OE1 O N N 162 GLN NE2 N N N 163 GLN OXT O N N 164 GLN H H N N 165 GLN H2 H N N 166 GLN HA H N N 167 GLN HB2 H N N 168 GLN HB3 H N N 169 GLN HG2 H N N 170 GLN HG3 H N N 171 GLN HE21 H N N 172 GLN HE22 H N N 173 GLN HXT H N N 174 GLU N N N N 175 GLU CA C N S 176 GLU C C N N 177 GLU O O N N 178 GLU CB C N N 179 GLU CG C N N 180 GLU CD C N N 181 GLU OE1 O N N 182 GLU OE2 O N N 183 GLU OXT O N N 184 GLU H H N N 185 GLU H2 H N N 186 GLU HA H N N 187 GLU HB2 H N N 188 GLU HB3 H N N 189 GLU HG2 H N N 190 GLU HG3 H N N 191 GLU HE2 H N N 192 GLU HXT H N N 193 GLY N N N N 194 GLY CA C N N 195 GLY C C N N 196 GLY O O N N 197 GLY OXT O N N 198 GLY H H N N 199 GLY H2 H N N 200 GLY HA2 H N N 201 GLY HA3 H N N 202 GLY HXT H N N 203 HIS N N N N 204 HIS CA C N S 205 HIS C C N N 206 HIS O O N N 207 HIS CB C N N 208 HIS CG C Y N 209 HIS ND1 N Y N 210 HIS CD2 C Y N 211 HIS CE1 C Y N 212 HIS NE2 N Y N 213 HIS OXT O N N 214 HIS H H N N 215 HIS H2 H N N 216 HIS HA H N N 217 HIS HB2 H N N 218 HIS HB3 H N N 219 HIS HD1 H N N 220 HIS HD2 H N N 221 HIS HE1 H N N 222 HIS HE2 H N N 223 HIS HXT H N N 224 HOH O O N N 225 HOH H1 H N N 226 HOH H2 H N N 227 ILE N N N N 228 ILE CA C N S 229 ILE C C N N 230 ILE O O N N 231 ILE CB C N S 232 ILE CG1 C N N 233 ILE CG2 C N N 234 ILE CD1 C N N 235 ILE OXT O N N 236 ILE H H N N 237 ILE H2 H N N 238 ILE HA H N N 239 ILE HB H N N 240 ILE HG12 H N N 241 ILE HG13 H N N 242 ILE HG21 H N N 243 ILE HG22 H N N 244 ILE HG23 H N N 245 ILE HD11 H N N 246 ILE HD12 H N N 247 ILE HD13 H N N 248 ILE HXT H N N 249 K K K N N 250 LEU N N N N 251 LEU CA C N S 252 LEU C C N N 253 LEU O O N N 254 LEU CB C N N 255 LEU CG C N N 256 LEU CD1 C N N 257 LEU CD2 C N N 258 LEU OXT O N N 259 LEU H H N N 260 LEU H2 H N N 261 LEU HA H N N 262 LEU HB2 H N N 263 LEU HB3 H N N 264 LEU HG H N N 265 LEU HD11 H N N 266 LEU HD12 H N N 267 LEU HD13 H N N 268 LEU HD21 H N N 269 LEU HD22 H N N 270 LEU HD23 H N N 271 LEU HXT H N N 272 LYS N N N N 273 LYS CA C N S 274 LYS C C N N 275 LYS O O N N 276 LYS CB C N N 277 LYS CG C N N 278 LYS CD C N N 279 LYS CE C N N 280 LYS NZ N N N 281 LYS OXT O N N 282 LYS H H N N 283 LYS H2 H N N 284 LYS HA H N N 285 LYS HB2 H N N 286 LYS HB3 H N N 287 LYS HG2 H N N 288 LYS HG3 H N N 289 LYS HD2 H N N 290 LYS HD3 H N N 291 LYS HE2 H N N 292 LYS HE3 H N N 293 LYS HZ1 H N N 294 LYS HZ2 H N N 295 LYS HZ3 H N N 296 LYS HXT H N N 297 MET N N N N 298 MET CA C N S 299 MET C C N N 300 MET O O N N 301 MET CB C N N 302 MET CG C N N 303 MET SD S N N 304 MET CE C N N 305 MET OXT O N N 306 MET H H N N 307 MET H2 H N N 308 MET HA H N N 309 MET HB2 H N N 310 MET HB3 H N N 311 MET HG2 H N N 312 MET HG3 H N N 313 MET HE1 H N N 314 MET HE2 H N N 315 MET HE3 H N N 316 MET HXT H N N 317 PHE N N N N 318 PHE CA C N S 319 PHE C C N N 320 PHE O O N N 321 PHE CB C N N 322 PHE CG C Y N 323 PHE CD1 C Y N 324 PHE CD2 C Y N 325 PHE CE1 C Y N 326 PHE CE2 C Y N 327 PHE CZ C Y N 328 PHE OXT O N N 329 PHE H H N N 330 PHE H2 H N N 331 PHE HA H N N 332 PHE HB2 H N N 333 PHE HB3 H N N 334 PHE HD1 H N N 335 PHE HD2 H N N 336 PHE HE1 H N N 337 PHE HE2 H N N 338 PHE HZ H N N 339 PHE HXT H N N 340 PO4 P P N N 341 PO4 O1 O N N 342 PO4 O2 O N N 343 PO4 O3 O N N 344 PO4 O4 O N N 345 PRO N N N N 346 PRO CA C N S 347 PRO C C N N 348 PRO O O N N 349 PRO CB C N N 350 PRO CG C N N 351 PRO CD C N N 352 PRO OXT O N N 353 PRO H H N N 354 PRO HA H N N 355 PRO HB2 H N N 356 PRO HB3 H N N 357 PRO HG2 H N N 358 PRO HG3 H N N 359 PRO HD2 H N N 360 PRO HD3 H N N 361 PRO HXT H N N 362 SER N N N N 363 SER CA C N S 364 SER C C N N 365 SER O O N N 366 SER CB C N N 367 SER OG O N N 368 SER OXT O N N 369 SER H H N N 370 SER H2 H N N 371 SER HA H N N 372 SER HB2 H N N 373 SER HB3 H N N 374 SER HG H N N 375 SER HXT H N N 376 THR N N N N 377 THR CA C N S 378 THR C C N N 379 THR O O N N 380 THR CB C N R 381 THR OG1 O N N 382 THR CG2 C N N 383 THR OXT O N N 384 THR H H N N 385 THR H2 H N N 386 THR HA H N N 387 THR HB H N N 388 THR HG1 H N N 389 THR HG21 H N N 390 THR HG22 H N N 391 THR HG23 H N N 392 THR HXT H N N 393 TYR N N N N 394 TYR CA C N S 395 TYR C C N N 396 TYR O O N N 397 TYR CB C N N 398 TYR CG C Y N 399 TYR CD1 C Y N 400 TYR CD2 C Y N 401 TYR CE1 C Y N 402 TYR CE2 C Y N 403 TYR CZ C Y N 404 TYR OH O N N 405 TYR OXT O N N 406 TYR H H N N 407 TYR H2 H N N 408 TYR HA H N N 409 TYR HB2 H N N 410 TYR HB3 H N N 411 TYR HD1 H N N 412 TYR HD2 H N N 413 TYR HE1 H N N 414 TYR HE2 H N N 415 TYR HH H N N 416 TYR HXT H N N 417 VAL N N N N 418 VAL CA C N S 419 VAL C C N N 420 VAL O O N N 421 VAL CB C N N 422 VAL CG1 C N N 423 VAL CG2 C N N 424 VAL OXT O N N 425 VAL H H N N 426 VAL H2 H N N 427 VAL HA H N N 428 VAL HB H N N 429 VAL HG11 H N N 430 VAL HG12 H N N 431 VAL HG13 H N N 432 VAL HG21 H N N 433 VAL HG22 H N N 434 VAL HG23 H N N 435 VAL HXT H N N 436 ZN ZN ZN N N 437 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 BB2 C5 C3 sing N N 70 BB2 C5 C6 sing N N 71 BB2 C5 H51 sing N N 72 BB2 C5 H52 sing N N 73 BB2 C3 O4 doub N N 74 BB2 C3 N1 sing N N 75 BB2 N1 O2 sing N N 76 BB2 N1 HN1 sing N N 77 BB2 O2 HO2 sing N N 78 BB2 C6 C12 sing N N 79 BB2 C6 C7 sing N N 80 BB2 C6 H6 sing N N 81 BB2 C12 O13 doub N N 82 BB2 C12 N14 sing N N 83 BB2 C7 C8 sing N N 84 BB2 C7 H71 sing N N 85 BB2 C7 H72 sing N N 86 BB2 C8 C9 sing N N 87 BB2 C8 H81 sing N N 88 BB2 C8 H82 sing N N 89 BB2 C9 C10 sing N N 90 BB2 C9 H91 sing N N 91 BB2 C9 H92 sing N N 92 BB2 C10 C11 sing N N 93 BB2 C10 H101 sing N N 94 BB2 C10 H102 sing N N 95 BB2 C11 H111 sing N N 96 BB2 C11 H112 sing N N 97 BB2 C11 H113 sing N N 98 BB2 N14 C15 sing N N 99 BB2 N14 H14 sing N N 100 BB2 C15 C16 sing N N 101 BB2 C15 C19 sing N N 102 BB2 C15 H15 sing N N 103 BB2 C16 C18 sing N N 104 BB2 C16 C17 sing N N 105 BB2 C16 H16 sing N N 106 BB2 C18 H181 sing N N 107 BB2 C18 H182 sing N N 108 BB2 C18 H183 sing N N 109 BB2 C17 H171 sing N N 110 BB2 C17 H172 sing N N 111 BB2 C17 H173 sing N N 112 BB2 C19 O20 doub N N 113 BB2 C19 N21 sing N N 114 BB2 N21 C22 sing N N 115 BB2 N21 C23 sing N N 116 BB2 C22 C25 sing N N 117 BB2 C22 C26 sing N N 118 BB2 C22 H22 sing N N 119 BB2 C23 C24 sing N N 120 BB2 C23 H231 sing N N 121 BB2 C23 H232 sing N N 122 BB2 C24 C25 sing N N 123 BB2 C24 H241 sing N N 124 BB2 C24 H242 sing N N 125 BB2 C25 H251 sing N N 126 BB2 C25 H252 sing N N 127 BB2 C26 O27 sing N N 128 BB2 C26 H261 sing N N 129 BB2 C26 H262 sing N N 130 BB2 O27 H27 sing N N 131 CYS N CA sing N N 132 CYS N H sing N N 133 CYS N H2 sing N N 134 CYS CA C sing N N 135 CYS CA CB sing N N 136 CYS CA HA sing N N 137 CYS C O doub N N 138 CYS C OXT sing N N 139 CYS CB SG sing N N 140 CYS CB HB2 sing N N 141 CYS CB HB3 sing N N 142 CYS SG HG sing N N 143 CYS OXT HXT sing N N 144 FMT C O1 doub N N 145 FMT C O2 sing N N 146 FMT C H sing N N 147 FMT O2 HO2 sing N N 148 GLN N CA sing N N 149 GLN N H sing N N 150 GLN N H2 sing N N 151 GLN CA C sing N N 152 GLN CA CB sing N N 153 GLN CA HA sing N N 154 GLN C O doub N N 155 GLN C OXT sing N N 156 GLN CB CG sing N N 157 GLN CB HB2 sing N N 158 GLN CB HB3 sing N N 159 GLN CG CD sing N N 160 GLN CG HG2 sing N N 161 GLN CG HG3 sing N N 162 GLN CD OE1 doub N N 163 GLN CD NE2 sing N N 164 GLN NE2 HE21 sing N N 165 GLN NE2 HE22 sing N N 166 GLN OXT HXT sing N N 167 GLU N CA sing N N 168 GLU N H sing N N 169 GLU N H2 sing N N 170 GLU CA C sing N N 171 GLU CA CB sing N N 172 GLU CA HA sing N N 173 GLU C O doub N N 174 GLU C OXT sing N N 175 GLU CB CG sing N N 176 GLU CB HB2 sing N N 177 GLU CB HB3 sing N N 178 GLU CG CD sing N N 179 GLU CG HG2 sing N N 180 GLU CG HG3 sing N N 181 GLU CD OE1 doub N N 182 GLU CD OE2 sing N N 183 GLU OE2 HE2 sing N N 184 GLU OXT HXT sing N N 185 GLY N CA sing N N 186 GLY N H sing N N 187 GLY N H2 sing N N 188 GLY CA C sing N N 189 GLY CA HA2 sing N N 190 GLY CA HA3 sing N N 191 GLY C O doub N N 192 GLY C OXT sing N N 193 GLY OXT HXT sing N N 194 HIS N CA sing N N 195 HIS N H sing N N 196 HIS N H2 sing N N 197 HIS CA C sing N N 198 HIS CA CB sing N N 199 HIS CA HA sing N N 200 HIS C O doub N N 201 HIS C OXT sing N N 202 HIS CB CG sing N N 203 HIS CB HB2 sing N N 204 HIS CB HB3 sing N N 205 HIS CG ND1 sing Y N 206 HIS CG CD2 doub Y N 207 HIS ND1 CE1 doub Y N 208 HIS ND1 HD1 sing N N 209 HIS CD2 NE2 sing Y N 210 HIS CD2 HD2 sing N N 211 HIS CE1 NE2 sing Y N 212 HIS CE1 HE1 sing N N 213 HIS NE2 HE2 sing N N 214 HIS OXT HXT sing N N 215 HOH O H1 sing N N 216 HOH O H2 sing N N 217 ILE N CA sing N N 218 ILE N H sing N N 219 ILE N H2 sing N N 220 ILE CA C sing N N 221 ILE CA CB sing N N 222 ILE CA HA sing N N 223 ILE C O doub N N 224 ILE C OXT sing N N 225 ILE CB CG1 sing N N 226 ILE CB CG2 sing N N 227 ILE CB HB sing N N 228 ILE CG1 CD1 sing N N 229 ILE CG1 HG12 sing N N 230 ILE CG1 HG13 sing N N 231 ILE CG2 HG21 sing N N 232 ILE CG2 HG22 sing N N 233 ILE CG2 HG23 sing N N 234 ILE CD1 HD11 sing N N 235 ILE CD1 HD12 sing N N 236 ILE CD1 HD13 sing N N 237 ILE OXT HXT sing N N 238 LEU N CA sing N N 239 LEU N H sing N N 240 LEU N H2 sing N N 241 LEU CA C sing N N 242 LEU CA CB sing N N 243 LEU CA HA sing N N 244 LEU C O doub N N 245 LEU C OXT sing N N 246 LEU CB CG sing N N 247 LEU CB HB2 sing N N 248 LEU CB HB3 sing N N 249 LEU CG CD1 sing N N 250 LEU CG CD2 sing N N 251 LEU CG HG sing N N 252 LEU CD1 HD11 sing N N 253 LEU CD1 HD12 sing N N 254 LEU CD1 HD13 sing N N 255 LEU CD2 HD21 sing N N 256 LEU CD2 HD22 sing N N 257 LEU CD2 HD23 sing N N 258 LEU OXT HXT sing N N 259 LYS N CA sing N N 260 LYS N H sing N N 261 LYS N H2 sing N N 262 LYS CA C sing N N 263 LYS CA CB sing N N 264 LYS CA HA sing N N 265 LYS C O doub N N 266 LYS C OXT sing N N 267 LYS CB CG sing N N 268 LYS CB HB2 sing N N 269 LYS CB HB3 sing N N 270 LYS CG CD sing N N 271 LYS CG HG2 sing N N 272 LYS CG HG3 sing N N 273 LYS CD CE sing N N 274 LYS CD HD2 sing N N 275 LYS CD HD3 sing N N 276 LYS CE NZ sing N N 277 LYS CE HE2 sing N N 278 LYS CE HE3 sing N N 279 LYS NZ HZ1 sing N N 280 LYS NZ HZ2 sing N N 281 LYS NZ HZ3 sing N N 282 LYS OXT HXT sing N N 283 MET N CA sing N N 284 MET N H sing N N 285 MET N H2 sing N N 286 MET CA C sing N N 287 MET CA CB sing N N 288 MET CA HA sing N N 289 MET C O doub N N 290 MET C OXT sing N N 291 MET CB CG sing N N 292 MET CB HB2 sing N N 293 MET CB HB3 sing N N 294 MET CG SD sing N N 295 MET CG HG2 sing N N 296 MET CG HG3 sing N N 297 MET SD CE sing N N 298 MET CE HE1 sing N N 299 MET CE HE2 sing N N 300 MET CE HE3 sing N N 301 MET OXT HXT sing N N 302 PHE N CA sing N N 303 PHE N H sing N N 304 PHE N H2 sing N N 305 PHE CA C sing N N 306 PHE CA CB sing N N 307 PHE CA HA sing N N 308 PHE C O doub N N 309 PHE C OXT sing N N 310 PHE CB CG sing N N 311 PHE CB HB2 sing N N 312 PHE CB HB3 sing N N 313 PHE CG CD1 doub Y N 314 PHE CG CD2 sing Y N 315 PHE CD1 CE1 sing Y N 316 PHE CD1 HD1 sing N N 317 PHE CD2 CE2 doub Y N 318 PHE CD2 HD2 sing N N 319 PHE CE1 CZ doub Y N 320 PHE CE1 HE1 sing N N 321 PHE CE2 CZ sing Y N 322 PHE CE2 HE2 sing N N 323 PHE CZ HZ sing N N 324 PHE OXT HXT sing N N 325 PO4 P O1 doub N N 326 PO4 P O2 sing N N 327 PO4 P O3 sing N N 328 PO4 P O4 sing N N 329 PRO N CA sing N N 330 PRO N CD sing N N 331 PRO N H sing N N 332 PRO CA C sing N N 333 PRO CA CB sing N N 334 PRO CA HA sing N N 335 PRO C O doub N N 336 PRO C OXT sing N N 337 PRO CB CG sing N N 338 PRO CB HB2 sing N N 339 PRO CB HB3 sing N N 340 PRO CG CD sing N N 341 PRO CG HG2 sing N N 342 PRO CG HG3 sing N N 343 PRO CD HD2 sing N N 344 PRO CD HD3 sing N N 345 PRO OXT HXT sing N N 346 SER N CA sing N N 347 SER N H sing N N 348 SER N H2 sing N N 349 SER CA C sing N N 350 SER CA CB sing N N 351 SER CA HA sing N N 352 SER C O doub N N 353 SER C OXT sing N N 354 SER CB OG sing N N 355 SER CB HB2 sing N N 356 SER CB HB3 sing N N 357 SER OG HG sing N N 358 SER OXT HXT sing N N 359 THR N CA sing N N 360 THR N H sing N N 361 THR N H2 sing N N 362 THR CA C sing N N 363 THR CA CB sing N N 364 THR CA HA sing N N 365 THR C O doub N N 366 THR C OXT sing N N 367 THR CB OG1 sing N N 368 THR CB CG2 sing N N 369 THR CB HB sing N N 370 THR OG1 HG1 sing N N 371 THR CG2 HG21 sing N N 372 THR CG2 HG22 sing N N 373 THR CG2 HG23 sing N N 374 THR OXT HXT sing N N 375 TYR N CA sing N N 376 TYR N H sing N N 377 TYR N H2 sing N N 378 TYR CA C sing N N 379 TYR CA CB sing N N 380 TYR CA HA sing N N 381 TYR C O doub N N 382 TYR C OXT sing N N 383 TYR CB CG sing N N 384 TYR CB HB2 sing N N 385 TYR CB HB3 sing N N 386 TYR CG CD1 doub Y N 387 TYR CG CD2 sing Y N 388 TYR CD1 CE1 sing Y N 389 TYR CD1 HD1 sing N N 390 TYR CD2 CE2 doub Y N 391 TYR CD2 HD2 sing N N 392 TYR CE1 CZ doub Y N 393 TYR CE1 HE1 sing N N 394 TYR CE2 CZ sing Y N 395 TYR CE2 HE2 sing N N 396 TYR CZ OH sing N N 397 TYR OH HH sing N N 398 TYR OXT HXT sing N N 399 VAL N CA sing N N 400 VAL N H sing N N 401 VAL N H2 sing N N 402 VAL CA C sing N N 403 VAL CA CB sing N N 404 VAL CA HA sing N N 405 VAL C O doub N N 406 VAL C OXT sing N N 407 VAL CB CG1 sing N N 408 VAL CB CG2 sing N N 409 VAL CB HB sing N N 410 VAL CG1 HG11 sing N N 411 VAL CG1 HG12 sing N N 412 VAL CG1 HG13 sing N N 413 VAL CG2 HG21 sing N N 414 VAL CG2 HG22 sing N N 415 VAL CG2 HG23 sing N N 416 VAL OXT HXT sing N N 417 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'European Research Council (ERC)' 'European Union' 716058 1 'Swiss National Science Foundation' Switzerland 310030_197724 2 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'in silico model' _pdbx_initial_refinement_model.source_name Other _pdbx_initial_refinement_model.accession_code ? _pdbx_initial_refinement_model.details Rosetta # _space_group.name_H-M_alt 'P 21 21 21' _space_group.name_Hall 'P 2ac 2ab' _space_group.IT_number 19 _space_group.crystal_system orthorhombic _space_group.id 1 # _atom_sites.entry_id 8S1X _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 0.020227 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.013332 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.012025 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.scat_dispersion_real _atom_type.scat_dispersion_imag _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c _atom_type.scat_source _atom_type.scat_dispersion_source C ? ? 3.54356 2.42580 ? ? 25.62398 1.50364 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? H ? ? 0.51345 0.48472 ? ? 24.73122 6.32584 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? K ? ? 16.37977 2.54835 ? ? 4.54127 84.28225 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? N ? ? 4.01032 2.96436 ? ? 19.97189 1.75589 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O ? ? 4.49882 3.47563 ? ? 15.80542 1.70748 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? P ? ? 9.51135 5.44231 ? ? 1.42069 35.72801 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? S ? ? 9.55732 6.39887 ? ? 1.23737 29.19336 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? ZN ? ? 24.64596 5.25405 ? ? 2.14387 29.76375 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? # loop_