data_8T6Z # _entry.id 8T6Z # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 8T6Z pdb_00008t6z 10.2210/pdb8t6z/pdb WWPDB D_1000275405 ? ? # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2024-05-08 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 8T6Z _pdbx_database_status.recvd_initial_deposition_date 2023-06-19 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _pdbx_database_related.db_name _pdbx_database_related.details _pdbx_database_related.db_id _pdbx_database_related.content_type PDB . 8T5W unspecified PDB . 8T5V unspecified PDB . 8T5Z unspecified PDB . 8T67 unspecified # _pdbx_contact_author.id 2 _pdbx_contact_author.email scohen@ucsd.edu _pdbx_contact_author.name_first Seth _pdbx_contact_author.name_last Cohen _pdbx_contact_author.name_mi M _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-5233-2280 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Kohlbrand, A.J.' 1 0000-0003-4599-526X 'Cohen, S.M.' 2 0000-0002-5233-2280 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Biochemistry _citation.journal_id_ASTM BICHAW _citation.journal_id_CSD 0033 _citation.journal_id_ISSN 0006-2960 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 63 _citation.language ? _citation.page_first 264 _citation.page_last 272 _citation.title 'Structural Studies of Inhibitors with Clinically Relevant Influenza Endonuclease Variants.' _citation.year 2024 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1021/acs.biochem.3c00536 _citation.pdbx_database_id_PubMed 38190441 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Kohlbrand, A.J.' 1 ? primary 'Stokes, R.W.' 2 0000-0001-5965-5421 primary 'Sankaran, B.' 3 ? primary 'Cohen, S.M.' 4 0000-0002-5233-2280 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Polymerase acidic protein' 22412.494 1 3.1.-.- I38T 'N-terminal domain' ? 2 non-polymer syn 'MANGANESE (II) ION' 54.938 2 ? ? ? ? 3 non-polymer syn '(6M)-3-hydroxy-4-oxo-6-[(4M)-4-(1H-tetrazol-5-yl)-2-(trifluoromethyl)phenyl]-1,4-dihydropyridine-2-carboxylic acid' 367.240 1 ? ? ? ? 4 water nat water 18.015 27 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'RNA-directed RNA polymerase subunit P2' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MGSGSAMEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAATCTHLEVCFMYSDFGSGDPNALLKHRFEIIEGRDRIM AWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEIGVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEE SRARIKTRLFTIRQEMASRSLWDSFRQSERGE ; _entity_poly.pdbx_seq_one_letter_code_can ;MGSGSAMEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAATCTHLEVCFMYSDFGSGDPNALLKHRFEIIEGRDRIM AWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEIGVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEE SRARIKTRLFTIRQEMASRSLWDSFRQSERGE ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'MANGANESE (II) ION' MN 3 '(6M)-3-hydroxy-4-oxo-6-[(4M)-4-(1H-tetrazol-5-yl)-2-(trifluoromethyl)phenyl]-1,4-dihydropyridine-2-carboxylic acid' IJM 4 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLY n 1 3 SER n 1 4 GLY n 1 5 SER n 1 6 ALA n 1 7 MET n 1 8 GLU n 1 9 ASP n 1 10 PHE n 1 11 VAL n 1 12 ARG n 1 13 GLN n 1 14 CYS n 1 15 PHE n 1 16 ASN n 1 17 PRO n 1 18 MET n 1 19 ILE n 1 20 VAL n 1 21 GLU n 1 22 LEU n 1 23 ALA n 1 24 GLU n 1 25 LYS n 1 26 ALA n 1 27 MET n 1 28 LYS n 1 29 GLU n 1 30 TYR n 1 31 GLY n 1 32 GLU n 1 33 ASP n 1 34 PRO n 1 35 LYS n 1 36 ILE n 1 37 GLU n 1 38 THR n 1 39 ASN n 1 40 LYS n 1 41 PHE n 1 42 ALA n 1 43 ALA n 1 44 THR n 1 45 CYS n 1 46 THR n 1 47 HIS n 1 48 LEU n 1 49 GLU n 1 50 VAL n 1 51 CYS n 1 52 PHE n 1 53 MET n 1 54 TYR n 1 55 SER n 1 56 ASP n 1 57 PHE n 1 58 GLY n 1 59 SER n 1 60 GLY n 1 61 ASP n 1 62 PRO n 1 63 ASN n 1 64 ALA n 1 65 LEU n 1 66 LEU n 1 67 LYS n 1 68 HIS n 1 69 ARG n 1 70 PHE n 1 71 GLU n 1 72 ILE n 1 73 ILE n 1 74 GLU n 1 75 GLY n 1 76 ARG n 1 77 ASP n 1 78 ARG n 1 79 ILE n 1 80 MET n 1 81 ALA n 1 82 TRP n 1 83 THR n 1 84 VAL n 1 85 VAL n 1 86 ASN n 1 87 SER n 1 88 ILE n 1 89 CYS n 1 90 ASN n 1 91 THR n 1 92 THR n 1 93 GLY n 1 94 VAL n 1 95 GLU n 1 96 LYS n 1 97 PRO n 1 98 LYS n 1 99 PHE n 1 100 LEU n 1 101 PRO n 1 102 ASP n 1 103 LEU n 1 104 TYR n 1 105 ASP n 1 106 TYR n 1 107 LYS n 1 108 GLU n 1 109 ASN n 1 110 ARG n 1 111 PHE n 1 112 ILE n 1 113 GLU n 1 114 ILE n 1 115 GLY n 1 116 VAL n 1 117 THR n 1 118 ARG n 1 119 ARG n 1 120 GLU n 1 121 VAL n 1 122 HIS n 1 123 ILE n 1 124 TYR n 1 125 TYR n 1 126 LEU n 1 127 GLU n 1 128 LYS n 1 129 ALA n 1 130 ASN n 1 131 LYS n 1 132 ILE n 1 133 LYS n 1 134 SER n 1 135 GLU n 1 136 LYS n 1 137 THR n 1 138 HIS n 1 139 ILE n 1 140 HIS n 1 141 ILE n 1 142 PHE n 1 143 SER n 1 144 PHE n 1 145 THR n 1 146 GLY n 1 147 GLU n 1 148 GLU n 1 149 MET n 1 150 ALA n 1 151 THR n 1 152 LYS n 1 153 ALA n 1 154 ASP n 1 155 TYR n 1 156 THR n 1 157 LEU n 1 158 ASP n 1 159 GLU n 1 160 GLU n 1 161 SER n 1 162 ARG n 1 163 ALA n 1 164 ARG n 1 165 ILE n 1 166 LYS n 1 167 THR n 1 168 ARG n 1 169 LEU n 1 170 PHE n 1 171 THR n 1 172 ILE n 1 173 ARG n 1 174 GLN n 1 175 GLU n 1 176 MET n 1 177 ALA n 1 178 SER n 1 179 ARG n 1 180 SER n 1 181 LEU n 1 182 TRP n 1 183 ASP n 1 184 SER n 1 185 PHE n 1 186 ARG n 1 187 GLN n 1 188 SER n 1 189 GLU n 1 190 ARG n 1 191 GLY n 1 192 GLU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 192 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene PA _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 'A/California/04/2009(H1N1)' _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Influenza A virus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 641501 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 IJM non-polymer . '(6M)-3-hydroxy-4-oxo-6-[(4M)-4-(1H-tetrazol-5-yl)-2-(trifluoromethyl)phenyl]-1,4-dihydropyridine-2-carboxylic acid' ? 'C14 H8 F3 N5 O4' 367.240 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MN non-polymer . 'MANGANESE (II) ION' ? 'Mn 2' 54.938 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 -5 ? ? ? A . n A 1 2 GLY 2 -4 ? ? ? A . n A 1 3 SER 3 -3 ? ? ? A . n A 1 4 GLY 4 -2 ? ? ? A . n A 1 5 SER 5 -1 -1 SER SER A . n A 1 6 ALA 6 0 0 ALA ALA A . n A 1 7 MET 7 1 1 MET MET A . n A 1 8 GLU 8 2 2 GLU GLU A . n A 1 9 ASP 9 3 3 ASP ASP A . n A 1 10 PHE 10 4 4 PHE PHE A . n A 1 11 VAL 11 5 5 VAL VAL A . n A 1 12 ARG 12 6 6 ARG ARG A . n A 1 13 GLN 13 7 7 GLN GLN A . n A 1 14 CYS 14 8 8 CYS CYS A . n A 1 15 PHE 15 9 9 PHE PHE A . n A 1 16 ASN 16 10 10 ASN ASN A . n A 1 17 PRO 17 11 11 PRO PRO A . n A 1 18 MET 18 12 12 MET MET A . n A 1 19 ILE 19 13 13 ILE ILE A . n A 1 20 VAL 20 14 14 VAL VAL A . n A 1 21 GLU 21 15 15 GLU GLU A . n A 1 22 LEU 22 16 16 LEU LEU A . n A 1 23 ALA 23 17 17 ALA ALA A . n A 1 24 GLU 24 18 18 GLU GLU A . n A 1 25 LYS 25 19 19 LYS LYS A . n A 1 26 ALA 26 20 20 ALA ALA A . n A 1 27 MET 27 21 21 MET MET A . n A 1 28 LYS 28 22 22 LYS LYS A . n A 1 29 GLU 29 23 23 GLU GLU A . n A 1 30 TYR 30 24 24 TYR TYR A . n A 1 31 GLY 31 25 25 GLY GLY A . n A 1 32 GLU 32 26 26 GLU GLU A . n A 1 33 ASP 33 27 27 ASP ASP A . n A 1 34 PRO 34 28 28 PRO PRO A . n A 1 35 LYS 35 29 29 LYS LYS A . n A 1 36 ILE 36 30 30 ILE ILE A . n A 1 37 GLU 37 31 31 GLU GLU A . n A 1 38 THR 38 32 32 THR THR A . n A 1 39 ASN 39 33 33 ASN ASN A . n A 1 40 LYS 40 34 34 LYS LYS A . n A 1 41 PHE 41 35 35 PHE PHE A . n A 1 42 ALA 42 36 36 ALA ALA A . n A 1 43 ALA 43 37 37 ALA ALA A . n A 1 44 THR 44 38 38 THR THR A . n A 1 45 CYS 45 39 39 CYS CYS A . n A 1 46 THR 46 40 40 THR THR A . n A 1 47 HIS 47 41 41 HIS HIS A . n A 1 48 LEU 48 42 42 LEU LEU A . n A 1 49 GLU 49 43 43 GLU GLU A . n A 1 50 VAL 50 44 44 VAL VAL A . n A 1 51 CYS 51 45 45 CYS CYS A . n A 1 52 PHE 52 46 46 PHE PHE A . n A 1 53 MET 53 47 47 MET MET A . n A 1 54 TYR 54 48 48 TYR TYR A . n A 1 55 SER 55 49 49 SER SER A . n A 1 56 ASP 56 50 50 ASP ASP A . n A 1 57 PHE 57 51 51 PHE PHE A . n A 1 58 GLY 58 52 52 GLY GLY A . n A 1 59 SER 59 65 ? ? ? A . n A 1 60 GLY 60 66 ? ? ? A . n A 1 61 ASP 61 67 ? ? ? A . n A 1 62 PRO 62 68 ? ? ? A . n A 1 63 ASN 63 69 ? ? ? A . n A 1 64 ALA 64 70 ? ? ? A . n A 1 65 LEU 65 71 ? ? ? A . n A 1 66 LEU 66 72 ? ? ? A . n A 1 67 LYS 67 73 73 LYS LYS A . n A 1 68 HIS 68 74 74 HIS HIS A . n A 1 69 ARG 69 75 75 ARG ARG A . n A 1 70 PHE 70 76 76 PHE PHE A . n A 1 71 GLU 71 77 77 GLU GLU A . n A 1 72 ILE 72 78 78 ILE ILE A . n A 1 73 ILE 73 79 79 ILE ILE A . n A 1 74 GLU 74 80 80 GLU GLU A . n A 1 75 GLY 75 81 81 GLY GLY A . n A 1 76 ARG 76 82 82 ARG ARG A . n A 1 77 ASP 77 83 83 ASP ASP A . n A 1 78 ARG 78 84 84 ARG ARG A . n A 1 79 ILE 79 85 85 ILE ILE A . n A 1 80 MET 80 86 86 MET MET A . n A 1 81 ALA 81 87 87 ALA ALA A . n A 1 82 TRP 82 88 88 TRP TRP A . n A 1 83 THR 83 89 89 THR THR A . n A 1 84 VAL 84 90 90 VAL VAL A . n A 1 85 VAL 85 91 91 VAL VAL A . n A 1 86 ASN 86 92 92 ASN ASN A . n A 1 87 SER 87 93 93 SER SER A . n A 1 88 ILE 88 94 94 ILE ILE A . n A 1 89 CYS 89 95 95 CYS CYS A . n A 1 90 ASN 90 96 96 ASN ASN A . n A 1 91 THR 91 97 97 THR THR A . n A 1 92 THR 92 98 98 THR THR A . n A 1 93 GLY 93 99 99 GLY GLY A . n A 1 94 VAL 94 100 100 VAL VAL A . n A 1 95 GLU 95 101 101 GLU GLU A . n A 1 96 LYS 96 102 102 LYS LYS A . n A 1 97 PRO 97 103 103 PRO PRO A . n A 1 98 LYS 98 104 104 LYS LYS A . n A 1 99 PHE 99 105 105 PHE PHE A . n A 1 100 LEU 100 106 106 LEU LEU A . n A 1 101 PRO 101 107 107 PRO PRO A . n A 1 102 ASP 102 108 108 ASP ASP A . n A 1 103 LEU 103 109 109 LEU LEU A . n A 1 104 TYR 104 110 110 TYR TYR A . n A 1 105 ASP 105 111 111 ASP ASP A . n A 1 106 TYR 106 112 112 TYR TYR A . n A 1 107 LYS 107 113 113 LYS LYS A . n A 1 108 GLU 108 114 114 GLU GLU A . n A 1 109 ASN 109 115 115 ASN ASN A . n A 1 110 ARG 110 116 116 ARG ARG A . n A 1 111 PHE 111 117 117 PHE PHE A . n A 1 112 ILE 112 118 118 ILE ILE A . n A 1 113 GLU 113 119 119 GLU GLU A . n A 1 114 ILE 114 120 120 ILE ILE A . n A 1 115 GLY 115 121 121 GLY GLY A . n A 1 116 VAL 116 122 122 VAL VAL A . n A 1 117 THR 117 123 123 THR THR A . n A 1 118 ARG 118 124 124 ARG ARG A . n A 1 119 ARG 119 125 125 ARG ARG A . n A 1 120 GLU 120 126 126 GLU GLU A . n A 1 121 VAL 121 127 127 VAL VAL A . n A 1 122 HIS 122 128 128 HIS HIS A . n A 1 123 ILE 123 129 129 ILE ILE A . n A 1 124 TYR 124 130 130 TYR TYR A . n A 1 125 TYR 125 131 131 TYR TYR A . n A 1 126 LEU 126 132 132 LEU LEU A . n A 1 127 GLU 127 133 133 GLU GLU A . n A 1 128 LYS 128 134 134 LYS LYS A . n A 1 129 ALA 129 135 135 ALA ALA A . n A 1 130 ASN 130 136 136 ASN ASN A . n A 1 131 LYS 131 137 137 LYS LYS A . n A 1 132 ILE 132 138 138 ILE ILE A . n A 1 133 LYS 133 139 139 LYS LYS A . n A 1 134 SER 134 140 140 SER SER A . n A 1 135 GLU 135 141 141 GLU GLU A . n A 1 136 LYS 136 142 142 LYS LYS A . n A 1 137 THR 137 143 143 THR THR A . n A 1 138 HIS 138 144 144 HIS HIS A . n A 1 139 ILE 139 145 145 ILE ILE A . n A 1 140 HIS 140 146 146 HIS HIS A . n A 1 141 ILE 141 147 147 ILE ILE A . n A 1 142 PHE 142 148 148 PHE PHE A . n A 1 143 SER 143 149 149 SER SER A . n A 1 144 PHE 144 150 150 PHE PHE A . n A 1 145 THR 145 151 151 THR THR A . n A 1 146 GLY 146 152 152 GLY GLY A . n A 1 147 GLU 147 153 153 GLU GLU A . n A 1 148 GLU 148 154 154 GLU GLU A . n A 1 149 MET 149 155 155 MET MET A . n A 1 150 ALA 150 156 156 ALA ALA A . n A 1 151 THR 151 157 157 THR THR A . n A 1 152 LYS 152 158 158 LYS LYS A . n A 1 153 ALA 153 159 159 ALA ALA A . n A 1 154 ASP 154 160 160 ASP ASP A . n A 1 155 TYR 155 161 161 TYR TYR A . n A 1 156 THR 156 162 162 THR THR A . n A 1 157 LEU 157 163 163 LEU LEU A . n A 1 158 ASP 158 164 164 ASP ASP A . n A 1 159 GLU 159 165 165 GLU GLU A . n A 1 160 GLU 160 166 166 GLU GLU A . n A 1 161 SER 161 167 167 SER SER A . n A 1 162 ARG 162 168 168 ARG ARG A . n A 1 163 ALA 163 169 169 ALA ALA A . n A 1 164 ARG 164 170 170 ARG ARG A . n A 1 165 ILE 165 171 171 ILE ILE A . n A 1 166 LYS 166 172 172 LYS LYS A . n A 1 167 THR 167 173 173 THR THR A . n A 1 168 ARG 168 174 174 ARG ARG A . n A 1 169 LEU 169 175 175 LEU LEU A . n A 1 170 PHE 170 176 176 PHE PHE A . n A 1 171 THR 171 177 177 THR THR A . n A 1 172 ILE 172 178 178 ILE ILE A . n A 1 173 ARG 173 179 179 ARG ARG A . n A 1 174 GLN 174 180 180 GLN GLN A . n A 1 175 GLU 175 181 181 GLU GLU A . n A 1 176 MET 176 182 182 MET MET A . n A 1 177 ALA 177 183 183 ALA ALA A . n A 1 178 SER 178 184 184 SER SER A . n A 1 179 ARG 179 185 185 ARG ARG A . n A 1 180 SER 180 186 186 SER SER A . n A 1 181 LEU 181 187 187 LEU LEU A . n A 1 182 TRP 182 188 188 TRP TRP A . n A 1 183 ASP 183 189 189 ASP ASP A . n A 1 184 SER 184 190 190 SER SER A . n A 1 185 PHE 185 191 191 PHE PHE A . n A 1 186 ARG 186 192 192 ARG ARG A . n A 1 187 GLN 187 193 193 GLN GLN A . n A 1 188 SER 188 194 194 SER SER A . n A 1 189 GLU 189 195 195 GLU GLU A . n A 1 190 ARG 190 196 ? ? ? A . n A 1 191 GLY 191 197 ? ? ? A . n A 1 192 GLU 192 198 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 MN 1 301 301 MN MN A . C 2 MN 1 302 302 MN MN A . D 3 IJM 1 303 303 IJM 23 A . E 4 HOH 1 401 3 HOH HOH A . E 4 HOH 2 402 15 HOH HOH A . E 4 HOH 3 403 4 HOH HOH A . E 4 HOH 4 404 10 HOH HOH A . E 4 HOH 5 405 7 HOH HOH A . E 4 HOH 6 406 1 HOH HOH A . E 4 HOH 7 407 19 HOH HOH A . E 4 HOH 8 408 16 HOH HOH A . E 4 HOH 9 409 6 HOH HOH A . E 4 HOH 10 410 22 HOH HOH A . E 4 HOH 11 411 2 HOH HOH A . E 4 HOH 12 412 23 HOH HOH A . E 4 HOH 13 413 17 HOH HOH A . E 4 HOH 14 414 12 HOH HOH A . E 4 HOH 15 415 30 HOH HOH A . E 4 HOH 16 416 5 HOH HOH A . E 4 HOH 17 417 18 HOH HOH A . E 4 HOH 18 418 13 HOH HOH A . E 4 HOH 19 419 14 HOH HOH A . E 4 HOH 20 420 9 HOH HOH A . E 4 HOH 21 421 26 HOH HOH A . E 4 HOH 22 422 27 HOH HOH A . E 4 HOH 23 423 21 HOH HOH A . E 4 HOH 24 424 29 HOH HOH A . E 4 HOH 25 425 8 HOH HOH A . E 4 HOH 26 426 20 HOH HOH A . E 4 HOH 27 427 28 HOH HOH A . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A LYS 34 ? CD ? A LYS 40 CD 2 1 Y 1 A LYS 34 ? CE ? A LYS 40 CE 3 1 Y 1 A LYS 34 ? NZ ? A LYS 40 NZ 4 1 Y 1 A PHE 51 ? CG ? A PHE 57 CG 5 1 Y 1 A PHE 51 ? CD1 ? A PHE 57 CD1 6 1 Y 1 A PHE 51 ? CD2 ? A PHE 57 CD2 7 1 Y 1 A PHE 51 ? CE1 ? A PHE 57 CE1 8 1 Y 1 A PHE 51 ? CE2 ? A PHE 57 CE2 9 1 Y 1 A PHE 51 ? CZ ? A PHE 57 CZ # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.19.2_4158 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? xia2 ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 120.000 _cell.angle_gamma_esd ? _cell.entry_id 8T6Z _cell.details ? _cell.formula_units_Z ? _cell.length_a 75.915 _cell.length_a_esd ? _cell.length_b 75.915 _cell.length_b_esd ? _cell.length_c 120.631 _cell.length_c_esd ? _cell.volume 602066.901 _cell.volume_esd ? _cell.Z_PDB 12 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 8T6Z _symmetry.cell_setting ? _symmetry.Int_Tables_number 180 _symmetry.space_group_name_Hall 'P 62 2 (x,y,z+1/3)' _symmetry.space_group_name_H-M 'P 62 2 2' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 8T6Z _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.39 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 48.59 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '32% PEG (MW 4000 g/mol), 100 mM Tris (pH 8.35), and 220 mM sodium acetate' _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 306 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS3 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2023-04-21 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'ALS BEAMLINE 5.0.2' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 5.0.2 _diffrn_source.pdbx_synchrotron_site ALS # _reflns.B_iso_Wilson_estimate 47.19 _reflns.entry_id 8T6Z _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.91 _reflns.d_resolution_low 65.78 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 27414 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 100.0 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 30.8 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 17 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 1.000 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 1.91 _reflns_shell.d_res_low 1.98 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 1620 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.425 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.percent_possible_all ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 63.60 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 8T6Z _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.91 _refine.ls_d_res_low 65.74 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 27414 _refine.ls_number_reflns_R_free 2765 _refine.ls_number_reflns_R_work 24649 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 90.74 _refine.ls_percent_reflns_R_free 10.09 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2317 _refine.ls_R_factor_R_free 0.2660 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2278 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.33 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values 'GeoStd + Monomer Library + CDL v1.2' _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 41.5579 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.5122 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 1.91 _refine_hist.d_res_low 65.74 _refine_hist.number_atoms_solvent 27 _refine_hist.number_atoms_total 1515 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 1460 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 28 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.0086 ? 1517 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 1.1246 ? 2041 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.0621 ? 214 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.0104 ? 260 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 20.8458 ? 568 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free _refine_ls_shell.R_factor_R_free 'X-RAY DIFFRACTION' 1.91 1.94 . . 63 564 40.58 . . . . 0.5520 . . . . . . . . . . . 0.5624 'X-RAY DIFFRACTION' 1.94 1.98 . . 49 392 29.34 . . . . 0.4545 . . . . . . . . . . . 0.3861 'X-RAY DIFFRACTION' 1.98 2.02 . . 116 941 70.51 . . . . 0.4534 . . . . . . . . . . . 0.4717 'X-RAY DIFFRACTION' 2.02 2.06 . . 118 1070 78.42 . . . . 0.4334 . . . . . . . . . . . 0.5479 'X-RAY DIFFRACTION' 2.06 2.10 . . 149 1323 97.42 . . . . 0.4232 . . . . . . . . . . . 0.4773 'X-RAY DIFFRACTION' 2.10 2.15 . . 149 1365 100.00 . . . . 0.3933 . . . . . . . . . . . 0.4126 'X-RAY DIFFRACTION' 2.15 2.21 . . 152 1342 99.93 . . . . 0.3610 . . . . . . . . . . . 0.3759 'X-RAY DIFFRACTION' 2.21 2.27 . . 147 1353 99.93 . . . . 0.3578 . . . . . . . . . . . 0.3924 'X-RAY DIFFRACTION' 2.27 2.33 . . 149 1348 100.00 . . . . 0.3285 . . . . . . . . . . . 0.3537 'X-RAY DIFFRACTION' 2.33 2.41 . . 153 1363 99.93 . . . . 0.2995 . . . . . . . . . . . 0.3506 'X-RAY DIFFRACTION' 2.41 2.49 . . 154 1352 99.87 . . . . 0.2800 . . . . . . . . . . . 0.3536 'X-RAY DIFFRACTION' 2.49 2.59 . . 153 1368 100.00 . . . . 0.2947 . . . . . . . . . . . 0.3408 'X-RAY DIFFRACTION' 2.59 2.71 . . 153 1359 100.00 . . . . 0.2538 . . . . . . . . . . . 0.2978 'X-RAY DIFFRACTION' 2.71 2.85 . . 145 1363 100.00 . . . . 0.2673 . . . . . . . . . . . 0.2545 'X-RAY DIFFRACTION' 2.85 3.03 . . 152 1358 100.00 . . . . 0.2437 . . . . . . . . . . . 0.3434 'X-RAY DIFFRACTION' 3.03 3.27 . . 151 1341 100.00 . . . . 0.2364 . . . . . . . . . . . 0.3188 'X-RAY DIFFRACTION' 3.27 3.60 . . 148 1370 100.00 . . . . 0.2002 . . . . . . . . . . . 0.2344 'X-RAY DIFFRACTION' 3.60 4.12 . . 149 1351 100.00 . . . . 0.1756 . . . . . . . . . . . 0.2488 'X-RAY DIFFRACTION' 4.12 5.18 . . 154 1363 100.00 . . . . 0.1669 . . . . . . . . . . . 0.2053 'X-RAY DIFFRACTION' 5.19 65.74 . . 161 1363 100.00 . . . . 0.2034 . . . . . . . . . . . 0.1948 # _struct.entry_id 8T6Z _struct.title ;Influenza PAN endonuclease I38T mutant with 6-(4-(1H-tetrazol-5-yl)-2-(trifluoromethyl)phenyl)-3-hydroxy-4-oxo-1,4-dihydropyridine-2-carboxylic acid ; _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 8T6Z _struct_keywords.text 'Influenza endonuclease, resistance, drug discovery, metal-binding pharmacophore, VIRAL PROTEIN, HYDROLASE-INHIBITOR complex' _struct_keywords.pdbx_keywords 'VIRAL PROTEIN,HYDROLASE/INHIBITOR' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 3 ? E N N 4 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code C3W5S0_I09A0 _struct_ref.pdbx_db_accession C3W5S0 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGESIIVESGDPNALLKHRFEIIE GRDRIMAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEIGVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKAD YTLDEESRARIKTRLFTIRQEMASRSLWDSFRQSERGE ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 8T6Z _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 7 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 192 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession C3W5S0 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 198 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 198 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 8T6Z MET A 1 ? UNP C3W5S0 ? ? 'initiating methionine' -5 1 1 8T6Z GLY A 2 ? UNP C3W5S0 ? ? 'expression tag' -4 2 1 8T6Z SER A 3 ? UNP C3W5S0 ? ? 'expression tag' -3 3 1 8T6Z GLY A 4 ? UNP C3W5S0 ? ? 'expression tag' -2 4 1 8T6Z SER A 5 ? UNP C3W5S0 ? ? 'expression tag' -1 5 1 8T6Z ALA A 6 ? UNP C3W5S0 ? ? 'expression tag' 0 6 1 8T6Z THR A 44 ? UNP C3W5S0 ILE 38 'engineered mutation' 38 7 1 8T6Z GLY A 58 ? UNP C3W5S0 HIS 52 conflict 52 8 1 8T6Z ? A ? ? UNP C3W5S0 PHE 53 deletion ? 9 1 8T6Z ? A ? ? UNP C3W5S0 ILE 54 deletion ? 10 1 8T6Z ? A ? ? UNP C3W5S0 ASP 55 deletion ? 11 1 8T6Z ? A ? ? UNP C3W5S0 GLU 56 deletion ? 12 1 8T6Z ? A ? ? UNP C3W5S0 ARG 57 deletion ? 13 1 8T6Z ? A ? ? UNP C3W5S0 GLY 58 deletion ? 14 1 8T6Z ? A ? ? UNP C3W5S0 GLU 59 deletion ? 15 1 8T6Z ? A ? ? UNP C3W5S0 SER 60 deletion ? 16 1 8T6Z ? A ? ? UNP C3W5S0 ILE 61 deletion ? 17 1 8T6Z ? A ? ? UNP C3W5S0 ILE 62 deletion ? 18 1 8T6Z ? A ? ? UNP C3W5S0 VAL 63 deletion ? 19 1 8T6Z ? A ? ? UNP C3W5S0 GLU 64 deletion ? 20 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 SER A 5 ? PHE A 15 ? SER A -1 PHE A 9 1 ? 11 HELX_P HELX_P2 AA2 ASN A 16 ? GLY A 31 ? ASN A 10 GLY A 25 1 ? 16 HELX_P HELX_P3 AA3 GLU A 37 ? PHE A 57 ? GLU A 31 PHE A 51 1 ? 21 HELX_P HELX_P4 AA4 ASP A 77 ? GLY A 93 ? ASP A 83 GLY A 99 1 ? 17 HELX_P HELX_P5 AA5 GLU A 120 ? LYS A 133 ? GLU A 126 LYS A 139 1 ? 14 HELX_P HELX_P6 AA6 LYS A 152 ? ASP A 154 ? LYS A 158 ASP A 160 5 ? 3 HELX_P HELX_P7 AA7 ASP A 158 ? ARG A 179 ? ASP A 164 ARG A 185 1 ? 22 HELX_P HELX_P8 AA8 LEU A 181 ? SER A 188 ? LEU A 187 SER A 194 1 ? 8 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A HIS 47 NE2 ? ? ? 1_555 B MN . MN ? ? A HIS 41 A MN 301 1_555 ? ? ? ? ? ? ? 2.318 ? ? metalc2 metalc ? ? A GLU 74 OE2 ? ? ? 1_555 C MN . MN ? ? A GLU 80 A MN 302 1_555 ? ? ? ? ? ? ? 2.303 ? ? metalc3 metalc ? ? A ASP 102 OD2 ? ? ? 1_555 B MN . MN ? ? A ASP 108 A MN 301 1_555 ? ? ? ? ? ? ? 2.346 ? ? metalc4 metalc ? ? A ASP 102 OD1 ? ? ? 1_555 C MN . MN ? ? A ASP 108 A MN 302 1_555 ? ? ? ? ? ? ? 2.331 ? ? metalc5 metalc ? ? A GLU 113 OE2 ? ? ? 1_555 B MN . MN ? ? A GLU 119 A MN 301 1_555 ? ? ? ? ? ? ? 2.216 ? ? metalc6 metalc ? ? A ILE 114 O ? ? ? 1_555 B MN . MN ? ? A ILE 120 A MN 301 1_555 ? ? ? ? ? ? ? 2.267 ? ? metalc7 metalc ? ? B MN . MN ? ? ? 1_555 D IJM . O23 ? ? A MN 301 A IJM 303 1_555 ? ? ? ? ? ? ? 2.310 ? ? metalc8 metalc ? ? B MN . MN ? ? ? 1_555 D IJM . O25 ? ? A MN 301 A IJM 303 1_555 ? ? ? ? ? ? ? 2.271 ? ? metalc9 metalc ? ? C MN . MN ? ? ? 1_555 D IJM . O01 ? ? A MN 302 A IJM 303 1_555 ? ? ? ? ? ? ? 2.072 ? ? metalc10 metalc ? ? C MN . MN ? ? ? 1_555 D IJM . O23 ? ? A MN 302 A IJM 303 1_555 ? ? ? ? ? ? ? 2.202 ? ? metalc11 metalc ? ? C MN . MN ? ? ? 1_555 E HOH . O ? ? A MN 302 A HOH 401 1_555 ? ? ? ? ? ? ? 2.504 ? ? metalc12 metalc ? ? C MN . MN ? ? ? 1_555 E HOH . O ? ? A MN 302 A HOH 404 1_555 ? ? ? ? ? ? ? 2.472 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 NE2 ? A HIS 47 ? A HIS 41 ? 1_555 MN ? B MN . ? A MN 301 ? 1_555 OD2 ? A ASP 102 ? A ASP 108 ? 1_555 105.8 ? 2 NE2 ? A HIS 47 ? A HIS 41 ? 1_555 MN ? B MN . ? A MN 301 ? 1_555 OE2 ? A GLU 113 ? A GLU 119 ? 1_555 175.6 ? 3 OD2 ? A ASP 102 ? A ASP 108 ? 1_555 MN ? B MN . ? A MN 301 ? 1_555 OE2 ? A GLU 113 ? A GLU 119 ? 1_555 76.8 ? 4 NE2 ? A HIS 47 ? A HIS 41 ? 1_555 MN ? B MN . ? A MN 301 ? 1_555 O ? A ILE 114 ? A ILE 120 ? 1_555 90.2 ? 5 OD2 ? A ASP 102 ? A ASP 108 ? 1_555 MN ? B MN . ? A MN 301 ? 1_555 O ? A ILE 114 ? A ILE 120 ? 1_555 91.1 ? 6 OE2 ? A GLU 113 ? A GLU 119 ? 1_555 MN ? B MN . ? A MN 301 ? 1_555 O ? A ILE 114 ? A ILE 120 ? 1_555 86.2 ? 7 NE2 ? A HIS 47 ? A HIS 41 ? 1_555 MN ? B MN . ? A MN 301 ? 1_555 O23 ? D IJM . ? A IJM 303 ? 1_555 97.6 ? 8 OD2 ? A ASP 102 ? A ASP 108 ? 1_555 MN ? B MN . ? A MN 301 ? 1_555 O23 ? D IJM . ? A IJM 303 ? 1_555 97.5 ? 9 OE2 ? A GLU 113 ? A GLU 119 ? 1_555 MN ? B MN . ? A MN 301 ? 1_555 O23 ? D IJM . ? A IJM 303 ? 1_555 85.4 ? 10 O ? A ILE 114 ? A ILE 120 ? 1_555 MN ? B MN . ? A MN 301 ? 1_555 O23 ? D IJM . ? A IJM 303 ? 1_555 166.3 ? 11 NE2 ? A HIS 47 ? A HIS 41 ? 1_555 MN ? B MN . ? A MN 301 ? 1_555 O25 ? D IJM . ? A IJM 303 ? 1_555 85.7 ? 12 OD2 ? A ASP 102 ? A ASP 108 ? 1_555 MN ? B MN . ? A MN 301 ? 1_555 O25 ? D IJM . ? A IJM 303 ? 1_555 166.6 ? 13 OE2 ? A GLU 113 ? A GLU 119 ? 1_555 MN ? B MN . ? A MN 301 ? 1_555 O25 ? D IJM . ? A IJM 303 ? 1_555 92.1 ? 14 O ? A ILE 114 ? A ILE 120 ? 1_555 MN ? B MN . ? A MN 301 ? 1_555 O25 ? D IJM . ? A IJM 303 ? 1_555 95.7 ? 15 O23 ? D IJM . ? A IJM 303 ? 1_555 MN ? B MN . ? A MN 301 ? 1_555 O25 ? D IJM . ? A IJM 303 ? 1_555 73.8 ? 16 OE2 ? A GLU 74 ? A GLU 80 ? 1_555 MN ? C MN . ? A MN 302 ? 1_555 OD1 ? A ASP 102 ? A ASP 108 ? 1_555 87.4 ? 17 OE2 ? A GLU 74 ? A GLU 80 ? 1_555 MN ? C MN . ? A MN 302 ? 1_555 O01 ? D IJM . ? A IJM 303 ? 1_555 82.9 ? 18 OD1 ? A ASP 102 ? A ASP 108 ? 1_555 MN ? C MN . ? A MN 302 ? 1_555 O01 ? D IJM . ? A IJM 303 ? 1_555 163.5 ? 19 OE2 ? A GLU 74 ? A GLU 80 ? 1_555 MN ? C MN . ? A MN 302 ? 1_555 O23 ? D IJM . ? A IJM 303 ? 1_555 103.6 ? 20 OD1 ? A ASP 102 ? A ASP 108 ? 1_555 MN ? C MN . ? A MN 302 ? 1_555 O23 ? D IJM . ? A IJM 303 ? 1_555 87.7 ? 21 O01 ? D IJM . ? A IJM 303 ? 1_555 MN ? C MN . ? A MN 302 ? 1_555 O23 ? D IJM . ? A IJM 303 ? 1_555 81.6 ? 22 OE2 ? A GLU 74 ? A GLU 80 ? 1_555 MN ? C MN . ? A MN 302 ? 1_555 O ? E HOH . ? A HOH 401 ? 1_555 173.0 ? 23 OD1 ? A ASP 102 ? A ASP 108 ? 1_555 MN ? C MN . ? A MN 302 ? 1_555 O ? E HOH . ? A HOH 401 ? 1_555 95.4 ? 24 O01 ? D IJM . ? A IJM 303 ? 1_555 MN ? C MN . ? A MN 302 ? 1_555 O ? E HOH . ? A HOH 401 ? 1_555 95.7 ? 25 O23 ? D IJM . ? A IJM 303 ? 1_555 MN ? C MN . ? A MN 302 ? 1_555 O ? E HOH . ? A HOH 401 ? 1_555 83.0 ? 26 OE2 ? A GLU 74 ? A GLU 80 ? 1_555 MN ? C MN . ? A MN 302 ? 1_555 O ? E HOH . ? A HOH 404 ? 1_555 95.8 ? 27 OD1 ? A ASP 102 ? A ASP 108 ? 1_555 MN ? C MN . ? A MN 302 ? 1_555 O ? E HOH . ? A HOH 404 ? 1_555 100.8 ? 28 O01 ? D IJM . ? A IJM 303 ? 1_555 MN ? C MN . ? A MN 302 ? 1_555 O ? E HOH . ? A HOH 404 ? 1_555 93.6 ? 29 O23 ? D IJM . ? A IJM 303 ? 1_555 MN ? C MN . ? A MN 302 ? 1_555 O ? E HOH . ? A HOH 404 ? 1_555 159.2 ? 30 O ? E HOH . ? A HOH 401 ? 1_555 MN ? C MN . ? A MN 302 ? 1_555 O ? E HOH . ? A HOH 404 ? 1_555 77.3 ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? parallel AA1 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 PHE A 70 ? ILE A 72 ? PHE A 76 ILE A 78 AA1 2 LEU A 103 ? ASP A 105 ? LEU A 109 ASP A 111 AA1 3 ARG A 110 ? THR A 117 ? ARG A 116 THR A 123 AA1 4 HIS A 138 ? SER A 143 ? HIS A 144 SER A 149 AA1 5 GLU A 148 ? ALA A 150 ? GLU A 154 ALA A 156 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N GLU A 71 ? N GLU A 77 O TYR A 104 ? O TYR A 110 AA1 2 3 N ASP A 105 ? N ASP A 111 O ARG A 110 ? O ARG A 116 AA1 3 4 N GLU A 113 ? N GLU A 119 O HIS A 138 ? O HIS A 144 AA1 4 5 N ILE A 141 ? N ILE A 147 O MET A 149 ? O MET A 155 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PHE A 51 ? ? -68.22 5.17 2 1 PRO A 107 ? ? -79.63 -168.72 3 1 ARG A 125 ? ? -101.27 -159.54 4 1 LYS A 139 ? ? 58.25 3.19 5 1 LYS A 158 ? ? 52.64 18.96 6 1 THR A 162 ? ? 70.29 -55.01 # _pdbx_struct_special_symmetry.id 1 _pdbx_struct_special_symmetry.PDB_model_num 1 _pdbx_struct_special_symmetry.auth_asym_id A _pdbx_struct_special_symmetry.auth_comp_id HOH _pdbx_struct_special_symmetry.auth_seq_id 408 _pdbx_struct_special_symmetry.PDB_ins_code ? _pdbx_struct_special_symmetry.label_asym_id E _pdbx_struct_special_symmetry.label_comp_id HOH _pdbx_struct_special_symmetry.label_seq_id . # loop_ _space_group_symop.id _space_group_symop.operation_xyz 1 x,y,z 2 x-y,x,z+1/3 3 y,-x+y,z+2/3 4 -y,x-y,z+2/3 5 -x+y,-x,z+1/3 6 x-y,-y,-z 7 -x,-x+y,-z+1/3 8 -x,-y,z 9 y,x,-z+2/3 10 -y,-x,-z+2/3 11 -x+y,y,-z 12 x,x-y,-z+1/3 # loop_ _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][2] 'X-RAY DIFFRACTION' 1 ? refined 29.559 7.577 -20.432 0.685897313697 0.46235365121 0.477211899802 0.00803228929501 0.0962894222374 -0.12931038339 8.16860755281 3.04816530411 7.10138845801 3.88040253706 1.66484876198 -0.0303820803884 -0.303981741811 0.358392860067 -0.0814157074705 1.1109508171 -0.733343248759 -0.166432749878 -0.31107292367 0.349790822692 0.0468848439212 'X-RAY DIFFRACTION' 2 ? refined 15.104 13.038 -8.271 0.604001675295 0.309239488611 0.551385488855 -0.0017474465802 0.069637985133 0.0347172070635 7.02310835536 1.12036615472 1.87484673418 0.323807153428 -0.688770650331 0.500904274723 0.00963803519902 -0.00982632141294 0.0368171252709 -0.00651046924216 -0.45959803981 0.436992700911 0.150922414556 0.115938534864 -0.137574230646 'X-RAY DIFFRACTION' 3 ? refined 19.080 25.610 -6.437 0.629670617175 0.314443090384 0.602041335389 -0.0152320937813 0.111608458408 -0.0167185954903 7.33028240432 3.83061973713 9.51663342351 0.336393293614 3.05691731643 -4.44645867734 -0.0711773467294 0.116233437602 -0.028443922677 0.135050134701 1.22456508178 0.416000238298 0.216208530055 -1.04689255745 -0.420391370159 'X-RAY DIFFRACTION' 4 ? refined 31.735 16.723 -4.297 0.669940714002 0.230515971689 0.340764636 -0.013925162513 0.00878679000698 0.0148011274807 9.74399562554 0.0529929529082 5.17008891673 -0.116249342432 -2.83354595095 0.495284053472 0.135449346849 0.020016532918 -0.134357460843 -0.418385264639 0.0448202105569 0.122798492793 0.280592358393 -0.366812382014 0.365706045012 # loop_ _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.selection_details _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.selection 'X-RAY DIFFRACTION' 1 1 A -1 A 31 '( CHAIN A AND RESID -1:31 )' ? ? ? ? ? 'X-RAY DIFFRACTION' 2 2 A 32 A 126 '( CHAIN A AND RESID 32:126 )' ? ? ? ? ? 'X-RAY DIFFRACTION' 3 3 A 127 A 149 '( CHAIN A AND RESID 127:149 )' ? ? ? ? ? 'X-RAY DIFFRACTION' 4 4 A 150 A 195 '( CHAIN A AND RESID 150:195 )' ? ? ? ? ? # _pdbx_entry_details.entry_id 8T6Z _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET -5 ? A MET 1 2 1 Y 1 A GLY -4 ? A GLY 2 3 1 Y 1 A SER -3 ? A SER 3 4 1 Y 1 A GLY -2 ? A GLY 4 5 1 Y 1 A SER 65 ? A SER 59 6 1 Y 1 A GLY 66 ? A GLY 60 7 1 Y 1 A ASP 67 ? A ASP 61 8 1 Y 1 A PRO 68 ? A PRO 62 9 1 Y 1 A ASN 69 ? A ASN 63 10 1 Y 1 A ALA 70 ? A ALA 64 11 1 Y 1 A LEU 71 ? A LEU 65 12 1 Y 1 A LEU 72 ? A LEU 66 13 1 Y 1 A ARG 196 ? A ARG 190 14 1 Y 1 A GLY 197 ? A GLY 191 15 1 Y 1 A GLU 198 ? A GLU 192 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 HOH O O N N 158 HOH H1 H N N 159 HOH H2 H N N 160 IJM C02 C N N 161 IJM C03 C N N 162 IJM C05 C N N 163 IJM C06 C Y N 164 IJM C07 C Y N 165 IJM C08 C Y N 166 IJM C09 C Y N 167 IJM C10 C Y N 168 IJM C15 C Y N 169 IJM C16 C Y N 170 IJM C17 C N N 171 IJM C21 C N N 172 IJM C22 C N N 173 IJM C24 C N N 174 IJM F18 F N N 175 IJM F19 F N N 176 IJM F20 F N N 177 IJM N04 N N N 178 IJM N11 N Y N 179 IJM N12 N Y N 180 IJM N13 N Y N 181 IJM N14 N Y N 182 IJM O01 O N N 183 IJM O23 O N N 184 IJM O25 O N N 185 IJM O26 O N N 186 IJM H071 H N N 187 IJM H081 H N N 188 IJM H151 H N N 189 IJM H211 H N N 190 IJM H041 H N N 191 IJM H141 H N N 192 IJM H1 H N N 193 IJM H2 H N N 194 ILE N N N N 195 ILE CA C N S 196 ILE C C N N 197 ILE O O N N 198 ILE CB C N S 199 ILE CG1 C N N 200 ILE CG2 C N N 201 ILE CD1 C N N 202 ILE OXT O N N 203 ILE H H N N 204 ILE H2 H N N 205 ILE HA H N N 206 ILE HB H N N 207 ILE HG12 H N N 208 ILE HG13 H N N 209 ILE HG21 H N N 210 ILE HG22 H N N 211 ILE HG23 H N N 212 ILE HD11 H N N 213 ILE HD12 H N N 214 ILE HD13 H N N 215 ILE HXT H N N 216 LEU N N N N 217 LEU CA C N S 218 LEU C C N N 219 LEU O O N N 220 LEU CB C N N 221 LEU CG C N N 222 LEU CD1 C N N 223 LEU CD2 C N N 224 LEU OXT O N N 225 LEU H H N N 226 LEU H2 H N N 227 LEU HA H N N 228 LEU HB2 H N N 229 LEU HB3 H N N 230 LEU HG H N N 231 LEU HD11 H N N 232 LEU HD12 H N N 233 LEU HD13 H N N 234 LEU HD21 H N N 235 LEU HD22 H N N 236 LEU HD23 H N N 237 LEU HXT H N N 238 LYS N N N N 239 LYS CA C N S 240 LYS C C N N 241 LYS O O N N 242 LYS CB C N N 243 LYS CG C N N 244 LYS CD C N N 245 LYS CE C N N 246 LYS NZ N N N 247 LYS OXT O N N 248 LYS H H N N 249 LYS H2 H N N 250 LYS HA H N N 251 LYS HB2 H N N 252 LYS HB3 H N N 253 LYS HG2 H N N 254 LYS HG3 H N N 255 LYS HD2 H N N 256 LYS HD3 H N N 257 LYS HE2 H N N 258 LYS HE3 H N N 259 LYS HZ1 H N N 260 LYS HZ2 H N N 261 LYS HZ3 H N N 262 LYS HXT H N N 263 MET N N N N 264 MET CA C N S 265 MET C C N N 266 MET O O N N 267 MET CB C N N 268 MET CG C N N 269 MET SD S N N 270 MET CE C N N 271 MET OXT O N N 272 MET H H N N 273 MET H2 H N N 274 MET HA H N N 275 MET HB2 H N N 276 MET HB3 H N N 277 MET HG2 H N N 278 MET HG3 H N N 279 MET HE1 H N N 280 MET HE2 H N N 281 MET HE3 H N N 282 MET HXT H N N 283 MN MN MN N N 284 PHE N N N N 285 PHE CA C N S 286 PHE C C N N 287 PHE O O N N 288 PHE CB C N N 289 PHE CG C Y N 290 PHE CD1 C Y N 291 PHE CD2 C Y N 292 PHE CE1 C Y N 293 PHE CE2 C Y N 294 PHE CZ C Y N 295 PHE OXT O N N 296 PHE H H N N 297 PHE H2 H N N 298 PHE HA H N N 299 PHE HB2 H N N 300 PHE HB3 H N N 301 PHE HD1 H N N 302 PHE HD2 H N N 303 PHE HE1 H N N 304 PHE HE2 H N N 305 PHE HZ H N N 306 PHE HXT H N N 307 PRO N N N N 308 PRO CA C N S 309 PRO C C N N 310 PRO O O N N 311 PRO CB C N N 312 PRO CG C N N 313 PRO CD C N N 314 PRO OXT O N N 315 PRO H H N N 316 PRO HA H N N 317 PRO HB2 H N N 318 PRO HB3 H N N 319 PRO HG2 H N N 320 PRO HG3 H N N 321 PRO HD2 H N N 322 PRO HD3 H N N 323 PRO HXT H N N 324 SER N N N N 325 SER CA C N S 326 SER C C N N 327 SER O O N N 328 SER CB C N N 329 SER OG O N N 330 SER OXT O N N 331 SER H H N N 332 SER H2 H N N 333 SER HA H N N 334 SER HB2 H N N 335 SER HB3 H N N 336 SER HG H N N 337 SER HXT H N N 338 THR N N N N 339 THR CA C N S 340 THR C C N N 341 THR O O N N 342 THR CB C N R 343 THR OG1 O N N 344 THR CG2 C N N 345 THR OXT O N N 346 THR H H N N 347 THR H2 H N N 348 THR HA H N N 349 THR HB H N N 350 THR HG1 H N N 351 THR HG21 H N N 352 THR HG22 H N N 353 THR HG23 H N N 354 THR HXT H N N 355 TRP N N N N 356 TRP CA C N S 357 TRP C C N N 358 TRP O O N N 359 TRP CB C N N 360 TRP CG C Y N 361 TRP CD1 C Y N 362 TRP CD2 C Y N 363 TRP NE1 N Y N 364 TRP CE2 C Y N 365 TRP CE3 C Y N 366 TRP CZ2 C Y N 367 TRP CZ3 C Y N 368 TRP CH2 C Y N 369 TRP OXT O N N 370 TRP H H N N 371 TRP H2 H N N 372 TRP HA H N N 373 TRP HB2 H N N 374 TRP HB3 H N N 375 TRP HD1 H N N 376 TRP HE1 H N N 377 TRP HE3 H N N 378 TRP HZ2 H N N 379 TRP HZ3 H N N 380 TRP HH2 H N N 381 TRP HXT H N N 382 TYR N N N N 383 TYR CA C N S 384 TYR C C N N 385 TYR O O N N 386 TYR CB C N N 387 TYR CG C Y N 388 TYR CD1 C Y N 389 TYR CD2 C Y N 390 TYR CE1 C Y N 391 TYR CE2 C Y N 392 TYR CZ C Y N 393 TYR OH O N N 394 TYR OXT O N N 395 TYR H H N N 396 TYR H2 H N N 397 TYR HA H N N 398 TYR HB2 H N N 399 TYR HB3 H N N 400 TYR HD1 H N N 401 TYR HD2 H N N 402 TYR HE1 H N N 403 TYR HE2 H N N 404 TYR HH H N N 405 TYR HXT H N N 406 VAL N N N N 407 VAL CA C N S 408 VAL C C N N 409 VAL O O N N 410 VAL CB C N N 411 VAL CG1 C N N 412 VAL CG2 C N N 413 VAL OXT O N N 414 VAL H H N N 415 VAL H2 H N N 416 VAL HA H N N 417 VAL HB H N N 418 VAL HG11 H N N 419 VAL HG12 H N N 420 VAL HG13 H N N 421 VAL HG21 H N N 422 VAL HG22 H N N 423 VAL HG23 H N N 424 VAL HXT H N N 425 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 IJM N13 N14 sing Y N 152 IJM N13 N12 doub Y N 153 IJM N14 C10 sing Y N 154 IJM N12 N11 sing Y N 155 IJM C10 N11 doub Y N 156 IJM C10 C09 sing N N 157 IJM C08 C09 doub Y N 158 IJM C08 C07 sing Y N 159 IJM C09 C15 sing Y N 160 IJM C07 C06 doub Y N 161 IJM C15 C16 doub Y N 162 IJM O26 C02 doub N N 163 IJM C06 C16 sing Y N 164 IJM C06 C05 sing N N 165 IJM C16 C17 sing N N 166 IJM N04 C05 sing N N 167 IJM N04 C03 sing N N 168 IJM F19 C17 sing N N 169 IJM C05 C21 doub N N 170 IJM C02 C03 sing N N 171 IJM C02 O01 sing N N 172 IJM F18 C17 sing N N 173 IJM C17 F20 sing N N 174 IJM C03 C22 doub N N 175 IJM C21 C24 sing N N 176 IJM C22 C24 sing N N 177 IJM C22 O23 sing N N 178 IJM C24 O25 doub N N 179 IJM C07 H071 sing N N 180 IJM C08 H081 sing N N 181 IJM C15 H151 sing N N 182 IJM C21 H211 sing N N 183 IJM N04 H041 sing N N 184 IJM N14 H141 sing N N 185 IJM O01 H1 sing N N 186 IJM O23 H2 sing N N 187 ILE N CA sing N N 188 ILE N H sing N N 189 ILE N H2 sing N N 190 ILE CA C sing N N 191 ILE CA CB sing N N 192 ILE CA HA sing N N 193 ILE C O doub N N 194 ILE C OXT sing N N 195 ILE CB CG1 sing N N 196 ILE CB CG2 sing N N 197 ILE CB HB sing N N 198 ILE CG1 CD1 sing N N 199 ILE CG1 HG12 sing N N 200 ILE CG1 HG13 sing N N 201 ILE CG2 HG21 sing N N 202 ILE CG2 HG22 sing N N 203 ILE CG2 HG23 sing N N 204 ILE CD1 HD11 sing N N 205 ILE CD1 HD12 sing N N 206 ILE CD1 HD13 sing N N 207 ILE OXT HXT sing N N 208 LEU N CA sing N N 209 LEU N H sing N N 210 LEU N H2 sing N N 211 LEU CA C sing N N 212 LEU CA CB sing N N 213 LEU CA HA sing N N 214 LEU C O doub N N 215 LEU C OXT sing N N 216 LEU CB CG sing N N 217 LEU CB HB2 sing N N 218 LEU CB HB3 sing N N 219 LEU CG CD1 sing N N 220 LEU CG CD2 sing N N 221 LEU CG HG sing N N 222 LEU CD1 HD11 sing N N 223 LEU CD1 HD12 sing N N 224 LEU CD1 HD13 sing N N 225 LEU CD2 HD21 sing N N 226 LEU CD2 HD22 sing N N 227 LEU CD2 HD23 sing N N 228 LEU OXT HXT sing N N 229 LYS N CA sing N N 230 LYS N H sing N N 231 LYS N H2 sing N N 232 LYS CA C sing N N 233 LYS CA CB sing N N 234 LYS CA HA sing N N 235 LYS C O doub N N 236 LYS C OXT sing N N 237 LYS CB CG sing N N 238 LYS CB HB2 sing N N 239 LYS CB HB3 sing N N 240 LYS CG CD sing N N 241 LYS CG HG2 sing N N 242 LYS CG HG3 sing N N 243 LYS CD CE sing N N 244 LYS CD HD2 sing N N 245 LYS CD HD3 sing N N 246 LYS CE NZ sing N N 247 LYS CE HE2 sing N N 248 LYS CE HE3 sing N N 249 LYS NZ HZ1 sing N N 250 LYS NZ HZ2 sing N N 251 LYS NZ HZ3 sing N N 252 LYS OXT HXT sing N N 253 MET N CA sing N N 254 MET N H sing N N 255 MET N H2 sing N N 256 MET CA C sing N N 257 MET CA CB sing N N 258 MET CA HA sing N N 259 MET C O doub N N 260 MET C OXT sing N N 261 MET CB CG sing N N 262 MET CB HB2 sing N N 263 MET CB HB3 sing N N 264 MET CG SD sing N N 265 MET CG HG2 sing N N 266 MET CG HG3 sing N N 267 MET SD CE sing N N 268 MET CE HE1 sing N N 269 MET CE HE2 sing N N 270 MET CE HE3 sing N N 271 MET OXT HXT sing N N 272 PHE N CA sing N N 273 PHE N H sing N N 274 PHE N H2 sing N N 275 PHE CA C sing N N 276 PHE CA CB sing N N 277 PHE CA HA sing N N 278 PHE C O doub N N 279 PHE C OXT sing N N 280 PHE CB CG sing N N 281 PHE CB HB2 sing N N 282 PHE CB HB3 sing N N 283 PHE CG CD1 doub Y N 284 PHE CG CD2 sing Y N 285 PHE CD1 CE1 sing Y N 286 PHE CD1 HD1 sing N N 287 PHE CD2 CE2 doub Y N 288 PHE CD2 HD2 sing N N 289 PHE CE1 CZ doub Y N 290 PHE CE1 HE1 sing N N 291 PHE CE2 CZ sing Y N 292 PHE CE2 HE2 sing N N 293 PHE CZ HZ sing N N 294 PHE OXT HXT sing N N 295 PRO N CA sing N N 296 PRO N CD sing N N 297 PRO N H sing N N 298 PRO CA C sing N N 299 PRO CA CB sing N N 300 PRO CA HA sing N N 301 PRO C O doub N N 302 PRO C OXT sing N N 303 PRO CB CG sing N N 304 PRO CB HB2 sing N N 305 PRO CB HB3 sing N N 306 PRO CG CD sing N N 307 PRO CG HG2 sing N N 308 PRO CG HG3 sing N N 309 PRO CD HD2 sing N N 310 PRO CD HD3 sing N N 311 PRO OXT HXT sing N N 312 SER N CA sing N N 313 SER N H sing N N 314 SER N H2 sing N N 315 SER CA C sing N N 316 SER CA CB sing N N 317 SER CA HA sing N N 318 SER C O doub N N 319 SER C OXT sing N N 320 SER CB OG sing N N 321 SER CB HB2 sing N N 322 SER CB HB3 sing N N 323 SER OG HG sing N N 324 SER OXT HXT sing N N 325 THR N CA sing N N 326 THR N H sing N N 327 THR N H2 sing N N 328 THR CA C sing N N 329 THR CA CB sing N N 330 THR CA HA sing N N 331 THR C O doub N N 332 THR C OXT sing N N 333 THR CB OG1 sing N N 334 THR CB CG2 sing N N 335 THR CB HB sing N N 336 THR OG1 HG1 sing N N 337 THR CG2 HG21 sing N N 338 THR CG2 HG22 sing N N 339 THR CG2 HG23 sing N N 340 THR OXT HXT sing N N 341 TRP N CA sing N N 342 TRP N H sing N N 343 TRP N H2 sing N N 344 TRP CA C sing N N 345 TRP CA CB sing N N 346 TRP CA HA sing N N 347 TRP C O doub N N 348 TRP C OXT sing N N 349 TRP CB CG sing N N 350 TRP CB HB2 sing N N 351 TRP CB HB3 sing N N 352 TRP CG CD1 doub Y N 353 TRP CG CD2 sing Y N 354 TRP CD1 NE1 sing Y N 355 TRP CD1 HD1 sing N N 356 TRP CD2 CE2 doub Y N 357 TRP CD2 CE3 sing Y N 358 TRP NE1 CE2 sing Y N 359 TRP NE1 HE1 sing N N 360 TRP CE2 CZ2 sing Y N 361 TRP CE3 CZ3 doub Y N 362 TRP CE3 HE3 sing N N 363 TRP CZ2 CH2 doub Y N 364 TRP CZ2 HZ2 sing N N 365 TRP CZ3 CH2 sing Y N 366 TRP CZ3 HZ3 sing N N 367 TRP CH2 HH2 sing N N 368 TRP OXT HXT sing N N 369 TYR N CA sing N N 370 TYR N H sing N N 371 TYR N H2 sing N N 372 TYR CA C sing N N 373 TYR CA CB sing N N 374 TYR CA HA sing N N 375 TYR C O doub N N 376 TYR C OXT sing N N 377 TYR CB CG sing N N 378 TYR CB HB2 sing N N 379 TYR CB HB3 sing N N 380 TYR CG CD1 doub Y N 381 TYR CG CD2 sing Y N 382 TYR CD1 CE1 sing Y N 383 TYR CD1 HD1 sing N N 384 TYR CD2 CE2 doub Y N 385 TYR CD2 HD2 sing N N 386 TYR CE1 CZ doub Y N 387 TYR CE1 HE1 sing N N 388 TYR CE2 CZ sing Y N 389 TYR CE2 HE2 sing N N 390 TYR CZ OH sing N N 391 TYR OH HH sing N N 392 TYR OXT HXT sing N N 393 VAL N CA sing N N 394 VAL N H sing N N 395 VAL N H2 sing N N 396 VAL CA C sing N N 397 VAL CA CB sing N N 398 VAL CA HA sing N N 399 VAL C O doub N N 400 VAL C OXT sing N N 401 VAL CB CG1 sing N N 402 VAL CB CG2 sing N N 403 VAL CB HB sing N N 404 VAL CG1 HG11 sing N N 405 VAL CG1 HG12 sing N N 406 VAL CG1 HG13 sing N N 407 VAL CG2 HG21 sing N N 408 VAL CG2 HG22 sing N N 409 VAL CG2 HG23 sing N N 410 VAL OXT HXT sing N N 411 # _pdbx_audit_support.funding_organization 'National Institutes of Health/National Institute Of Allergy and Infectious Diseases (NIH/NIAID)' _pdbx_audit_support.country 'United States' _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id IJM _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id IJM _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 8DDB _pdbx_initial_refinement_model.details ? # _space_group.name_H-M_alt 'P 62 2 2' _space_group.name_Hall 'P 62 2 (x,y,z+1/3)' _space_group.IT_number 180 _space_group.crystal_system hexagonal _space_group.id 1 # _atom_sites.entry_id 8T6Z _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.013173 _atom_sites.fract_transf_matrix[1][2] 0.007605 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.015210 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.008290 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.scat_dispersion_real _atom_type.scat_dispersion_imag _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c _atom_type.scat_source _atom_type.scat_dispersion_source C ? ? 3.54356 2.42580 ? ? 25.62398 1.50364 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? F ? ? 4.90428 4.07044 ? ? 12.99538 1.63651 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? H ? ? 0.51345 0.48472 ? ? 24.73122 6.32584 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? MN ? ? 20.23591 4.67902 ? ? 2.76514 44.01191 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? N ? ? 4.01032 2.96436 ? ? 19.97189 1.75589 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O ? ? 4.49882 3.47563 ? ? 15.80542 1.70748 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O1- ? ? 5.12366 3.84317 ? ? 3.49406 27.47979 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? S ? ? 9.55732 6.39887 ? ? 1.23737 29.19336 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? # loop_