data_8S97 # _entry.id 8S97 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.381 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 8S97 pdb_00008s97 10.2210/pdb8s97/pdb WWPDB D_1000273224 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 8S97 _pdbx_database_status.recvd_initial_deposition_date 2023-03-27 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Pathirage, R.' 1 0000-0002-8751-8042 'Ronning, D.' 2 0000-0003-2583-8849 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Rsc Med Chem' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2632-8682 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 14 _citation.language ? _citation.page_first 921 _citation.page_last 933 _citation.title 'Mycobacterium tuberculosis CitA activity is modulated by cysteine oxidation and pyruvate binding.' _citation.year 2023 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1039/d3md00058c _citation.pdbx_database_id_PubMed 37252106 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Pathirage, R.' 1 0000-0002-8751-8042 primary 'Favrot, L.' 2 ? primary 'Petit, C.' 3 ? primary 'Yamsek, M.' 4 ? primary 'Singh, S.' 5 ? primary 'Mallareddy, J.R.' 6 ? primary 'Rana, S.' 7 0000-0001-5802-5970 primary 'Natarajan, A.' 8 0000-0001-5067-0203 primary 'Ronning, D.R.' 9 0000-0003-2583-8849 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 8S97 _cell.details ? _cell.formula_units_Z ? _cell.length_a 148.472 _cell.length_a_esd ? _cell.length_b 148.472 _cell.length_b_esd ? _cell.length_c 230.402 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 16 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 8S97 _symmetry.cell_setting ? _symmetry.Int_Tables_number 98 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'I 41 2 2' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'citrate synthase' 41102.672 1 2.3.3.16 C143W ? ? 2 non-polymer nat 1,2-ETHANEDIOL 62.068 4 ? ? ? ? 3 water nat water 18.015 19 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MTVVPENFVPGLDGVVAFTTEIAEPDKDGGALRYRGVDIEDLVSQRVTFGDVWALLVDGNFGSGLPPAEPFPLPIHSGDV RVDVQAGLAMLAPIWGYAPLLDIDDATARQQLARASVMALSYVAQSARGIYQPAVPQRIIDEWSTVTARFMTRWQGEPDP RHIEAIDAYWVSAAEHGMNASTFTARVIASTGADVAAALSGAIGAMSGPLHGGAPARVLPMLDEVERAGDARSVVKGILD RGEKLMGFGHRVYRAEDPRARVLRAAAERLGAPRYEVAVAVEQAALSELRERRPDRAIETNVEFWAAVVLDFARVPANMM PAMFTCGRTAGWCAHILEQKRLGKLVRPSAIYVGPGPRSPESVDGWERVLTTAHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MTVVPENFVPGLDGVVAFTTEIAEPDKDGGALRYRGVDIEDLVSQRVTFGDVWALLVDGNFGSGLPPAEPFPLPIHSGDV RVDVQAGLAMLAPIWGYAPLLDIDDATARQQLARASVMALSYVAQSARGIYQPAVPQRIIDEWSTVTARFMTRWQGEPDP RHIEAIDAYWVSAAEHGMNASTFTARVIASTGADVAAALSGAIGAMSGPLHGGAPARVLPMLDEVERAGDARSVVKGILD RGEKLMGFGHRVYRAEDPRARVLRAAAERLGAPRYEVAVAVEQAALSELRERRPDRAIETNVEFWAAVVLDFARVPANMM PAMFTCGRTAGWCAHILEQKRLGKLVRPSAIYVGPGPRSPESVDGWERVLTTAHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 THR n 1 3 VAL n 1 4 VAL n 1 5 PRO n 1 6 GLU n 1 7 ASN n 1 8 PHE n 1 9 VAL n 1 10 PRO n 1 11 GLY n 1 12 LEU n 1 13 ASP n 1 14 GLY n 1 15 VAL n 1 16 VAL n 1 17 ALA n 1 18 PHE n 1 19 THR n 1 20 THR n 1 21 GLU n 1 22 ILE n 1 23 ALA n 1 24 GLU n 1 25 PRO n 1 26 ASP n 1 27 LYS n 1 28 ASP n 1 29 GLY n 1 30 GLY n 1 31 ALA n 1 32 LEU n 1 33 ARG n 1 34 TYR n 1 35 ARG n 1 36 GLY n 1 37 VAL n 1 38 ASP n 1 39 ILE n 1 40 GLU n 1 41 ASP n 1 42 LEU n 1 43 VAL n 1 44 SER n 1 45 GLN n 1 46 ARG n 1 47 VAL n 1 48 THR n 1 49 PHE n 1 50 GLY n 1 51 ASP n 1 52 VAL n 1 53 TRP n 1 54 ALA n 1 55 LEU n 1 56 LEU n 1 57 VAL n 1 58 ASP n 1 59 GLY n 1 60 ASN n 1 61 PHE n 1 62 GLY n 1 63 SER n 1 64 GLY n 1 65 LEU n 1 66 PRO n 1 67 PRO n 1 68 ALA n 1 69 GLU n 1 70 PRO n 1 71 PHE n 1 72 PRO n 1 73 LEU n 1 74 PRO n 1 75 ILE n 1 76 HIS n 1 77 SER n 1 78 GLY n 1 79 ASP n 1 80 VAL n 1 81 ARG n 1 82 VAL n 1 83 ASP n 1 84 VAL n 1 85 GLN n 1 86 ALA n 1 87 GLY n 1 88 LEU n 1 89 ALA n 1 90 MET n 1 91 LEU n 1 92 ALA n 1 93 PRO n 1 94 ILE n 1 95 TRP n 1 96 GLY n 1 97 TYR n 1 98 ALA n 1 99 PRO n 1 100 LEU n 1 101 LEU n 1 102 ASP n 1 103 ILE n 1 104 ASP n 1 105 ASP n 1 106 ALA n 1 107 THR n 1 108 ALA n 1 109 ARG n 1 110 GLN n 1 111 GLN n 1 112 LEU n 1 113 ALA n 1 114 ARG n 1 115 ALA n 1 116 SER n 1 117 VAL n 1 118 MET n 1 119 ALA n 1 120 LEU n 1 121 SER n 1 122 TYR n 1 123 VAL n 1 124 ALA n 1 125 GLN n 1 126 SER n 1 127 ALA n 1 128 ARG n 1 129 GLY n 1 130 ILE n 1 131 TYR n 1 132 GLN n 1 133 PRO n 1 134 ALA n 1 135 VAL n 1 136 PRO n 1 137 GLN n 1 138 ARG n 1 139 ILE n 1 140 ILE n 1 141 ASP n 1 142 GLU n 1 143 TRP n 1 144 SER n 1 145 THR n 1 146 VAL n 1 147 THR n 1 148 ALA n 1 149 ARG n 1 150 PHE n 1 151 MET n 1 152 THR n 1 153 ARG n 1 154 TRP n 1 155 GLN n 1 156 GLY n 1 157 GLU n 1 158 PRO n 1 159 ASP n 1 160 PRO n 1 161 ARG n 1 162 HIS n 1 163 ILE n 1 164 GLU n 1 165 ALA n 1 166 ILE n 1 167 ASP n 1 168 ALA n 1 169 TYR n 1 170 TRP n 1 171 VAL n 1 172 SER n 1 173 ALA n 1 174 ALA n 1 175 GLU n 1 176 HIS n 1 177 GLY n 1 178 MET n 1 179 ASN n 1 180 ALA n 1 181 SER n 1 182 THR n 1 183 PHE n 1 184 THR n 1 185 ALA n 1 186 ARG n 1 187 VAL n 1 188 ILE n 1 189 ALA n 1 190 SER n 1 191 THR n 1 192 GLY n 1 193 ALA n 1 194 ASP n 1 195 VAL n 1 196 ALA n 1 197 ALA n 1 198 ALA n 1 199 LEU n 1 200 SER n 1 201 GLY n 1 202 ALA n 1 203 ILE n 1 204 GLY n 1 205 ALA n 1 206 MET n 1 207 SER n 1 208 GLY n 1 209 PRO n 1 210 LEU n 1 211 HIS n 1 212 GLY n 1 213 GLY n 1 214 ALA n 1 215 PRO n 1 216 ALA n 1 217 ARG n 1 218 VAL n 1 219 LEU n 1 220 PRO n 1 221 MET n 1 222 LEU n 1 223 ASP n 1 224 GLU n 1 225 VAL n 1 226 GLU n 1 227 ARG n 1 228 ALA n 1 229 GLY n 1 230 ASP n 1 231 ALA n 1 232 ARG n 1 233 SER n 1 234 VAL n 1 235 VAL n 1 236 LYS n 1 237 GLY n 1 238 ILE n 1 239 LEU n 1 240 ASP n 1 241 ARG n 1 242 GLY n 1 243 GLU n 1 244 LYS n 1 245 LEU n 1 246 MET n 1 247 GLY n 1 248 PHE n 1 249 GLY n 1 250 HIS n 1 251 ARG n 1 252 VAL n 1 253 TYR n 1 254 ARG n 1 255 ALA n 1 256 GLU n 1 257 ASP n 1 258 PRO n 1 259 ARG n 1 260 ALA n 1 261 ARG n 1 262 VAL n 1 263 LEU n 1 264 ARG n 1 265 ALA n 1 266 ALA n 1 267 ALA n 1 268 GLU n 1 269 ARG n 1 270 LEU n 1 271 GLY n 1 272 ALA n 1 273 PRO n 1 274 ARG n 1 275 TYR n 1 276 GLU n 1 277 VAL n 1 278 ALA n 1 279 VAL n 1 280 ALA n 1 281 VAL n 1 282 GLU n 1 283 GLN n 1 284 ALA n 1 285 ALA n 1 286 LEU n 1 287 SER n 1 288 GLU n 1 289 LEU n 1 290 ARG n 1 291 GLU n 1 292 ARG n 1 293 ARG n 1 294 PRO n 1 295 ASP n 1 296 ARG n 1 297 ALA n 1 298 ILE n 1 299 GLU n 1 300 THR n 1 301 ASN n 1 302 VAL n 1 303 GLU n 1 304 PHE n 1 305 TRP n 1 306 ALA n 1 307 ALA n 1 308 VAL n 1 309 VAL n 1 310 LEU n 1 311 ASP n 1 312 PHE n 1 313 ALA n 1 314 ARG n 1 315 VAL n 1 316 PRO n 1 317 ALA n 1 318 ASN n 1 319 MET n 1 320 MET n 1 321 PRO n 1 322 ALA n 1 323 MET n 1 324 PHE n 1 325 THR n 1 326 CYS n 1 327 GLY n 1 328 ARG n 1 329 THR n 1 330 ALA n 1 331 GLY n 1 332 TRP n 1 333 CYS n 1 334 ALA n 1 335 HIS n 1 336 ILE n 1 337 LEU n 1 338 GLU n 1 339 GLN n 1 340 LYS n 1 341 ARG n 1 342 LEU n 1 343 GLY n 1 344 LYS n 1 345 LEU n 1 346 VAL n 1 347 ARG n 1 348 PRO n 1 349 SER n 1 350 ALA n 1 351 ILE n 1 352 TYR n 1 353 VAL n 1 354 GLY n 1 355 PRO n 1 356 GLY n 1 357 PRO n 1 358 ARG n 1 359 SER n 1 360 PRO n 1 361 GLU n 1 362 SER n 1 363 VAL n 1 364 ASP n 1 365 GLY n 1 366 TRP n 1 367 GLU n 1 368 ARG n 1 369 VAL n 1 370 LEU n 1 371 THR n 1 372 THR n 1 373 ALA n 1 374 HIS n 1 375 HIS n 1 376 HIS n 1 377 HIS n 1 378 HIS n 1 379 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 379 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'citA, SAMEA2683035_02214' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Mycobacterium tuberculosis H37Rv' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 83332 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code A0A045JB88_MYCTX _struct_ref.pdbx_db_accession A0A045JB88 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MTVVPENFVPGLDGVVAFTTEIAEPDKDGGALRYRGVDIEDLVSQRVTFGDVWALLVDGNFGSGLPPAEPFPLPIHSGDV RVDVQAGLAMLAPIWGYAPLLDIDDATARQQLARASVMALSYVAQSARGIYQPAVPQRIIDECSTVTARFMTRWQGEPDP RHIEAIDAYWVSAAEHGMNASTFTARVIASTGADVAAALSGAIGAMSGPLHGGAPARVLPMLDEVERAGDARSVVKGILD RGEKLMGFGHRVYRAEDPRARVLRAAAERLGAPRYEVAVAVEQAALSELRERRPDRAIETNVEFWAAVVLDFARVPANMM PAMFTCGRTAGWCAHILEQKRLGKLVRPSAIYVGPGPRSPESVDGWERVLTTA ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 8S97 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 373 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession A0A045JB88 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 373 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 373 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 8S97 TRP A 143 ? UNP A0A045JB88 CYS 143 'engineered mutation' 143 1 1 8S97 HIS A 374 ? UNP A0A045JB88 ? ? 'expression tag' 374 2 1 8S97 HIS A 375 ? UNP A0A045JB88 ? ? 'expression tag' 375 3 1 8S97 HIS A 376 ? UNP A0A045JB88 ? ? 'expression tag' 376 4 1 8S97 HIS A 377 ? UNP A0A045JB88 ? ? 'expression tag' 377 5 1 8S97 HIS A 378 ? UNP A0A045JB88 ? ? 'expression tag' 378 6 1 8S97 HIS A 379 ? UNP A0A045JB88 ? ? 'expression tag' 379 7 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 EDO non-polymer . 1,2-ETHANEDIOL 'ETHYLENE GLYCOL' 'C2 H6 O2' 62.068 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 8S97 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 7.72 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 84 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.1 M Sodium Acetate pH 4.5, 3 M NaCl with the additive 5 % w/v D-sorbitol' _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 289 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'RAYONIX MX-300' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2020-08-07 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97856 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'APS BEAMLINE 21-ID-G' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.97856 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 21-ID-G _diffrn_source.pdbx_synchrotron_site APS # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 8S97 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.7 _reflns.d_resolution_low 50.5 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 35636 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.81 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 15.0 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 5.78 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.2317 _reflns.pdbx_Rpim_I_all 0.05985 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.993 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs 0.2238 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 2.7 _reflns_shell.d_res_low 2.797 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 3488 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all 1.836 _reflns_shell.pdbx_Rpim_I_all 0.4694 _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.639 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.percent_possible_all ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 1.774 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean ? _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 8S97 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.70 _refine.ls_d_res_low 50.5 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 35636 _refine.ls_number_reflns_R_free 3022 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.31 _refine.ls_percent_reflns_R_free 4.50 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2444 _refine.ls_R_factor_R_free 0.2716 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2431 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.35 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 33.48 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.59 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 2.70 _refine_hist.d_res_low 50.5 _refine_hist.number_atoms_solvent 19 _refine_hist.number_atoms_total 2831 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 2796 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 16 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.002 ? 2873 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.481 ? 3906 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 3.456 ? 412 ? f_dihedral_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.039 ? 429 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.004 ? 519 ? f_plane_restr ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free _refine_ls_shell.R_factor_R_free 'X-RAY DIFFRACTION' 2.70 2.74 . . 126 2570 88.00 . . . . 0.3968 . . . . . . . . . . . 0.3437 'X-RAY DIFFRACTION' 2.74 2.79 . . 140 2878 97.00 . . . . 0.3848 . . . . . . . . . . . 0.4462 'X-RAY DIFFRACTION' 2.79 2.84 . . 138 2892 100.00 . . . . 0.3780 . . . . . . . . . . . 0.3769 'X-RAY DIFFRACTION' 2.84 2.89 . . 139 2950 100.00 . . . . 0.3675 . . . . . . . . . . . 0.3740 'X-RAY DIFFRACTION' 2.89 2.94 . . 138 2926 100.00 . . . . 0.3496 . . . . . . . . . . . 0.3355 'X-RAY DIFFRACTION' 2.94 3.00 . . 138 2929 100.00 . . . . 0.3380 . . . . . . . . . . . 0.3533 'X-RAY DIFFRACTION' 3.00 3.07 . . 136 2928 100.00 . . . . 0.3385 . . . . . . . . . . . 0.3933 'X-RAY DIFFRACTION' 3.07 3.14 . . 136 2915 100.00 . . . . 0.3078 . . . . . . . . . . . 0.3678 'X-RAY DIFFRACTION' 3.14 3.22 . . 139 2936 100.00 . . . . 0.3123 . . . . . . . . . . . 0.3565 'X-RAY DIFFRACTION' 3.22 3.30 . . 141 2951 100.00 . . . . 0.2909 . . . . . . . . . . . 0.3210 'X-RAY DIFFRACTION' 3.30 3.40 . . 136 2917 100.00 . . . . 0.2579 . . . . . . . . . . . 0.2754 'X-RAY DIFFRACTION' 3.40 3.51 . . 139 2937 100.00 . . . . 0.2476 . . . . . . . . . . . 0.3130 'X-RAY DIFFRACTION' 3.51 3.64 . . 139 2939 100.00 . . . . 0.2383 . . . . . . . . . . . 0.2779 'X-RAY DIFFRACTION' 3.64 3.78 . . 140 2922 100.00 . . . . 0.2351 . . . . . . . . . . . 0.2930 'X-RAY DIFFRACTION' 3.78 3.95 . . 135 2937 100.00 . . . . 0.2237 . . . . . . . . . . . 0.2303 'X-RAY DIFFRACTION' 3.95 4.16 . . 131 2953 100.00 . . . . 0.2071 . . . . . . . . . . . 0.3070 'X-RAY DIFFRACTION' 4.16 4.42 . . 140 2917 100.00 . . . . 0.1988 . . . . . . . . . . . 0.1987 'X-RAY DIFFRACTION' 4.42 4.76 . . 139 2937 100.00 . . . . 0.1959 . . . . . . . . . . . 0.2379 'X-RAY DIFFRACTION' 4.77 5.24 . . 137 2931 100.00 . . . . 0.2119 . . . . . . . . . . . 0.2491 'X-RAY DIFFRACTION' 5.24 6.00 . . 138 2938 100.00 . . . . 0.2118 . . . . . . . . . . . 0.2190 'X-RAY DIFFRACTION' 6.00 7.56 . . 140 2932 100.00 . . . . 0.2263 . . . . . . . . . . . 0.2145 'X-RAY DIFFRACTION' 7.56 50.5 . . 137 2949 100.00 . . . . 0.2102 . . . . . . . . . . . 0.2387 # _struct.entry_id 8S97 _struct.title 'C143W variant of Citrate Synthase (CitA) in Mycobacterium tuberculosis' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 8S97 _struct_keywords.text 'Citrate Synthesis, TCA cycle, C143W variant, CYTOSOLIC PROTEIN' _struct_keywords.pdbx_keywords 'CYTOSOLIC PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 2 ? E N N 2 ? F N N 3 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ILE A 39 ? GLN A 45 ? ILE A 39 GLN A 45 1 ? 7 HELX_P HELX_P2 AA2 THR A 48 ? GLY A 59 ? THR A 48 GLY A 59 1 ? 12 HELX_P HELX_P3 AA3 ASP A 79 ? MET A 90 ? ASP A 79 MET A 90 1 ? 12 HELX_P HELX_P4 AA4 MET A 90 ? GLY A 96 ? MET A 90 GLY A 96 1 ? 7 HELX_P HELX_P5 AA5 ASP A 104 ? GLY A 129 ? ASP A 104 GLY A 129 1 ? 26 HELX_P HELX_P6 AA6 PRO A 136 ? ASP A 141 ? PRO A 136 ASP A 141 1 ? 6 HELX_P HELX_P7 AA7 THR A 145 ? GLY A 156 ? THR A 145 GLY A 156 1 ? 12 HELX_P HELX_P8 AA8 ASP A 159 ? ALA A 173 ? ASP A 159 ALA A 173 1 ? 15 HELX_P HELX_P9 AA9 ASN A 179 ? THR A 191 ? ASN A 179 THR A 191 1 ? 13 HELX_P HELX_P10 AB1 ASP A 194 ? SER A 207 ? ASP A 194 SER A 207 1 ? 14 HELX_P HELX_P11 AB2 ALA A 214 ? ARG A 217 ? ALA A 214 ARG A 217 5 ? 4 HELX_P HELX_P12 AB3 VAL A 218 ? VAL A 225 ? VAL A 218 VAL A 225 1 ? 8 HELX_P HELX_P13 AB4 ASP A 230 ? ARG A 241 ? ASP A 230 ARG A 241 1 ? 12 HELX_P HELX_P14 AB5 ASP A 257 ? GLY A 271 ? ASP A 257 GLY A 271 1 ? 15 HELX_P HELX_P15 AB6 ARG A 274 ? ARG A 293 ? ARG A 274 ARG A 293 1 ? 20 HELX_P HELX_P16 AB7 ASN A 301 ? ALA A 313 ? ASN A 301 ALA A 313 1 ? 13 HELX_P HELX_P17 AB8 MET A 319 ? GLY A 343 ? MET A 319 GLY A 343 1 ? 25 HELX_P HELX_P18 AB9 SER A 359 ? VAL A 363 ? SER A 359 VAL A 363 5 ? 5 HELX_P HELX_P19 AC1 GLY A 365 ? THR A 372 ? GLY A 365 THR A 372 1 ? 8 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 3 ? AA2 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA2 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ALA A 23 ? ASP A 26 ? ALA A 23 ASP A 26 AA1 2 ALA A 31 ? TYR A 34 ? ALA A 31 TYR A 34 AA1 3 VAL A 37 ? ASP A 38 ? VAL A 37 ASP A 38 AA2 1 PHE A 248 ? HIS A 250 ? PHE A 248 HIS A 250 AA2 2 ILE A 298 ? THR A 300 ? ILE A 298 THR A 300 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N ASP A 26 ? N ASP A 26 O ALA A 31 ? O ALA A 31 AA1 2 3 N TYR A 34 ? N TYR A 34 O VAL A 37 ? O VAL A 37 AA2 1 2 N GLY A 249 ? N GLY A 249 O GLU A 299 ? O GLU A 299 # _atom_sites.entry_id 8S97 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.006735 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.006735 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.004340 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 THR 2 2 ? ? ? A . n A 1 3 VAL 3 3 ? ? ? A . n A 1 4 VAL 4 4 ? ? ? A . n A 1 5 PRO 5 5 ? ? ? A . n A 1 6 GLU 6 6 6 GLU GLU A . n A 1 7 ASN 7 7 7 ASN ASN A . n A 1 8 PHE 8 8 8 PHE PHE A . n A 1 9 VAL 9 9 9 VAL VAL A . n A 1 10 PRO 10 10 10 PRO PRO A . n A 1 11 GLY 11 11 11 GLY GLY A . n A 1 12 LEU 12 12 12 LEU LEU A . n A 1 13 ASP 13 13 13 ASP ASP A . n A 1 14 GLY 14 14 14 GLY GLY A . n A 1 15 VAL 15 15 15 VAL VAL A . n A 1 16 VAL 16 16 16 VAL VAL A . n A 1 17 ALA 17 17 17 ALA ALA A . n A 1 18 PHE 18 18 18 PHE PHE A . n A 1 19 THR 19 19 19 THR THR A . n A 1 20 THR 20 20 20 THR THR A . n A 1 21 GLU 21 21 21 GLU GLU A . n A 1 22 ILE 22 22 22 ILE ILE A . n A 1 23 ALA 23 23 23 ALA ALA A . n A 1 24 GLU 24 24 24 GLU GLU A . n A 1 25 PRO 25 25 25 PRO PRO A . n A 1 26 ASP 26 26 26 ASP ASP A . n A 1 27 LYS 27 27 27 LYS LYS A . n A 1 28 ASP 28 28 28 ASP ASP A . n A 1 29 GLY 29 29 29 GLY GLY A . n A 1 30 GLY 30 30 30 GLY GLY A . n A 1 31 ALA 31 31 31 ALA ALA A . n A 1 32 LEU 32 32 32 LEU LEU A . n A 1 33 ARG 33 33 33 ARG ARG A . n A 1 34 TYR 34 34 34 TYR TYR A . n A 1 35 ARG 35 35 35 ARG ARG A . n A 1 36 GLY 36 36 36 GLY GLY A . n A 1 37 VAL 37 37 37 VAL VAL A . n A 1 38 ASP 38 38 38 ASP ASP A . n A 1 39 ILE 39 39 39 ILE ILE A . n A 1 40 GLU 40 40 40 GLU GLU A . n A 1 41 ASP 41 41 41 ASP ASP A . n A 1 42 LEU 42 42 42 LEU LEU A . n A 1 43 VAL 43 43 43 VAL VAL A . n A 1 44 SER 44 44 44 SER SER A . n A 1 45 GLN 45 45 45 GLN GLN A . n A 1 46 ARG 46 46 46 ARG ARG A . n A 1 47 VAL 47 47 47 VAL VAL A . n A 1 48 THR 48 48 48 THR THR A . n A 1 49 PHE 49 49 49 PHE PHE A . n A 1 50 GLY 50 50 50 GLY GLY A . n A 1 51 ASP 51 51 51 ASP ASP A . n A 1 52 VAL 52 52 52 VAL VAL A . n A 1 53 TRP 53 53 53 TRP TRP A . n A 1 54 ALA 54 54 54 ALA ALA A . n A 1 55 LEU 55 55 55 LEU LEU A . n A 1 56 LEU 56 56 56 LEU LEU A . n A 1 57 VAL 57 57 57 VAL VAL A . n A 1 58 ASP 58 58 58 ASP ASP A . n A 1 59 GLY 59 59 59 GLY GLY A . n A 1 60 ASN 60 60 60 ASN ASN A . n A 1 61 PHE 61 61 61 PHE PHE A . n A 1 62 GLY 62 62 62 GLY GLY A . n A 1 63 SER 63 63 63 SER SER A . n A 1 64 GLY 64 64 64 GLY GLY A . n A 1 65 LEU 65 65 65 LEU LEU A . n A 1 66 PRO 66 66 66 PRO PRO A . n A 1 67 PRO 67 67 67 PRO PRO A . n A 1 68 ALA 68 68 68 ALA ALA A . n A 1 69 GLU 69 69 69 GLU GLU A . n A 1 70 PRO 70 70 70 PRO PRO A . n A 1 71 PHE 71 71 71 PHE PHE A . n A 1 72 PRO 72 72 72 PRO PRO A . n A 1 73 LEU 73 73 73 LEU LEU A . n A 1 74 PRO 74 74 74 PRO PRO A . n A 1 75 ILE 75 75 75 ILE ILE A . n A 1 76 HIS 76 76 76 HIS HIS A . n A 1 77 SER 77 77 77 SER SER A . n A 1 78 GLY 78 78 78 GLY GLY A . n A 1 79 ASP 79 79 79 ASP ASP A . n A 1 80 VAL 80 80 80 VAL VAL A . n A 1 81 ARG 81 81 81 ARG ARG A . n A 1 82 VAL 82 82 82 VAL VAL A . n A 1 83 ASP 83 83 83 ASP ASP A . n A 1 84 VAL 84 84 84 VAL VAL A . n A 1 85 GLN 85 85 85 GLN GLN A . n A 1 86 ALA 86 86 86 ALA ALA A . n A 1 87 GLY 87 87 87 GLY GLY A . n A 1 88 LEU 88 88 88 LEU LEU A . n A 1 89 ALA 89 89 89 ALA ALA A . n A 1 90 MET 90 90 90 MET MET A . n A 1 91 LEU 91 91 91 LEU LEU A . n A 1 92 ALA 92 92 92 ALA ALA A . n A 1 93 PRO 93 93 93 PRO PRO A . n A 1 94 ILE 94 94 94 ILE ILE A . n A 1 95 TRP 95 95 95 TRP TRP A . n A 1 96 GLY 96 96 96 GLY GLY A . n A 1 97 TYR 97 97 97 TYR TYR A . n A 1 98 ALA 98 98 98 ALA ALA A . n A 1 99 PRO 99 99 99 PRO PRO A . n A 1 100 LEU 100 100 100 LEU LEU A . n A 1 101 LEU 101 101 101 LEU LEU A . n A 1 102 ASP 102 102 102 ASP ASP A . n A 1 103 ILE 103 103 103 ILE ILE A . n A 1 104 ASP 104 104 104 ASP ASP A . n A 1 105 ASP 105 105 105 ASP ASP A . n A 1 106 ALA 106 106 106 ALA ALA A . n A 1 107 THR 107 107 107 THR THR A . n A 1 108 ALA 108 108 108 ALA ALA A . n A 1 109 ARG 109 109 109 ARG ARG A . n A 1 110 GLN 110 110 110 GLN GLN A . n A 1 111 GLN 111 111 111 GLN GLN A . n A 1 112 LEU 112 112 112 LEU LEU A . n A 1 113 ALA 113 113 113 ALA ALA A . n A 1 114 ARG 114 114 114 ARG ARG A . n A 1 115 ALA 115 115 115 ALA ALA A . n A 1 116 SER 116 116 116 SER SER A . n A 1 117 VAL 117 117 117 VAL VAL A . n A 1 118 MET 118 118 118 MET MET A . n A 1 119 ALA 119 119 119 ALA ALA A . n A 1 120 LEU 120 120 120 LEU LEU A . n A 1 121 SER 121 121 121 SER SER A . n A 1 122 TYR 122 122 122 TYR TYR A . n A 1 123 VAL 123 123 123 VAL VAL A . n A 1 124 ALA 124 124 124 ALA ALA A . n A 1 125 GLN 125 125 125 GLN GLN A . n A 1 126 SER 126 126 126 SER SER A . n A 1 127 ALA 127 127 127 ALA ALA A . n A 1 128 ARG 128 128 128 ARG ARG A . n A 1 129 GLY 129 129 129 GLY GLY A . n A 1 130 ILE 130 130 130 ILE ILE A . n A 1 131 TYR 131 131 131 TYR TYR A . n A 1 132 GLN 132 132 132 GLN GLN A . n A 1 133 PRO 133 133 133 PRO PRO A . n A 1 134 ALA 134 134 134 ALA ALA A . n A 1 135 VAL 135 135 135 VAL VAL A . n A 1 136 PRO 136 136 136 PRO PRO A . n A 1 137 GLN 137 137 137 GLN GLN A . n A 1 138 ARG 138 138 138 ARG ARG A . n A 1 139 ILE 139 139 139 ILE ILE A . n A 1 140 ILE 140 140 140 ILE ILE A . n A 1 141 ASP 141 141 141 ASP ASP A . n A 1 142 GLU 142 142 142 GLU GLU A . n A 1 143 TRP 143 143 143 TRP TRP A . n A 1 144 SER 144 144 144 SER SER A . n A 1 145 THR 145 145 145 THR THR A . n A 1 146 VAL 146 146 146 VAL VAL A . n A 1 147 THR 147 147 147 THR THR A . n A 1 148 ALA 148 148 148 ALA ALA A . n A 1 149 ARG 149 149 149 ARG ARG A . n A 1 150 PHE 150 150 150 PHE PHE A . n A 1 151 MET 151 151 151 MET MET A . n A 1 152 THR 152 152 152 THR THR A . n A 1 153 ARG 153 153 153 ARG ARG A . n A 1 154 TRP 154 154 154 TRP TRP A . n A 1 155 GLN 155 155 155 GLN GLN A . n A 1 156 GLY 156 156 156 GLY GLY A . n A 1 157 GLU 157 157 157 GLU GLU A . n A 1 158 PRO 158 158 158 PRO PRO A . n A 1 159 ASP 159 159 159 ASP ASP A . n A 1 160 PRO 160 160 160 PRO PRO A . n A 1 161 ARG 161 161 161 ARG ARG A . n A 1 162 HIS 162 162 162 HIS HIS A . n A 1 163 ILE 163 163 163 ILE ILE A . n A 1 164 GLU 164 164 164 GLU GLU A . n A 1 165 ALA 165 165 165 ALA ALA A . n A 1 166 ILE 166 166 166 ILE ILE A . n A 1 167 ASP 167 167 167 ASP ASP A . n A 1 168 ALA 168 168 168 ALA ALA A . n A 1 169 TYR 169 169 169 TYR TYR A . n A 1 170 TRP 170 170 170 TRP TRP A . n A 1 171 VAL 171 171 171 VAL VAL A . n A 1 172 SER 172 172 172 SER SER A . n A 1 173 ALA 173 173 173 ALA ALA A . n A 1 174 ALA 174 174 174 ALA ALA A . n A 1 175 GLU 175 175 175 GLU GLU A . n A 1 176 HIS 176 176 176 HIS HIS A . n A 1 177 GLY 177 177 177 GLY GLY A . n A 1 178 MET 178 178 178 MET MET A . n A 1 179 ASN 179 179 179 ASN ASN A . n A 1 180 ALA 180 180 180 ALA ALA A . n A 1 181 SER 181 181 181 SER SER A . n A 1 182 THR 182 182 182 THR THR A . n A 1 183 PHE 183 183 183 PHE PHE A . n A 1 184 THR 184 184 184 THR THR A . n A 1 185 ALA 185 185 185 ALA ALA A . n A 1 186 ARG 186 186 186 ARG ARG A . n A 1 187 VAL 187 187 187 VAL VAL A . n A 1 188 ILE 188 188 188 ILE ILE A . n A 1 189 ALA 189 189 189 ALA ALA A . n A 1 190 SER 190 190 190 SER SER A . n A 1 191 THR 191 191 191 THR THR A . n A 1 192 GLY 192 192 192 GLY GLY A . n A 1 193 ALA 193 193 193 ALA ALA A . n A 1 194 ASP 194 194 194 ASP ASP A . n A 1 195 VAL 195 195 195 VAL VAL A . n A 1 196 ALA 196 196 196 ALA ALA A . n A 1 197 ALA 197 197 197 ALA ALA A . n A 1 198 ALA 198 198 198 ALA ALA A . n A 1 199 LEU 199 199 199 LEU LEU A . n A 1 200 SER 200 200 200 SER SER A . n A 1 201 GLY 201 201 201 GLY GLY A . n A 1 202 ALA 202 202 202 ALA ALA A . n A 1 203 ILE 203 203 203 ILE ILE A . n A 1 204 GLY 204 204 204 GLY GLY A . n A 1 205 ALA 205 205 205 ALA ALA A . n A 1 206 MET 206 206 206 MET MET A . n A 1 207 SER 207 207 207 SER SER A . n A 1 208 GLY 208 208 208 GLY GLY A . n A 1 209 PRO 209 209 209 PRO PRO A . n A 1 210 LEU 210 210 210 LEU LEU A . n A 1 211 HIS 211 211 211 HIS HIS A . n A 1 212 GLY 212 212 212 GLY GLY A . n A 1 213 GLY 213 213 213 GLY GLY A . n A 1 214 ALA 214 214 214 ALA ALA A . n A 1 215 PRO 215 215 215 PRO PRO A . n A 1 216 ALA 216 216 216 ALA ALA A . n A 1 217 ARG 217 217 217 ARG ARG A . n A 1 218 VAL 218 218 218 VAL VAL A . n A 1 219 LEU 219 219 219 LEU LEU A . n A 1 220 PRO 220 220 220 PRO PRO A . n A 1 221 MET 221 221 221 MET MET A . n A 1 222 LEU 222 222 222 LEU LEU A . n A 1 223 ASP 223 223 223 ASP ASP A . n A 1 224 GLU 224 224 224 GLU GLU A . n A 1 225 VAL 225 225 225 VAL VAL A . n A 1 226 GLU 226 226 226 GLU GLU A . n A 1 227 ARG 227 227 227 ARG ARG A . n A 1 228 ALA 228 228 228 ALA ALA A . n A 1 229 GLY 229 229 229 GLY GLY A . n A 1 230 ASP 230 230 230 ASP ASP A . n A 1 231 ALA 231 231 231 ALA ALA A . n A 1 232 ARG 232 232 232 ARG ARG A . n A 1 233 SER 233 233 233 SER SER A . n A 1 234 VAL 234 234 234 VAL VAL A . n A 1 235 VAL 235 235 235 VAL VAL A . n A 1 236 LYS 236 236 236 LYS LYS A . n A 1 237 GLY 237 237 237 GLY GLY A . n A 1 238 ILE 238 238 238 ILE ILE A . n A 1 239 LEU 239 239 239 LEU LEU A . n A 1 240 ASP 240 240 240 ASP ASP A . n A 1 241 ARG 241 241 241 ARG ARG A . n A 1 242 GLY 242 242 242 GLY GLY A . n A 1 243 GLU 243 243 243 GLU GLU A . n A 1 244 LYS 244 244 244 LYS LYS A . n A 1 245 LEU 245 245 245 LEU LEU A . n A 1 246 MET 246 246 246 MET MET A . n A 1 247 GLY 247 247 247 GLY GLY A . n A 1 248 PHE 248 248 248 PHE PHE A . n A 1 249 GLY 249 249 249 GLY GLY A . n A 1 250 HIS 250 250 250 HIS HIS A . n A 1 251 ARG 251 251 251 ARG ARG A . n A 1 252 VAL 252 252 252 VAL VAL A . n A 1 253 TYR 253 253 253 TYR TYR A . n A 1 254 ARG 254 254 254 ARG ARG A . n A 1 255 ALA 255 255 255 ALA ALA A . n A 1 256 GLU 256 256 256 GLU GLU A . n A 1 257 ASP 257 257 257 ASP ASP A . n A 1 258 PRO 258 258 258 PRO PRO A . n A 1 259 ARG 259 259 259 ARG ARG A . n A 1 260 ALA 260 260 260 ALA ALA A . n A 1 261 ARG 261 261 261 ARG ARG A . n A 1 262 VAL 262 262 262 VAL VAL A . n A 1 263 LEU 263 263 263 LEU LEU A . n A 1 264 ARG 264 264 264 ARG ARG A . n A 1 265 ALA 265 265 265 ALA ALA A . n A 1 266 ALA 266 266 266 ALA ALA A . n A 1 267 ALA 267 267 267 ALA ALA A . n A 1 268 GLU 268 268 268 GLU GLU A . n A 1 269 ARG 269 269 269 ARG ARG A . n A 1 270 LEU 270 270 270 LEU LEU A . n A 1 271 GLY 271 271 271 GLY GLY A . n A 1 272 ALA 272 272 272 ALA ALA A . n A 1 273 PRO 273 273 273 PRO PRO A . n A 1 274 ARG 274 274 274 ARG ARG A . n A 1 275 TYR 275 275 275 TYR TYR A . n A 1 276 GLU 276 276 276 GLU GLU A . n A 1 277 VAL 277 277 277 VAL VAL A . n A 1 278 ALA 278 278 278 ALA ALA A . n A 1 279 VAL 279 279 279 VAL VAL A . n A 1 280 ALA 280 280 280 ALA ALA A . n A 1 281 VAL 281 281 281 VAL VAL A . n A 1 282 GLU 282 282 282 GLU GLU A . n A 1 283 GLN 283 283 283 GLN GLN A . n A 1 284 ALA 284 284 284 ALA ALA A . n A 1 285 ALA 285 285 285 ALA ALA A . n A 1 286 LEU 286 286 286 LEU LEU A . n A 1 287 SER 287 287 287 SER SER A . n A 1 288 GLU 288 288 288 GLU GLU A . n A 1 289 LEU 289 289 289 LEU LEU A . n A 1 290 ARG 290 290 290 ARG ARG A . n A 1 291 GLU 291 291 291 GLU GLU A . n A 1 292 ARG 292 292 292 ARG ARG A . n A 1 293 ARG 293 293 293 ARG ARG A . n A 1 294 PRO 294 294 294 PRO PRO A . n A 1 295 ASP 295 295 295 ASP ASP A . n A 1 296 ARG 296 296 296 ARG ARG A . n A 1 297 ALA 297 297 297 ALA ALA A . n A 1 298 ILE 298 298 298 ILE ILE A . n A 1 299 GLU 299 299 299 GLU GLU A . n A 1 300 THR 300 300 300 THR THR A . n A 1 301 ASN 301 301 301 ASN ASN A . n A 1 302 VAL 302 302 302 VAL VAL A . n A 1 303 GLU 303 303 303 GLU GLU A . n A 1 304 PHE 304 304 304 PHE PHE A . n A 1 305 TRP 305 305 305 TRP TRP A . n A 1 306 ALA 306 306 306 ALA ALA A . n A 1 307 ALA 307 307 307 ALA ALA A . n A 1 308 VAL 308 308 308 VAL VAL A . n A 1 309 VAL 309 309 309 VAL VAL A . n A 1 310 LEU 310 310 310 LEU LEU A . n A 1 311 ASP 311 311 311 ASP ASP A . n A 1 312 PHE 312 312 312 PHE PHE A . n A 1 313 ALA 313 313 313 ALA ALA A . n A 1 314 ARG 314 314 314 ARG ARG A . n A 1 315 VAL 315 315 315 VAL VAL A . n A 1 316 PRO 316 316 316 PRO PRO A . n A 1 317 ALA 317 317 317 ALA ALA A . n A 1 318 ASN 318 318 318 ASN ASN A . n A 1 319 MET 319 319 319 MET MET A . n A 1 320 MET 320 320 320 MET MET A . n A 1 321 PRO 321 321 321 PRO PRO A . n A 1 322 ALA 322 322 322 ALA ALA A . n A 1 323 MET 323 323 323 MET MET A . n A 1 324 PHE 324 324 324 PHE PHE A . n A 1 325 THR 325 325 325 THR THR A . n A 1 326 CYS 326 326 326 CYS CYS A . n A 1 327 GLY 327 327 327 GLY GLY A . n A 1 328 ARG 328 328 328 ARG ARG A . n A 1 329 THR 329 329 329 THR THR A . n A 1 330 ALA 330 330 330 ALA ALA A . n A 1 331 GLY 331 331 331 GLY GLY A . n A 1 332 TRP 332 332 332 TRP TRP A . n A 1 333 CYS 333 333 333 CYS CYS A . n A 1 334 ALA 334 334 334 ALA ALA A . n A 1 335 HIS 335 335 335 HIS HIS A . n A 1 336 ILE 336 336 336 ILE ILE A . n A 1 337 LEU 337 337 337 LEU LEU A . n A 1 338 GLU 338 338 338 GLU GLU A . n A 1 339 GLN 339 339 339 GLN GLN A . n A 1 340 LYS 340 340 340 LYS LYS A . n A 1 341 ARG 341 341 341 ARG ARG A . n A 1 342 LEU 342 342 342 LEU LEU A . n A 1 343 GLY 343 343 343 GLY GLY A . n A 1 344 LYS 344 344 344 LYS LYS A . n A 1 345 LEU 345 345 345 LEU LEU A . n A 1 346 VAL 346 346 346 VAL VAL A . n A 1 347 ARG 347 347 347 ARG ARG A . n A 1 348 PRO 348 348 348 PRO PRO A . n A 1 349 SER 349 349 349 SER SER A . n A 1 350 ALA 350 350 350 ALA ALA A . n A 1 351 ILE 351 351 351 ILE ILE A . n A 1 352 TYR 352 352 352 TYR TYR A . n A 1 353 VAL 353 353 353 VAL VAL A . n A 1 354 GLY 354 354 354 GLY GLY A . n A 1 355 PRO 355 355 355 PRO PRO A . n A 1 356 GLY 356 356 356 GLY GLY A . n A 1 357 PRO 357 357 357 PRO PRO A . n A 1 358 ARG 358 358 358 ARG ARG A . n A 1 359 SER 359 359 359 SER SER A . n A 1 360 PRO 360 360 360 PRO PRO A . n A 1 361 GLU 361 361 361 GLU GLU A . n A 1 362 SER 362 362 362 SER SER A . n A 1 363 VAL 363 363 363 VAL VAL A . n A 1 364 ASP 364 364 364 ASP ASP A . n A 1 365 GLY 365 365 365 GLY GLY A . n A 1 366 TRP 366 366 366 TRP TRP A . n A 1 367 GLU 367 367 367 GLU GLU A . n A 1 368 ARG 368 368 368 ARG ARG A . n A 1 369 VAL 369 369 369 VAL VAL A . n A 1 370 LEU 370 370 370 LEU LEU A . n A 1 371 THR 371 371 371 THR THR A . n A 1 372 THR 372 372 372 THR THR A . n A 1 373 ALA 373 373 373 ALA ALA A . n A 1 374 HIS 374 374 ? ? ? A . n A 1 375 HIS 375 375 ? ? ? A . n A 1 376 HIS 376 376 ? ? ? A . n A 1 377 HIS 377 377 ? ? ? A . n A 1 378 HIS 378 378 ? ? ? A . n A 1 379 HIS 379 379 ? ? ? A . n # _pdbx_contact_author.id 2 _pdbx_contact_author.email don.ronning@unmc.edu _pdbx_contact_author.name_first Donald _pdbx_contact_author.name_last Ronning _pdbx_contact_author.name_mi R. _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0003-2583-8849 # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 EDO 1 401 401 EDO EDO A . C 2 EDO 1 402 402 EDO EDO A . D 2 EDO 1 403 403 EDO EDO A . E 2 EDO 1 404 404 EDO EDO A . F 3 HOH 1 501 18 HOH HOH A . F 3 HOH 2 502 16 HOH HOH A . F 3 HOH 3 503 10 HOH HOH A . F 3 HOH 4 504 15 HOH HOH A . F 3 HOH 5 505 2 HOH HOH A . F 3 HOH 6 506 17 HOH HOH A . F 3 HOH 7 507 8 HOH HOH A . F 3 HOH 8 508 12 HOH HOH A . F 3 HOH 9 509 24 HOH HOH A . F 3 HOH 10 510 21 HOH HOH A . F 3 HOH 11 511 7 HOH HOH A . F 3 HOH 12 512 4 HOH HOH A . F 3 HOH 13 513 6 HOH HOH A . F 3 HOH 14 514 11 HOH HOH A . F 3 HOH 15 515 27 HOH HOH A . F 3 HOH 16 516 25 HOH HOH A . F 3 HOH 17 517 23 HOH HOH A . F 3 HOH 18 518 9 HOH HOH A . F 3 HOH 19 519 26 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 9440 ? 1 MORE -35 ? 1 'SSA (A^2)' 28870 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 16_554 -y+1/2,-x+1/2,-z-1/2 0.0000000000 -1.0000000000 0.0000000000 74.2360000000 -1.0000000000 0.0000000000 0.0000000000 74.2360000000 0.0000000000 0.0000000000 -1.0000000000 -115.2010000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2023-06-07 2 'Structure model' 1 1 2023-11-08 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Source and taxonomy' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' chem_comp_atom 2 2 'Structure model' chem_comp_bond 3 2 'Structure model' entity_src_gen # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id' 2 2 'Structure model' '_entity_src_gen.pdbx_gene_src_scientific_name' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.19.2_4158:000 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? DIALS ? ? ? . 2 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? DIALS ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? . 4 # _pdbx_entry_details.entry_id 8S97 _pdbx_entry_details.has_ligand_of_interest N _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PHE A 61 ? ? -90.56 42.76 2 1 PHE A 71 ? ? -165.52 87.77 3 1 HIS A 176 ? ? -151.23 50.02 4 1 MET A 178 ? ? -99.91 59.08 5 1 ALA A 255 ? ? -96.57 -116.41 6 1 ALA A 285 ? ? -60.84 -75.55 7 1 THR A 372 ? ? -105.23 50.74 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A THR 2 ? A THR 2 3 1 Y 1 A VAL 3 ? A VAL 3 4 1 Y 1 A VAL 4 ? A VAL 4 5 1 Y 1 A PRO 5 ? A PRO 5 6 1 Y 1 A HIS 374 ? A HIS 374 7 1 Y 1 A HIS 375 ? A HIS 375 8 1 Y 1 A HIS 376 ? A HIS 376 9 1 Y 1 A HIS 377 ? A HIS 377 10 1 Y 1 A HIS 378 ? A HIS 378 11 1 Y 1 A HIS 379 ? A HIS 379 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 EDO C1 C N N 88 EDO O1 O N N 89 EDO C2 C N N 90 EDO O2 O N N 91 EDO H11 H N N 92 EDO H12 H N N 93 EDO HO1 H N N 94 EDO H21 H N N 95 EDO H22 H N N 96 EDO HO2 H N N 97 GLN N N N N 98 GLN CA C N S 99 GLN C C N N 100 GLN O O N N 101 GLN CB C N N 102 GLN CG C N N 103 GLN CD C N N 104 GLN OE1 O N N 105 GLN NE2 N N N 106 GLN OXT O N N 107 GLN H H N N 108 GLN H2 H N N 109 GLN HA H N N 110 GLN HB2 H N N 111 GLN HB3 H N N 112 GLN HG2 H N N 113 GLN HG3 H N N 114 GLN HE21 H N N 115 GLN HE22 H N N 116 GLN HXT H N N 117 GLU N N N N 118 GLU CA C N S 119 GLU C C N N 120 GLU O O N N 121 GLU CB C N N 122 GLU CG C N N 123 GLU CD C N N 124 GLU OE1 O N N 125 GLU OE2 O N N 126 GLU OXT O N N 127 GLU H H N N 128 GLU H2 H N N 129 GLU HA H N N 130 GLU HB2 H N N 131 GLU HB3 H N N 132 GLU HG2 H N N 133 GLU HG3 H N N 134 GLU HE2 H N N 135 GLU HXT H N N 136 GLY N N N N 137 GLY CA C N N 138 GLY C C N N 139 GLY O O N N 140 GLY OXT O N N 141 GLY H H N N 142 GLY H2 H N N 143 GLY HA2 H N N 144 GLY HA3 H N N 145 GLY HXT H N N 146 HIS N N N N 147 HIS CA C N S 148 HIS C C N N 149 HIS O O N N 150 HIS CB C N N 151 HIS CG C Y N 152 HIS ND1 N Y N 153 HIS CD2 C Y N 154 HIS CE1 C Y N 155 HIS NE2 N Y N 156 HIS OXT O N N 157 HIS H H N N 158 HIS H2 H N N 159 HIS HA H N N 160 HIS HB2 H N N 161 HIS HB3 H N N 162 HIS HD1 H N N 163 HIS HD2 H N N 164 HIS HE1 H N N 165 HIS HE2 H N N 166 HIS HXT H N N 167 HOH O O N N 168 HOH H1 H N N 169 HOH H2 H N N 170 ILE N N N N 171 ILE CA C N S 172 ILE C C N N 173 ILE O O N N 174 ILE CB C N S 175 ILE CG1 C N N 176 ILE CG2 C N N 177 ILE CD1 C N N 178 ILE OXT O N N 179 ILE H H N N 180 ILE H2 H N N 181 ILE HA H N N 182 ILE HB H N N 183 ILE HG12 H N N 184 ILE HG13 H N N 185 ILE HG21 H N N 186 ILE HG22 H N N 187 ILE HG23 H N N 188 ILE HD11 H N N 189 ILE HD12 H N N 190 ILE HD13 H N N 191 ILE HXT H N N 192 LEU N N N N 193 LEU CA C N S 194 LEU C C N N 195 LEU O O N N 196 LEU CB C N N 197 LEU CG C N N 198 LEU CD1 C N N 199 LEU CD2 C N N 200 LEU OXT O N N 201 LEU H H N N 202 LEU H2 H N N 203 LEU HA H N N 204 LEU HB2 H N N 205 LEU HB3 H N N 206 LEU HG H N N 207 LEU HD11 H N N 208 LEU HD12 H N N 209 LEU HD13 H N N 210 LEU HD21 H N N 211 LEU HD22 H N N 212 LEU HD23 H N N 213 LEU HXT H N N 214 LYS N N N N 215 LYS CA C N S 216 LYS C C N N 217 LYS O O N N 218 LYS CB C N N 219 LYS CG C N N 220 LYS CD C N N 221 LYS CE C N N 222 LYS NZ N N N 223 LYS OXT O N N 224 LYS H H N N 225 LYS H2 H N N 226 LYS HA H N N 227 LYS HB2 H N N 228 LYS HB3 H N N 229 LYS HG2 H N N 230 LYS HG3 H N N 231 LYS HD2 H N N 232 LYS HD3 H N N 233 LYS HE2 H N N 234 LYS HE3 H N N 235 LYS HZ1 H N N 236 LYS HZ2 H N N 237 LYS HZ3 H N N 238 LYS HXT H N N 239 MET N N N N 240 MET CA C N S 241 MET C C N N 242 MET O O N N 243 MET CB C N N 244 MET CG C N N 245 MET SD S N N 246 MET CE C N N 247 MET OXT O N N 248 MET H H N N 249 MET H2 H N N 250 MET HA H N N 251 MET HB2 H N N 252 MET HB3 H N N 253 MET HG2 H N N 254 MET HG3 H N N 255 MET HE1 H N N 256 MET HE2 H N N 257 MET HE3 H N N 258 MET HXT H N N 259 PHE N N N N 260 PHE CA C N S 261 PHE C C N N 262 PHE O O N N 263 PHE CB C N N 264 PHE CG C Y N 265 PHE CD1 C Y N 266 PHE CD2 C Y N 267 PHE CE1 C Y N 268 PHE CE2 C Y N 269 PHE CZ C Y N 270 PHE OXT O N N 271 PHE H H N N 272 PHE H2 H N N 273 PHE HA H N N 274 PHE HB2 H N N 275 PHE HB3 H N N 276 PHE HD1 H N N 277 PHE HD2 H N N 278 PHE HE1 H N N 279 PHE HE2 H N N 280 PHE HZ H N N 281 PHE HXT H N N 282 PRO N N N N 283 PRO CA C N S 284 PRO C C N N 285 PRO O O N N 286 PRO CB C N N 287 PRO CG C N N 288 PRO CD C N N 289 PRO OXT O N N 290 PRO H H N N 291 PRO HA H N N 292 PRO HB2 H N N 293 PRO HB3 H N N 294 PRO HG2 H N N 295 PRO HG3 H N N 296 PRO HD2 H N N 297 PRO HD3 H N N 298 PRO HXT H N N 299 SER N N N N 300 SER CA C N S 301 SER C C N N 302 SER O O N N 303 SER CB C N N 304 SER OG O N N 305 SER OXT O N N 306 SER H H N N 307 SER H2 H N N 308 SER HA H N N 309 SER HB2 H N N 310 SER HB3 H N N 311 SER HG H N N 312 SER HXT H N N 313 THR N N N N 314 THR CA C N S 315 THR C C N N 316 THR O O N N 317 THR CB C N R 318 THR OG1 O N N 319 THR CG2 C N N 320 THR OXT O N N 321 THR H H N N 322 THR H2 H N N 323 THR HA H N N 324 THR HB H N N 325 THR HG1 H N N 326 THR HG21 H N N 327 THR HG22 H N N 328 THR HG23 H N N 329 THR HXT H N N 330 TRP N N N N 331 TRP CA C N S 332 TRP C C N N 333 TRP O O N N 334 TRP CB C N N 335 TRP CG C Y N 336 TRP CD1 C Y N 337 TRP CD2 C Y N 338 TRP NE1 N Y N 339 TRP CE2 C Y N 340 TRP CE3 C Y N 341 TRP CZ2 C Y N 342 TRP CZ3 C Y N 343 TRP CH2 C Y N 344 TRP OXT O N N 345 TRP H H N N 346 TRP H2 H N N 347 TRP HA H N N 348 TRP HB2 H N N 349 TRP HB3 H N N 350 TRP HD1 H N N 351 TRP HE1 H N N 352 TRP HE3 H N N 353 TRP HZ2 H N N 354 TRP HZ3 H N N 355 TRP HH2 H N N 356 TRP HXT H N N 357 TYR N N N N 358 TYR CA C N S 359 TYR C C N N 360 TYR O O N N 361 TYR CB C N N 362 TYR CG C Y N 363 TYR CD1 C Y N 364 TYR CD2 C Y N 365 TYR CE1 C Y N 366 TYR CE2 C Y N 367 TYR CZ C Y N 368 TYR OH O N N 369 TYR OXT O N N 370 TYR H H N N 371 TYR H2 H N N 372 TYR HA H N N 373 TYR HB2 H N N 374 TYR HB3 H N N 375 TYR HD1 H N N 376 TYR HD2 H N N 377 TYR HE1 H N N 378 TYR HE2 H N N 379 TYR HH H N N 380 TYR HXT H N N 381 VAL N N N N 382 VAL CA C N S 383 VAL C C N N 384 VAL O O N N 385 VAL CB C N N 386 VAL CG1 C N N 387 VAL CG2 C N N 388 VAL OXT O N N 389 VAL H H N N 390 VAL H2 H N N 391 VAL HA H N N 392 VAL HB H N N 393 VAL HG11 H N N 394 VAL HG12 H N N 395 VAL HG13 H N N 396 VAL HG21 H N N 397 VAL HG22 H N N 398 VAL HG23 H N N 399 VAL HXT H N N 400 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 EDO C1 O1 sing N N 83 EDO C1 C2 sing N N 84 EDO C1 H11 sing N N 85 EDO C1 H12 sing N N 86 EDO O1 HO1 sing N N 87 EDO C2 O2 sing N N 88 EDO C2 H21 sing N N 89 EDO C2 H22 sing N N 90 EDO O2 HO2 sing N N 91 GLN N CA sing N N 92 GLN N H sing N N 93 GLN N H2 sing N N 94 GLN CA C sing N N 95 GLN CA CB sing N N 96 GLN CA HA sing N N 97 GLN C O doub N N 98 GLN C OXT sing N N 99 GLN CB CG sing N N 100 GLN CB HB2 sing N N 101 GLN CB HB3 sing N N 102 GLN CG CD sing N N 103 GLN CG HG2 sing N N 104 GLN CG HG3 sing N N 105 GLN CD OE1 doub N N 106 GLN CD NE2 sing N N 107 GLN NE2 HE21 sing N N 108 GLN NE2 HE22 sing N N 109 GLN OXT HXT sing N N 110 GLU N CA sing N N 111 GLU N H sing N N 112 GLU N H2 sing N N 113 GLU CA C sing N N 114 GLU CA CB sing N N 115 GLU CA HA sing N N 116 GLU C O doub N N 117 GLU C OXT sing N N 118 GLU CB CG sing N N 119 GLU CB HB2 sing N N 120 GLU CB HB3 sing N N 121 GLU CG CD sing N N 122 GLU CG HG2 sing N N 123 GLU CG HG3 sing N N 124 GLU CD OE1 doub N N 125 GLU CD OE2 sing N N 126 GLU OE2 HE2 sing N N 127 GLU OXT HXT sing N N 128 GLY N CA sing N N 129 GLY N H sing N N 130 GLY N H2 sing N N 131 GLY CA C sing N N 132 GLY CA HA2 sing N N 133 GLY CA HA3 sing N N 134 GLY C O doub N N 135 GLY C OXT sing N N 136 GLY OXT HXT sing N N 137 HIS N CA sing N N 138 HIS N H sing N N 139 HIS N H2 sing N N 140 HIS CA C sing N N 141 HIS CA CB sing N N 142 HIS CA HA sing N N 143 HIS C O doub N N 144 HIS C OXT sing N N 145 HIS CB CG sing N N 146 HIS CB HB2 sing N N 147 HIS CB HB3 sing N N 148 HIS CG ND1 sing Y N 149 HIS CG CD2 doub Y N 150 HIS ND1 CE1 doub Y N 151 HIS ND1 HD1 sing N N 152 HIS CD2 NE2 sing Y N 153 HIS CD2 HD2 sing N N 154 HIS CE1 NE2 sing Y N 155 HIS CE1 HE1 sing N N 156 HIS NE2 HE2 sing N N 157 HIS OXT HXT sing N N 158 HOH O H1 sing N N 159 HOH O H2 sing N N 160 ILE N CA sing N N 161 ILE N H sing N N 162 ILE N H2 sing N N 163 ILE CA C sing N N 164 ILE CA CB sing N N 165 ILE CA HA sing N N 166 ILE C O doub N N 167 ILE C OXT sing N N 168 ILE CB CG1 sing N N 169 ILE CB CG2 sing N N 170 ILE CB HB sing N N 171 ILE CG1 CD1 sing N N 172 ILE CG1 HG12 sing N N 173 ILE CG1 HG13 sing N N 174 ILE CG2 HG21 sing N N 175 ILE CG2 HG22 sing N N 176 ILE CG2 HG23 sing N N 177 ILE CD1 HD11 sing N N 178 ILE CD1 HD12 sing N N 179 ILE CD1 HD13 sing N N 180 ILE OXT HXT sing N N 181 LEU N CA sing N N 182 LEU N H sing N N 183 LEU N H2 sing N N 184 LEU CA C sing N N 185 LEU CA CB sing N N 186 LEU CA HA sing N N 187 LEU C O doub N N 188 LEU C OXT sing N N 189 LEU CB CG sing N N 190 LEU CB HB2 sing N N 191 LEU CB HB3 sing N N 192 LEU CG CD1 sing N N 193 LEU CG CD2 sing N N 194 LEU CG HG sing N N 195 LEU CD1 HD11 sing N N 196 LEU CD1 HD12 sing N N 197 LEU CD1 HD13 sing N N 198 LEU CD2 HD21 sing N N 199 LEU CD2 HD22 sing N N 200 LEU CD2 HD23 sing N N 201 LEU OXT HXT sing N N 202 LYS N CA sing N N 203 LYS N H sing N N 204 LYS N H2 sing N N 205 LYS CA C sing N N 206 LYS CA CB sing N N 207 LYS CA HA sing N N 208 LYS C O doub N N 209 LYS C OXT sing N N 210 LYS CB CG sing N N 211 LYS CB HB2 sing N N 212 LYS CB HB3 sing N N 213 LYS CG CD sing N N 214 LYS CG HG2 sing N N 215 LYS CG HG3 sing N N 216 LYS CD CE sing N N 217 LYS CD HD2 sing N N 218 LYS CD HD3 sing N N 219 LYS CE NZ sing N N 220 LYS CE HE2 sing N N 221 LYS CE HE3 sing N N 222 LYS NZ HZ1 sing N N 223 LYS NZ HZ2 sing N N 224 LYS NZ HZ3 sing N N 225 LYS OXT HXT sing N N 226 MET N CA sing N N 227 MET N H sing N N 228 MET N H2 sing N N 229 MET CA C sing N N 230 MET CA CB sing N N 231 MET CA HA sing N N 232 MET C O doub N N 233 MET C OXT sing N N 234 MET CB CG sing N N 235 MET CB HB2 sing N N 236 MET CB HB3 sing N N 237 MET CG SD sing N N 238 MET CG HG2 sing N N 239 MET CG HG3 sing N N 240 MET SD CE sing N N 241 MET CE HE1 sing N N 242 MET CE HE2 sing N N 243 MET CE HE3 sing N N 244 MET OXT HXT sing N N 245 PHE N CA sing N N 246 PHE N H sing N N 247 PHE N H2 sing N N 248 PHE CA C sing N N 249 PHE CA CB sing N N 250 PHE CA HA sing N N 251 PHE C O doub N N 252 PHE C OXT sing N N 253 PHE CB CG sing N N 254 PHE CB HB2 sing N N 255 PHE CB HB3 sing N N 256 PHE CG CD1 doub Y N 257 PHE CG CD2 sing Y N 258 PHE CD1 CE1 sing Y N 259 PHE CD1 HD1 sing N N 260 PHE CD2 CE2 doub Y N 261 PHE CD2 HD2 sing N N 262 PHE CE1 CZ doub Y N 263 PHE CE1 HE1 sing N N 264 PHE CE2 CZ sing Y N 265 PHE CE2 HE2 sing N N 266 PHE CZ HZ sing N N 267 PHE OXT HXT sing N N 268 PRO N CA sing N N 269 PRO N CD sing N N 270 PRO N H sing N N 271 PRO CA C sing N N 272 PRO CA CB sing N N 273 PRO CA HA sing N N 274 PRO C O doub N N 275 PRO C OXT sing N N 276 PRO CB CG sing N N 277 PRO CB HB2 sing N N 278 PRO CB HB3 sing N N 279 PRO CG CD sing N N 280 PRO CG HG2 sing N N 281 PRO CG HG3 sing N N 282 PRO CD HD2 sing N N 283 PRO CD HD3 sing N N 284 PRO OXT HXT sing N N 285 SER N CA sing N N 286 SER N H sing N N 287 SER N H2 sing N N 288 SER CA C sing N N 289 SER CA CB sing N N 290 SER CA HA sing N N 291 SER C O doub N N 292 SER C OXT sing N N 293 SER CB OG sing N N 294 SER CB HB2 sing N N 295 SER CB HB3 sing N N 296 SER OG HG sing N N 297 SER OXT HXT sing N N 298 THR N CA sing N N 299 THR N H sing N N 300 THR N H2 sing N N 301 THR CA C sing N N 302 THR CA CB sing N N 303 THR CA HA sing N N 304 THR C O doub N N 305 THR C OXT sing N N 306 THR CB OG1 sing N N 307 THR CB CG2 sing N N 308 THR CB HB sing N N 309 THR OG1 HG1 sing N N 310 THR CG2 HG21 sing N N 311 THR CG2 HG22 sing N N 312 THR CG2 HG23 sing N N 313 THR OXT HXT sing N N 314 TRP N CA sing N N 315 TRP N H sing N N 316 TRP N H2 sing N N 317 TRP CA C sing N N 318 TRP CA CB sing N N 319 TRP CA HA sing N N 320 TRP C O doub N N 321 TRP C OXT sing N N 322 TRP CB CG sing N N 323 TRP CB HB2 sing N N 324 TRP CB HB3 sing N N 325 TRP CG CD1 doub Y N 326 TRP CG CD2 sing Y N 327 TRP CD1 NE1 sing Y N 328 TRP CD1 HD1 sing N N 329 TRP CD2 CE2 doub Y N 330 TRP CD2 CE3 sing Y N 331 TRP NE1 CE2 sing Y N 332 TRP NE1 HE1 sing N N 333 TRP CE2 CZ2 sing Y N 334 TRP CE3 CZ3 doub Y N 335 TRP CE3 HE3 sing N N 336 TRP CZ2 CH2 doub Y N 337 TRP CZ2 HZ2 sing N N 338 TRP CZ3 CH2 sing Y N 339 TRP CZ3 HZ3 sing N N 340 TRP CH2 HH2 sing N N 341 TRP OXT HXT sing N N 342 TYR N CA sing N N 343 TYR N H sing N N 344 TYR N H2 sing N N 345 TYR CA C sing N N 346 TYR CA CB sing N N 347 TYR CA HA sing N N 348 TYR C O doub N N 349 TYR C OXT sing N N 350 TYR CB CG sing N N 351 TYR CB HB2 sing N N 352 TYR CB HB3 sing N N 353 TYR CG CD1 doub Y N 354 TYR CG CD2 sing Y N 355 TYR CD1 CE1 sing Y N 356 TYR CD1 HD1 sing N N 357 TYR CD2 CE2 doub Y N 358 TYR CD2 HD2 sing N N 359 TYR CE1 CZ doub Y N 360 TYR CE1 HE1 sing N N 361 TYR CE2 CZ sing Y N 362 TYR CE2 HE2 sing N N 363 TYR CZ OH sing N N 364 TYR OH HH sing N N 365 TYR OXT HXT sing N N 366 VAL N CA sing N N 367 VAL N H sing N N 368 VAL N H2 sing N N 369 VAL CA C sing N N 370 VAL CA CB sing N N 371 VAL CA HA sing N N 372 VAL C O doub N N 373 VAL C OXT sing N N 374 VAL CB CG1 sing N N 375 VAL CB CG2 sing N N 376 VAL CB HB sing N N 377 VAL CG1 HG11 sing N N 378 VAL CG1 HG12 sing N N 379 VAL CG1 HG13 sing N N 380 VAL CG2 HG21 sing N N 381 VAL CG2 HG22 sing N N 382 VAL CG2 HG23 sing N N 383 VAL OXT HXT sing N N 384 # _pdbx_audit_support.funding_organization 'National Institutes of Health/National Institute Of Allergy and Infectious Diseases (NIH/NIAID)' _pdbx_audit_support.country 'United States' _pdbx_audit_support.grant_number CA260749 _pdbx_audit_support.ordinal 1 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 1,2-ETHANEDIOL EDO 3 water HOH # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? #