data_8TGF # _entry.id 8TGF # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.395 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 8TGF pdb_00008tgf 10.2210/pdb8tgf/pdb WWPDB D_1000275876 ? ? # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2024-07-17 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 8TGF _pdbx_database_status.recvd_initial_deposition_date 2023-07-12 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_contact_author.id 2 _pdbx_contact_author.email calvin.yip@ubc.ca _pdbx_contact_author.name_first Calvin _pdbx_contact_author.name_last Yip _pdbx_contact_author.name_mi K. _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0003-1779-9501 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Cheung, Y.W.S.' 1 0000-0001-9698-8479 'Yip, C.K.' 2 0000-0003-1779-9501 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To be published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title ;Molecular basis of the mode of interaction between the tandem LC3-interacting region motif of the autophagy tethering factor EPG5 and ATG8 proteins ; _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Cheung, Y.W.S.' 1 0000-0001-9698-8479 primary 'Fairlie, G.' 2 ? primary 'Scheu, K.' 3 ? primary 'Yip, C.K.' 4 0000-0003-1779-9501 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Protein lgg-1' 14933.061 1 ? ? ? ? 2 polymer syn 'Ectopic P granules protein 5' 1279.265 1 ? ? ? ? 3 non-polymer syn 'ACETATE ION' 59.044 1 ? ? ? ? 4 water nat water 18.015 65 ? ? ? ? # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no ;GSMKWAYKEENNFEKRRAEGDKIRRKYPDRIPVIVEKAPKSKLHDLDKKKYLVPSDLTVGQFYFLIRKRIQLRPEDALFF FVNNVIPQTMTTMGQLYQDHHEEDLFLYIAYSDESVYGGEVEKKE ; ;GSMKWAYKEENNFEKRRAEGDKIRRKYPDRIPVIVEKAPKSKLHDLDKKKYLVPSDLTVGQFYFLIRKRIQLRPEDALFF FVNNVIPQTMTTMGQLYQDHHEEDLFLYIAYSDESVYGGEVEKKE ; A ? 2 'polypeptide(L)' no no STWEILADDDD STWEILADDDD B ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 3 'ACETATE ION' ACT 4 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 MET n 1 4 LYS n 1 5 TRP n 1 6 ALA n 1 7 TYR n 1 8 LYS n 1 9 GLU n 1 10 GLU n 1 11 ASN n 1 12 ASN n 1 13 PHE n 1 14 GLU n 1 15 LYS n 1 16 ARG n 1 17 ARG n 1 18 ALA n 1 19 GLU n 1 20 GLY n 1 21 ASP n 1 22 LYS n 1 23 ILE n 1 24 ARG n 1 25 ARG n 1 26 LYS n 1 27 TYR n 1 28 PRO n 1 29 ASP n 1 30 ARG n 1 31 ILE n 1 32 PRO n 1 33 VAL n 1 34 ILE n 1 35 VAL n 1 36 GLU n 1 37 LYS n 1 38 ALA n 1 39 PRO n 1 40 LYS n 1 41 SER n 1 42 LYS n 1 43 LEU n 1 44 HIS n 1 45 ASP n 1 46 LEU n 1 47 ASP n 1 48 LYS n 1 49 LYS n 1 50 LYS n 1 51 TYR n 1 52 LEU n 1 53 VAL n 1 54 PRO n 1 55 SER n 1 56 ASP n 1 57 LEU n 1 58 THR n 1 59 VAL n 1 60 GLY n 1 61 GLN n 1 62 PHE n 1 63 TYR n 1 64 PHE n 1 65 LEU n 1 66 ILE n 1 67 ARG n 1 68 LYS n 1 69 ARG n 1 70 ILE n 1 71 GLN n 1 72 LEU n 1 73 ARG n 1 74 PRO n 1 75 GLU n 1 76 ASP n 1 77 ALA n 1 78 LEU n 1 79 PHE n 1 80 PHE n 1 81 PHE n 1 82 VAL n 1 83 ASN n 1 84 ASN n 1 85 VAL n 1 86 ILE n 1 87 PRO n 1 88 GLN n 1 89 THR n 1 90 MET n 1 91 THR n 1 92 THR n 1 93 MET n 1 94 GLY n 1 95 GLN n 1 96 LEU n 1 97 TYR n 1 98 GLN n 1 99 ASP n 1 100 HIS n 1 101 HIS n 1 102 GLU n 1 103 GLU n 1 104 ASP n 1 105 LEU n 1 106 PHE n 1 107 LEU n 1 108 TYR n 1 109 ILE n 1 110 ALA n 1 111 TYR n 1 112 SER n 1 113 ASP n 1 114 GLU n 1 115 SER n 1 116 VAL n 1 117 TYR n 1 118 GLY n 1 119 GLY n 1 120 GLU n 1 121 VAL n 1 122 GLU n 1 123 LYS n 1 124 LYS n 1 125 GLU n 2 1 SER n 2 2 THR n 2 3 TRP n 2 4 GLU n 2 5 ILE n 2 6 LEU n 2 7 ALA n 2 8 ASP n 2 9 ASP n 2 10 ASP n 2 11 ASP n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 125 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'lgg-1, atg-8.1, C32D5.9' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Caenorhabditis elegans' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 6239 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _pdbx_entity_src_syn.entity_id 2 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num 1 _pdbx_entity_src_syn.pdbx_end_seq_num 11 _pdbx_entity_src_syn.organism_scientific 'Caenorhabditis elegans' _pdbx_entity_src_syn.organism_common_name ? _pdbx_entity_src_syn.ncbi_taxonomy_id 6239 _pdbx_entity_src_syn.details ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ACT non-polymer . 'ACETATE ION' ? 'C2 H3 O2 -1' 59.044 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 -1 ? ? ? A . n A 1 2 SER 2 0 ? ? ? A . n A 1 3 MET 3 1 1 MET MET A . n A 1 4 LYS 4 2 2 LYS LYS A . n A 1 5 TRP 5 3 3 TRP TRP A . n A 1 6 ALA 6 4 4 ALA ALA A . n A 1 7 TYR 7 5 5 TYR TYR A . n A 1 8 LYS 8 6 6 LYS LYS A . n A 1 9 GLU 9 7 7 GLU GLU A . n A 1 10 GLU 10 8 8 GLU GLU A . n A 1 11 ASN 11 9 9 ASN ASN A . n A 1 12 ASN 12 10 10 ASN ASN A . n A 1 13 PHE 13 11 11 PHE PHE A . n A 1 14 GLU 14 12 12 GLU GLU A . n A 1 15 LYS 15 13 13 LYS LYS A . n A 1 16 ARG 16 14 14 ARG ARG A . n A 1 17 ARG 17 15 15 ARG ARG A . n A 1 18 ALA 18 16 16 ALA ALA A . n A 1 19 GLU 19 17 17 GLU GLU A . n A 1 20 GLY 20 18 18 GLY GLY A . n A 1 21 ASP 21 19 19 ASP ASP A . n A 1 22 LYS 22 20 20 LYS LYS A . n A 1 23 ILE 23 21 21 ILE ILE A . n A 1 24 ARG 24 22 22 ARG ARG A . n A 1 25 ARG 25 23 23 ARG ARG A . n A 1 26 LYS 26 24 24 LYS LYS A . n A 1 27 TYR 27 25 25 TYR TYR A . n A 1 28 PRO 28 26 26 PRO PRO A . n A 1 29 ASP 29 27 27 ASP ASP A . n A 1 30 ARG 30 28 28 ARG ARG A . n A 1 31 ILE 31 29 29 ILE ILE A . n A 1 32 PRO 32 30 30 PRO PRO A . n A 1 33 VAL 33 31 31 VAL VAL A . n A 1 34 ILE 34 32 32 ILE ILE A . n A 1 35 VAL 35 33 33 VAL VAL A . n A 1 36 GLU 36 34 34 GLU GLU A . n A 1 37 LYS 37 35 35 LYS LYS A . n A 1 38 ALA 38 36 36 ALA ALA A . n A 1 39 PRO 39 37 37 PRO PRO A . n A 1 40 LYS 40 38 38 LYS LYS A . n A 1 41 SER 41 39 39 SER SER A . n A 1 42 LYS 42 40 40 LYS LYS A . n A 1 43 LEU 43 41 41 LEU LEU A . n A 1 44 HIS 44 42 42 HIS HIS A . n A 1 45 ASP 45 43 43 ASP ASP A . n A 1 46 LEU 46 44 44 LEU LEU A . n A 1 47 ASP 47 45 45 ASP ASP A . n A 1 48 LYS 48 46 46 LYS LYS A . n A 1 49 LYS 49 47 47 LYS LYS A . n A 1 50 LYS 50 48 48 LYS LYS A . n A 1 51 TYR 51 49 49 TYR TYR A . n A 1 52 LEU 52 50 50 LEU LEU A . n A 1 53 VAL 53 51 51 VAL VAL A . n A 1 54 PRO 54 52 52 PRO PRO A . n A 1 55 SER 55 53 53 SER SER A . n A 1 56 ASP 56 54 54 ASP ASP A . n A 1 57 LEU 57 55 55 LEU LEU A . n A 1 58 THR 58 56 56 THR THR A . n A 1 59 VAL 59 57 57 VAL VAL A . n A 1 60 GLY 60 58 58 GLY GLY A . n A 1 61 GLN 61 59 59 GLN GLN A . n A 1 62 PHE 62 60 60 PHE PHE A . n A 1 63 TYR 63 61 61 TYR TYR A . n A 1 64 PHE 64 62 62 PHE PHE A . n A 1 65 LEU 65 63 63 LEU LEU A . n A 1 66 ILE 66 64 64 ILE ILE A . n A 1 67 ARG 67 65 65 ARG ARG A . n A 1 68 LYS 68 66 66 LYS LYS A . n A 1 69 ARG 69 67 67 ARG ARG A . n A 1 70 ILE 70 68 68 ILE ILE A . n A 1 71 GLN 71 69 69 GLN GLN A . n A 1 72 LEU 72 70 ? ? ? A . n A 1 73 ARG 73 71 ? ? ? A . n A 1 74 PRO 74 72 ? ? ? A . n A 1 75 GLU 75 73 73 GLU GLU A . n A 1 76 ASP 76 74 74 ASP ASP A . n A 1 77 ALA 77 75 75 ALA ALA A . n A 1 78 LEU 78 76 76 LEU LEU A . n A 1 79 PHE 79 77 77 PHE PHE A . n A 1 80 PHE 80 78 78 PHE PHE A . n A 1 81 PHE 81 79 79 PHE PHE A . n A 1 82 VAL 82 80 80 VAL VAL A . n A 1 83 ASN 83 81 81 ASN ASN A . n A 1 84 ASN 84 82 82 ASN ASN A . n A 1 85 VAL 85 83 83 VAL VAL A . n A 1 86 ILE 86 84 84 ILE ILE A . n A 1 87 PRO 87 85 85 PRO PRO A . n A 1 88 GLN 88 86 86 GLN GLN A . n A 1 89 THR 89 87 87 THR THR A . n A 1 90 MET 90 88 88 MET MET A . n A 1 91 THR 91 89 89 THR THR A . n A 1 92 THR 92 90 90 THR THR A . n A 1 93 MET 93 91 91 MET MET A . n A 1 94 GLY 94 92 92 GLY GLY A . n A 1 95 GLN 95 93 93 GLN GLN A . n A 1 96 LEU 96 94 94 LEU LEU A . n A 1 97 TYR 97 95 95 TYR TYR A . n A 1 98 GLN 98 96 96 GLN GLN A . n A 1 99 ASP 99 97 97 ASP ASP A . n A 1 100 HIS 100 98 98 HIS HIS A . n A 1 101 HIS 101 99 99 HIS HIS A . n A 1 102 GLU 102 100 100 GLU GLU A . n A 1 103 GLU 103 101 101 GLU GLU A . n A 1 104 ASP 104 102 102 ASP ASP A . n A 1 105 LEU 105 103 103 LEU LEU A . n A 1 106 PHE 106 104 104 PHE PHE A . n A 1 107 LEU 107 105 105 LEU LEU A . n A 1 108 TYR 108 106 106 TYR TYR A . n A 1 109 ILE 109 107 107 ILE ILE A . n A 1 110 ALA 110 108 108 ALA ALA A . n A 1 111 TYR 111 109 109 TYR TYR A . n A 1 112 SER 112 110 110 SER SER A . n A 1 113 ASP 113 111 111 ASP ASP A . n A 1 114 GLU 114 112 112 GLU GLU A . n A 1 115 SER 115 113 113 SER SER A . n A 1 116 VAL 116 114 ? ? ? A . n A 1 117 TYR 117 115 ? ? ? A . n A 1 118 GLY 118 116 ? ? ? A . n A 1 119 GLY 119 117 ? ? ? A . n A 1 120 GLU 120 118 ? ? ? A . n A 1 121 VAL 121 119 ? ? ? A . n A 1 122 GLU 122 120 ? ? ? A . n A 1 123 LYS 123 121 ? ? ? A . n A 1 124 LYS 124 122 ? ? ? A . n A 1 125 GLU 125 123 ? ? ? A . n B 2 1 SER 1 505 505 SER SER B . n B 2 2 THR 2 506 506 THR THR B . n B 2 3 TRP 3 507 507 TRP TRP B . n B 2 4 GLU 4 508 508 GLU GLU B . n B 2 5 ILE 5 509 509 ILE ILE B . n B 2 6 LEU 6 510 510 LEU LEU B . n B 2 7 ALA 7 511 511 ALA ALA B . n B 2 8 ASP 8 512 512 ASP ASP B . n B 2 9 ASP 9 513 513 ASP ASP B . n B 2 10 ASP 10 514 ? ? ? B . n B 2 11 ASP 11 515 ? ? ? B . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 3 ACT 1 201 1 ACT ACT A . D 4 HOH 1 301 69 HOH HOH A . D 4 HOH 2 302 43 HOH HOH A . D 4 HOH 3 303 36 HOH HOH A . D 4 HOH 4 304 30 HOH HOH A . D 4 HOH 5 305 65 HOH HOH A . D 4 HOH 6 306 55 HOH HOH A . D 4 HOH 7 307 21 HOH HOH A . D 4 HOH 8 308 8 HOH HOH A . D 4 HOH 9 309 25 HOH HOH A . D 4 HOH 10 310 24 HOH HOH A . D 4 HOH 11 311 64 HOH HOH A . D 4 HOH 12 312 23 HOH HOH A . D 4 HOH 13 313 9 HOH HOH A . D 4 HOH 14 314 2 HOH HOH A . D 4 HOH 15 315 13 HOH HOH A . D 4 HOH 16 316 26 HOH HOH A . D 4 HOH 17 317 5 HOH HOH A . D 4 HOH 18 318 47 HOH HOH A . D 4 HOH 19 319 6 HOH HOH A . D 4 HOH 20 320 11 HOH HOH A . D 4 HOH 21 321 1 HOH HOH A . D 4 HOH 22 322 57 HOH HOH A . D 4 HOH 23 323 61 HOH HOH A . D 4 HOH 24 324 3 HOH HOH A . D 4 HOH 25 325 62 HOH HOH A . D 4 HOH 26 326 19 HOH HOH A . D 4 HOH 27 327 32 HOH HOH A . D 4 HOH 28 328 68 HOH HOH A . D 4 HOH 29 329 42 HOH HOH A . D 4 HOH 30 330 4 HOH HOH A . D 4 HOH 31 331 67 HOH HOH A . D 4 HOH 32 332 48 HOH HOH A . D 4 HOH 33 333 12 HOH HOH A . D 4 HOH 34 334 45 HOH HOH A . D 4 HOH 35 335 66 HOH HOH A . D 4 HOH 36 336 7 HOH HOH A . D 4 HOH 37 337 28 HOH HOH A . D 4 HOH 38 338 29 HOH HOH A . D 4 HOH 39 339 38 HOH HOH A . D 4 HOH 40 340 16 HOH HOH A . D 4 HOH 41 341 46 HOH HOH A . D 4 HOH 42 342 49 HOH HOH A . D 4 HOH 43 343 44 HOH HOH A . D 4 HOH 44 344 54 HOH HOH A . D 4 HOH 45 345 63 HOH HOH A . D 4 HOH 46 346 17 HOH HOH A . D 4 HOH 47 347 33 HOH HOH A . D 4 HOH 48 348 52 HOH HOH A . D 4 HOH 49 349 56 HOH HOH A . D 4 HOH 50 350 34 HOH HOH A . D 4 HOH 51 351 58 HOH HOH A . D 4 HOH 52 352 39 HOH HOH A . D 4 HOH 53 353 60 HOH HOH A . D 4 HOH 54 354 41 HOH HOH A . D 4 HOH 55 355 50 HOH HOH A . E 4 HOH 1 601 27 HOH HOH B . E 4 HOH 2 602 15 HOH HOH B . E 4 HOH 3 603 53 HOH HOH B . E 4 HOH 4 604 10 HOH HOH B . E 4 HOH 5 605 14 HOH HOH B . E 4 HOH 6 606 22 HOH HOH B . E 4 HOH 7 607 37 HOH HOH B . E 4 HOH 8 608 20 HOH HOH B . E 4 HOH 9 609 59 HOH HOH B . E 4 HOH 10 610 35 HOH HOH B . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A HIS 42 ? CG ? A HIS 44 CG 2 1 Y 1 A HIS 42 ? ND1 ? A HIS 44 ND1 3 1 Y 1 A HIS 42 ? CD2 ? A HIS 44 CD2 4 1 Y 1 A HIS 42 ? CE1 ? A HIS 44 CE1 5 1 Y 1 A HIS 42 ? NE2 ? A HIS 44 NE2 6 1 Y 1 A GLU 73 ? CG ? A GLU 75 CG 7 1 Y 1 A GLU 73 ? CD ? A GLU 75 CD 8 1 Y 1 A GLU 73 ? OE1 ? A GLU 75 OE1 9 1 Y 1 A GLU 73 ? OE2 ? A GLU 75 OE2 # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? DIALS ? ? ? . 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? 0.7.9 2 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? 2.8.2 3 ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.14_3260 4 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 100.102 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 8TGF _cell.details ? _cell.formula_units_Z ? _cell.length_a 33.991 _cell.length_a_esd ? _cell.length_b 37.952 _cell.length_b_esd ? _cell.length_c 45.177 _cell.length_c_esd ? _cell.volume 57376.086 _cell.volume_esd ? _cell.Z_PDB 2 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 8TGF _symmetry.cell_setting ? _symmetry.Int_Tables_number 4 _symmetry.space_group_name_Hall 'P 2yb' _symmetry.space_group_name_H-M 'P 1 21 1' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 8TGF _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 1.79 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 31.49 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 8.0 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.1 M sodium acetate pH 4.6, 21% (w/v) PEG 6000' _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 298 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2022-10-16 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.00 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'ALS BEAMLINE 5.0.2' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.00 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 5.0.2 _diffrn_source.pdbx_synchrotron_site ALS # _reflns.B_iso_Wilson_estimate 14.59 _reflns.entry_id 8TGF _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.60 _reflns.d_resolution_low 44.48 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 14650 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 96.93 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 3.3 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 25.12 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs 0.0364 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 1.60 _reflns_shell.d_res_low 1.657 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 1406 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.percent_possible_all ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.1156 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 22.52 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 8TGF _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.60 _refine.ls_d_res_low 44.48 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 14647 _refine.ls_number_reflns_R_free 724 _refine.ls_number_reflns_R_work 13923 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 96.94 _refine.ls_percent_reflns_R_free 4.94 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1762 _refine.ls_R_factor_R_free 0.2134 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1743 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.47 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 5AZF _refine.pdbx_stereochemistry_target_values 'CDL v1.2' _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 22.0927 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.1491 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 1.60 _refine_hist.d_res_low 44.48 _refine_hist.number_atoms_solvent 65 _refine_hist.number_atoms_total 1071 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 1002 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 4 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.0101 ? 1036 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 1.0902 ? 1393 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.0698 ? 146 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.0075 ? 178 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 2.6402 ? 872 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free _refine_ls_shell.R_factor_R_free 'X-RAY DIFFRACTION' 1.60 1.72 . . 136 2756 97.18 . . . . 0.1813 . . . . . . . . . . . 0.2295 'X-RAY DIFFRACTION' 1.72 1.90 . . 149 2790 97.54 . . . . 0.1742 . . . . . . . . . . . 0.2302 'X-RAY DIFFRACTION' 1.90 2.17 . . 156 2720 96.06 . . . . 0.1661 . . . . . . . . . . . 0.2110 'X-RAY DIFFRACTION' 2.17 2.74 . . 132 2783 96.56 . . . . 0.1795 . . . . . . . . . . . 0.2191 'X-RAY DIFFRACTION' 2.74 44.48 . . 151 2874 97.36 . . . . 0.1734 . . . . . . . . . . . 0.2047 # _struct.entry_id 8TGF _struct.title 'Crystal structure of cEPG5 LIR/LGG-1 complex' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 8TGF _struct_keywords.text 'SIGNALING PROTEIN' _struct_keywords.pdbx_keywords 'SIGNALING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? E N N 4 ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP LGG1_CAEEL Q09490 ? 1 ;MKWAYKEENNFEKRRAEGDKIRRKYPDRIPVIVEKAPKSKLHDLDKKKYLVPSDLTVGQFYFLIRKRIQLRPEDALFFFV NNVIPQTMTTMGQLYQDHHEEDLFLYIAYSDESVYGGEVEKKE ; 1 2 UNP EPG5_CAEEL Q18892 ? 2 STWEILADDDD 505 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 8TGF A 3 ? 125 ? Q09490 1 ? 123 ? 1 123 2 2 8TGF B 1 ? 11 ? Q18892 505 ? 515 ? 505 515 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 8TGF GLY A 1 ? UNP Q09490 ? ? 'expression tag' -1 1 1 8TGF SER A 2 ? UNP Q09490 ? ? 'expression tag' 0 2 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0 _pdbx_struct_oper_list.matrix[1][2] 0.0 _pdbx_struct_oper_list.matrix[1][3] 0.0 _pdbx_struct_oper_list.vector[1] 0.0 _pdbx_struct_oper_list.matrix[2][1] 0.0 _pdbx_struct_oper_list.matrix[2][2] 1.0 _pdbx_struct_oper_list.matrix[2][3] 0.0 _pdbx_struct_oper_list.vector[2] 0.0 _pdbx_struct_oper_list.matrix[3][1] 0.0 _pdbx_struct_oper_list.matrix[3][2] 0.0 _pdbx_struct_oper_list.matrix[3][3] 1.0 _pdbx_struct_oper_list.vector[3] 0.0 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 TRP A 5 ? ASN A 11 ? TRP A 3 ASN A 9 1 ? 7 HELX_P HELX_P2 AA2 ASN A 12 ? TYR A 27 ? ASN A 10 TYR A 25 1 ? 16 HELX_P HELX_P3 AA3 THR A 58 ? GLN A 71 ? THR A 56 GLN A 69 1 ? 14 HELX_P HELX_P4 AA4 THR A 92 ? HIS A 101 ? THR A 90 HIS A 99 1 ? 10 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? parallel AA1 3 4 ? anti-parallel AA1 4 5 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 PHE A 79 ? PHE A 81 ? PHE A 77 PHE A 79 AA1 2 LEU A 107 ? SER A 112 ? LEU A 105 SER A 110 AA1 3 ARG A 30 ? LYS A 37 ? ARG A 28 LYS A 35 AA1 4 LYS A 50 ? PRO A 54 ? LYS A 48 PRO A 52 AA1 5 GLU B 4 ? ILE B 5 ? GLU B 508 ILE B 509 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N PHE A 81 ? N PHE A 79 O ALA A 110 ? O ALA A 108 AA1 2 3 O LEU A 107 ? O LEU A 105 N ILE A 34 ? N ILE A 32 AA1 3 4 N ILE A 31 ? N ILE A 29 O VAL A 53 ? O VAL A 51 AA1 4 5 N LEU A 52 ? N LEU A 50 O GLU B 4 ? O GLU B 508 # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id ALA _pdbx_validate_torsion.auth_asym_id B _pdbx_validate_torsion.auth_seq_id 511 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi 75.28 _pdbx_validate_torsion.psi 145.62 # loop_ _space_group_symop.id _space_group_symop.operation_xyz 1 x,y,z 2 -x,y+1/2,-z # loop_ _pdbx_refine_tls.id _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[1][1]_esd _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][2]_esd _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[1][3]_esd _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[2][2]_esd _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.T[2][3]_esd _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[3][3]_esd _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[1][1]_esd _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][2]_esd _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[1][3]_esd _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[2][2]_esd _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.L[2][3]_esd _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[3][3]_esd _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][1]_esd _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][2]_esd _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[1][3]_esd _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][1]_esd _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][2]_esd _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[2][3]_esd _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][1]_esd _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][2]_esd _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.S[3][3]_esd 1 'X-RAY DIFFRACTION' ? refined 13.6094069815 2.71308955472 8.95489426179 0.0990898033278 ? -0.00708522175863 ? -0.00193304056668 ? 0.0527254604252 ? -0.00589836736181 ? 0.087267611651 ? 2.17727153718 ? -0.0240872748873 ? -0.0363506429527 ? 2.44772583851 ? -0.0262227882218 ? 2.59832559653 ? 0.0181722663387 ? -0.00216498585229 ? -0.201894310231 ? -0.00525567121074 ? 0.0153329684708 ? 0.129203408275 ? 0.219192124217 ? -0.106313915491 ? -0.0389958066864 ? 2 'X-RAY DIFFRACTION' ? refined 14.933422665 15.4539119206 20.6892308196 0.284066698772 ? -0.0315314168034 ? 0.044656796816 ? 0.139468226506 ? -0.0499828092141 ? 0.153800517351 ? 5.3351982118 ? -0.96751008405 ? -1.8654806129 ? 5.4125743399 ? 0.554151741323 ? 1.6107160325 ? -0.0137674789692 ? -0.394499287901 ? -0.026753871336 ? 0.298479267176 ? -0.0300418473696 ? -0.134123847085 ? -0.0150443695715 ? -0.0769420230072 ? 0.0274173340506 ? 3 'X-RAY DIFFRACTION' ? refined 15.1136485458 17.6998717012 5.1822685006 0.12288898302 ? -0.00900431436677 ? 0.00708370784918 ? 0.0764279140478 ? 0.0163339558461 ? 0.0815215645044 ? 1.38390554231 ? -1.06440470151 ? -1.48071639062 ? 4.79025103076 ? -0.923082021513 ? 4.20751683389 ? -0.0112391835609 ? 0.0404640260741 ? 0.0474629926332 ? -0.00416427015545 ? 0.120250211865 ? 0.190857183574 ? -0.26191179644 ? -0.192220721406 ? -0.0339886351119 ? 4 'X-RAY DIFFRACTION' ? refined 10.2537521346 9.79941421894 14.7183129304 0.130130069077 ? 0.0212761119817 ? 0.0306178588525 ? 0.112342577804 ? 0.00497266144237 ? 0.0720468759707 ? 3.16341864361 ? 1.42477812018 ? -0.0868334300857 ? 3.94943356116 ? 0.0891497256625 ? 2.19931690488 ? -0.0675718438115 ? -0.0946061163133 ? 0.411094640017 ? 0.167360358992 ? 0.045045166481 ? 0.215738564879 ? -0.246436245442 ? -0.203698922786 ? 0.0587351963941 ? 5 'X-RAY DIFFRACTION' ? refined 9.1900867277 2.91261907023 21.3715320134 0.347470714602 ? 0.0360191338267 ? 0.0501657863221 ? 0.119182935591 ? 0.0963185029241 ? 0.0669601032739 ? 0.851988462196 ? 0.247400995712 ? 0.56761732068 ? 2.99296287757 ? -0.857902759222 ? 4.89909141834 ? 0.0501460316585 ? -0.003241943042 ? 0.0981766102692 ? 0.469270685677 ? 0.0238992897993 ? 0.394921304139 ? -0.216279842245 ? -0.336366252128 ? -0.299118422597 ? 6 'X-RAY DIFFRACTION' ? refined 0.517190111811 2.23224103259 18.9217082588 0.242521248935 ? 0.0498350802043 ? 0.0775781343041 ? 0.48828853334 ? 0.108079201632 ? 0.388182562391 ? 1.32326096777 ? 0.308434562991 ? -0.0959438017905 ? 0.35278905414 ? -0.492280019987 ? 1.01903432043 ? -0.0459957656783 ? -0.661396854004 ? -0.0063050185284 ? 0.539062847909 ? 0.0493462158482 ? 0.733850377147 ? -0.123262412657 ? -0.756402605618 ? 0.0131197774208 ? # loop_ _pdbx_refine_tls_group.id _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.beg_PDB_ins_code _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.end_PDB_ins_code _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 1 'X-RAY DIFFRACTION' 1 ? ? ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 78 through 113 ) ; 2 'X-RAY DIFFRACTION' 2 ? ? ? ? ? ? ? ? ? ? ? ;chain 'B' and (resid 505 through 513 ) ; 3 'X-RAY DIFFRACTION' 3 ? ? ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 1 through 24 ) ; 4 'X-RAY DIFFRACTION' 4 ? ? ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 25 through 56 ) ; 5 'X-RAY DIFFRACTION' 5 ? ? ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 57 through 66 ) ; 6 'X-RAY DIFFRACTION' 6 ? ? ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 67 through 77 ) ; # _pdbx_entry_details.entry_id 8TGF _pdbx_entry_details.has_ligand_of_interest N _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY -1 ? A GLY 1 2 1 Y 1 A SER 0 ? A SER 2 3 1 Y 1 A LEU 70 ? A LEU 72 4 1 Y 1 A ARG 71 ? A ARG 73 5 1 Y 1 A PRO 72 ? A PRO 74 6 1 Y 1 A VAL 114 ? A VAL 116 7 1 Y 1 A TYR 115 ? A TYR 117 8 1 Y 1 A GLY 116 ? A GLY 118 9 1 Y 1 A GLY 117 ? A GLY 119 10 1 Y 1 A GLU 118 ? A GLU 120 11 1 Y 1 A VAL 119 ? A VAL 121 12 1 Y 1 A GLU 120 ? A GLU 122 13 1 Y 1 A LYS 121 ? A LYS 123 14 1 Y 1 A LYS 122 ? A LYS 124 15 1 Y 1 A GLU 123 ? A GLU 125 16 1 Y 1 B ASP 514 ? B ASP 10 17 1 Y 1 B ASP 515 ? B ASP 11 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ACT C C N N 1 ACT O O N N 2 ACT OXT O N N 3 ACT CH3 C N N 4 ACT H1 H N N 5 ACT H2 H N N 6 ACT H3 H N N 7 ALA N N N N 8 ALA CA C N S 9 ALA C C N N 10 ALA O O N N 11 ALA CB C N N 12 ALA OXT O N N 13 ALA H H N N 14 ALA H2 H N N 15 ALA HA H N N 16 ALA HB1 H N N 17 ALA HB2 H N N 18 ALA HB3 H N N 19 ALA HXT H N N 20 ARG N N N N 21 ARG CA C N S 22 ARG C C N N 23 ARG O O N N 24 ARG CB C N N 25 ARG CG C N N 26 ARG CD C N N 27 ARG NE N N N 28 ARG CZ C N N 29 ARG NH1 N N N 30 ARG NH2 N N N 31 ARG OXT O N N 32 ARG H H N N 33 ARG H2 H N N 34 ARG HA H N N 35 ARG HB2 H N N 36 ARG HB3 H N N 37 ARG HG2 H N N 38 ARG HG3 H N N 39 ARG HD2 H N N 40 ARG HD3 H N N 41 ARG HE H N N 42 ARG HH11 H N N 43 ARG HH12 H N N 44 ARG HH21 H N N 45 ARG HH22 H N N 46 ARG HXT H N N 47 ASN N N N N 48 ASN CA C N S 49 ASN C C N N 50 ASN O O N N 51 ASN CB C N N 52 ASN CG C N N 53 ASN OD1 O N N 54 ASN ND2 N N N 55 ASN OXT O N N 56 ASN H H N N 57 ASN H2 H N N 58 ASN HA H N N 59 ASN HB2 H N N 60 ASN HB3 H N N 61 ASN HD21 H N N 62 ASN HD22 H N N 63 ASN HXT H N N 64 ASP N N N N 65 ASP CA C N S 66 ASP C C N N 67 ASP O O N N 68 ASP CB C N N 69 ASP CG C N N 70 ASP OD1 O N N 71 ASP OD2 O N N 72 ASP OXT O N N 73 ASP H H N N 74 ASP H2 H N N 75 ASP HA H N N 76 ASP HB2 H N N 77 ASP HB3 H N N 78 ASP HD2 H N N 79 ASP HXT H N N 80 GLN N N N N 81 GLN CA C N S 82 GLN C C N N 83 GLN O O N N 84 GLN CB C N N 85 GLN CG C N N 86 GLN CD C N N 87 GLN OE1 O N N 88 GLN NE2 N N N 89 GLN OXT O N N 90 GLN H H N N 91 GLN H2 H N N 92 GLN HA H N N 93 GLN HB2 H N N 94 GLN HB3 H N N 95 GLN HG2 H N N 96 GLN HG3 H N N 97 GLN HE21 H N N 98 GLN HE22 H N N 99 GLN HXT H N N 100 GLU N N N N 101 GLU CA C N S 102 GLU C C N N 103 GLU O O N N 104 GLU CB C N N 105 GLU CG C N N 106 GLU CD C N N 107 GLU OE1 O N N 108 GLU OE2 O N N 109 GLU OXT O N N 110 GLU H H N N 111 GLU H2 H N N 112 GLU HA H N N 113 GLU HB2 H N N 114 GLU HB3 H N N 115 GLU HG2 H N N 116 GLU HG3 H N N 117 GLU HE2 H N N 118 GLU HXT H N N 119 GLY N N N N 120 GLY CA C N N 121 GLY C C N N 122 GLY O O N N 123 GLY OXT O N N 124 GLY H H N N 125 GLY H2 H N N 126 GLY HA2 H N N 127 GLY HA3 H N N 128 GLY HXT H N N 129 HIS N N N N 130 HIS CA C N S 131 HIS C C N N 132 HIS O O N N 133 HIS CB C N N 134 HIS CG C Y N 135 HIS ND1 N Y N 136 HIS CD2 C Y N 137 HIS CE1 C Y N 138 HIS NE2 N Y N 139 HIS OXT O N N 140 HIS H H N N 141 HIS H2 H N N 142 HIS HA H N N 143 HIS HB2 H N N 144 HIS HB3 H N N 145 HIS HD1 H N N 146 HIS HD2 H N N 147 HIS HE1 H N N 148 HIS HE2 H N N 149 HIS HXT H N N 150 HOH O O N N 151 HOH H1 H N N 152 HOH H2 H N N 153 ILE N N N N 154 ILE CA C N S 155 ILE C C N N 156 ILE O O N N 157 ILE CB C N S 158 ILE CG1 C N N 159 ILE CG2 C N N 160 ILE CD1 C N N 161 ILE OXT O N N 162 ILE H H N N 163 ILE H2 H N N 164 ILE HA H N N 165 ILE HB H N N 166 ILE HG12 H N N 167 ILE HG13 H N N 168 ILE HG21 H N N 169 ILE HG22 H N N 170 ILE HG23 H N N 171 ILE HD11 H N N 172 ILE HD12 H N N 173 ILE HD13 H N N 174 ILE HXT H N N 175 LEU N N N N 176 LEU CA C N S 177 LEU C C N N 178 LEU O O N N 179 LEU CB C N N 180 LEU CG C N N 181 LEU CD1 C N N 182 LEU CD2 C N N 183 LEU OXT O N N 184 LEU H H N N 185 LEU H2 H N N 186 LEU HA H N N 187 LEU HB2 H N N 188 LEU HB3 H N N 189 LEU HG H N N 190 LEU HD11 H N N 191 LEU HD12 H N N 192 LEU HD13 H N N 193 LEU HD21 H N N 194 LEU HD22 H N N 195 LEU HD23 H N N 196 LEU HXT H N N 197 LYS N N N N 198 LYS CA C N S 199 LYS C C N N 200 LYS O O N N 201 LYS CB C N N 202 LYS CG C N N 203 LYS CD C N N 204 LYS CE C N N 205 LYS NZ N N N 206 LYS OXT O N N 207 LYS H H N N 208 LYS H2 H N N 209 LYS HA H N N 210 LYS HB2 H N N 211 LYS HB3 H N N 212 LYS HG2 H N N 213 LYS HG3 H N N 214 LYS HD2 H N N 215 LYS HD3 H N N 216 LYS HE2 H N N 217 LYS HE3 H N N 218 LYS HZ1 H N N 219 LYS HZ2 H N N 220 LYS HZ3 H N N 221 LYS HXT H N N 222 MET N N N N 223 MET CA C N S 224 MET C C N N 225 MET O O N N 226 MET CB C N N 227 MET CG C N N 228 MET SD S N N 229 MET CE C N N 230 MET OXT O N N 231 MET H H N N 232 MET H2 H N N 233 MET HA H N N 234 MET HB2 H N N 235 MET HB3 H N N 236 MET HG2 H N N 237 MET HG3 H N N 238 MET HE1 H N N 239 MET HE2 H N N 240 MET HE3 H N N 241 MET HXT H N N 242 PHE N N N N 243 PHE CA C N S 244 PHE C C N N 245 PHE O O N N 246 PHE CB C N N 247 PHE CG C Y N 248 PHE CD1 C Y N 249 PHE CD2 C Y N 250 PHE CE1 C Y N 251 PHE CE2 C Y N 252 PHE CZ C Y N 253 PHE OXT O N N 254 PHE H H N N 255 PHE H2 H N N 256 PHE HA H N N 257 PHE HB2 H N N 258 PHE HB3 H N N 259 PHE HD1 H N N 260 PHE HD2 H N N 261 PHE HE1 H N N 262 PHE HE2 H N N 263 PHE HZ H N N 264 PHE HXT H N N 265 PRO N N N N 266 PRO CA C N S 267 PRO C C N N 268 PRO O O N N 269 PRO CB C N N 270 PRO CG C N N 271 PRO CD C N N 272 PRO OXT O N N 273 PRO H H N N 274 PRO HA H N N 275 PRO HB2 H N N 276 PRO HB3 H N N 277 PRO HG2 H N N 278 PRO HG3 H N N 279 PRO HD2 H N N 280 PRO HD3 H N N 281 PRO HXT H N N 282 SER N N N N 283 SER CA C N S 284 SER C C N N 285 SER O O N N 286 SER CB C N N 287 SER OG O N N 288 SER OXT O N N 289 SER H H N N 290 SER H2 H N N 291 SER HA H N N 292 SER HB2 H N N 293 SER HB3 H N N 294 SER HG H N N 295 SER HXT H N N 296 THR N N N N 297 THR CA C N S 298 THR C C N N 299 THR O O N N 300 THR CB C N R 301 THR OG1 O N N 302 THR CG2 C N N 303 THR OXT O N N 304 THR H H N N 305 THR H2 H N N 306 THR HA H N N 307 THR HB H N N 308 THR HG1 H N N 309 THR HG21 H N N 310 THR HG22 H N N 311 THR HG23 H N N 312 THR HXT H N N 313 TRP N N N N 314 TRP CA C N S 315 TRP C C N N 316 TRP O O N N 317 TRP CB C N N 318 TRP CG C Y N 319 TRP CD1 C Y N 320 TRP CD2 C Y N 321 TRP NE1 N Y N 322 TRP CE2 C Y N 323 TRP CE3 C Y N 324 TRP CZ2 C Y N 325 TRP CZ3 C Y N 326 TRP CH2 C Y N 327 TRP OXT O N N 328 TRP H H N N 329 TRP H2 H N N 330 TRP HA H N N 331 TRP HB2 H N N 332 TRP HB3 H N N 333 TRP HD1 H N N 334 TRP HE1 H N N 335 TRP HE3 H N N 336 TRP HZ2 H N N 337 TRP HZ3 H N N 338 TRP HH2 H N N 339 TRP HXT H N N 340 TYR N N N N 341 TYR CA C N S 342 TYR C C N N 343 TYR O O N N 344 TYR CB C N N 345 TYR CG C Y N 346 TYR CD1 C Y N 347 TYR CD2 C Y N 348 TYR CE1 C Y N 349 TYR CE2 C Y N 350 TYR CZ C Y N 351 TYR OH O N N 352 TYR OXT O N N 353 TYR H H N N 354 TYR H2 H N N 355 TYR HA H N N 356 TYR HB2 H N N 357 TYR HB3 H N N 358 TYR HD1 H N N 359 TYR HD2 H N N 360 TYR HE1 H N N 361 TYR HE2 H N N 362 TYR HH H N N 363 TYR HXT H N N 364 VAL N N N N 365 VAL CA C N S 366 VAL C C N N 367 VAL O O N N 368 VAL CB C N N 369 VAL CG1 C N N 370 VAL CG2 C N N 371 VAL OXT O N N 372 VAL H H N N 373 VAL H2 H N N 374 VAL HA H N N 375 VAL HB H N N 376 VAL HG11 H N N 377 VAL HG12 H N N 378 VAL HG13 H N N 379 VAL HG21 H N N 380 VAL HG22 H N N 381 VAL HG23 H N N 382 VAL HXT H N N 383 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ACT C O doub N N 1 ACT C OXT sing N N 2 ACT C CH3 sing N N 3 ACT CH3 H1 sing N N 4 ACT CH3 H2 sing N N 5 ACT CH3 H3 sing N N 6 ALA N CA sing N N 7 ALA N H sing N N 8 ALA N H2 sing N N 9 ALA CA C sing N N 10 ALA CA CB sing N N 11 ALA CA HA sing N N 12 ALA C O doub N N 13 ALA C OXT sing N N 14 ALA CB HB1 sing N N 15 ALA CB HB2 sing N N 16 ALA CB HB3 sing N N 17 ALA OXT HXT sing N N 18 ARG N CA sing N N 19 ARG N H sing N N 20 ARG N H2 sing N N 21 ARG CA C sing N N 22 ARG CA CB sing N N 23 ARG CA HA sing N N 24 ARG C O doub N N 25 ARG C OXT sing N N 26 ARG CB CG sing N N 27 ARG CB HB2 sing N N 28 ARG CB HB3 sing N N 29 ARG CG CD sing N N 30 ARG CG HG2 sing N N 31 ARG CG HG3 sing N N 32 ARG CD NE sing N N 33 ARG CD HD2 sing N N 34 ARG CD HD3 sing N N 35 ARG NE CZ sing N N 36 ARG NE HE sing N N 37 ARG CZ NH1 sing N N 38 ARG CZ NH2 doub N N 39 ARG NH1 HH11 sing N N 40 ARG NH1 HH12 sing N N 41 ARG NH2 HH21 sing N N 42 ARG NH2 HH22 sing N N 43 ARG OXT HXT sing N N 44 ASN N CA sing N N 45 ASN N H sing N N 46 ASN N H2 sing N N 47 ASN CA C sing N N 48 ASN CA CB sing N N 49 ASN CA HA sing N N 50 ASN C O doub N N 51 ASN C OXT sing N N 52 ASN CB CG sing N N 53 ASN CB HB2 sing N N 54 ASN CB HB3 sing N N 55 ASN CG OD1 doub N N 56 ASN CG ND2 sing N N 57 ASN ND2 HD21 sing N N 58 ASN ND2 HD22 sing N N 59 ASN OXT HXT sing N N 60 ASP N CA sing N N 61 ASP N H sing N N 62 ASP N H2 sing N N 63 ASP CA C sing N N 64 ASP CA CB sing N N 65 ASP CA HA sing N N 66 ASP C O doub N N 67 ASP C OXT sing N N 68 ASP CB CG sing N N 69 ASP CB HB2 sing N N 70 ASP CB HB3 sing N N 71 ASP CG OD1 doub N N 72 ASP CG OD2 sing N N 73 ASP OD2 HD2 sing N N 74 ASP OXT HXT sing N N 75 GLN N CA sing N N 76 GLN N H sing N N 77 GLN N H2 sing N N 78 GLN CA C sing N N 79 GLN CA CB sing N N 80 GLN CA HA sing N N 81 GLN C O doub N N 82 GLN C OXT sing N N 83 GLN CB CG sing N N 84 GLN CB HB2 sing N N 85 GLN CB HB3 sing N N 86 GLN CG CD sing N N 87 GLN CG HG2 sing N N 88 GLN CG HG3 sing N N 89 GLN CD OE1 doub N N 90 GLN CD NE2 sing N N 91 GLN NE2 HE21 sing N N 92 GLN NE2 HE22 sing N N 93 GLN OXT HXT sing N N 94 GLU N CA sing N N 95 GLU N H sing N N 96 GLU N H2 sing N N 97 GLU CA C sing N N 98 GLU CA CB sing N N 99 GLU CA HA sing N N 100 GLU C O doub N N 101 GLU C OXT sing N N 102 GLU CB CG sing N N 103 GLU CB HB2 sing N N 104 GLU CB HB3 sing N N 105 GLU CG CD sing N N 106 GLU CG HG2 sing N N 107 GLU CG HG3 sing N N 108 GLU CD OE1 doub N N 109 GLU CD OE2 sing N N 110 GLU OE2 HE2 sing N N 111 GLU OXT HXT sing N N 112 GLY N CA sing N N 113 GLY N H sing N N 114 GLY N H2 sing N N 115 GLY CA C sing N N 116 GLY CA HA2 sing N N 117 GLY CA HA3 sing N N 118 GLY C O doub N N 119 GLY C OXT sing N N 120 GLY OXT HXT sing N N 121 HIS N CA sing N N 122 HIS N H sing N N 123 HIS N H2 sing N N 124 HIS CA C sing N N 125 HIS CA CB sing N N 126 HIS CA HA sing N N 127 HIS C O doub N N 128 HIS C OXT sing N N 129 HIS CB CG sing N N 130 HIS CB HB2 sing N N 131 HIS CB HB3 sing N N 132 HIS CG ND1 sing Y N 133 HIS CG CD2 doub Y N 134 HIS ND1 CE1 doub Y N 135 HIS ND1 HD1 sing N N 136 HIS CD2 NE2 sing Y N 137 HIS CD2 HD2 sing N N 138 HIS CE1 NE2 sing Y N 139 HIS CE1 HE1 sing N N 140 HIS NE2 HE2 sing N N 141 HIS OXT HXT sing N N 142 HOH O H1 sing N N 143 HOH O H2 sing N N 144 ILE N CA sing N N 145 ILE N H sing N N 146 ILE N H2 sing N N 147 ILE CA C sing N N 148 ILE CA CB sing N N 149 ILE CA HA sing N N 150 ILE C O doub N N 151 ILE C OXT sing N N 152 ILE CB CG1 sing N N 153 ILE CB CG2 sing N N 154 ILE CB HB sing N N 155 ILE CG1 CD1 sing N N 156 ILE CG1 HG12 sing N N 157 ILE CG1 HG13 sing N N 158 ILE CG2 HG21 sing N N 159 ILE CG2 HG22 sing N N 160 ILE CG2 HG23 sing N N 161 ILE CD1 HD11 sing N N 162 ILE CD1 HD12 sing N N 163 ILE CD1 HD13 sing N N 164 ILE OXT HXT sing N N 165 LEU N CA sing N N 166 LEU N H sing N N 167 LEU N H2 sing N N 168 LEU CA C sing N N 169 LEU CA CB sing N N 170 LEU CA HA sing N N 171 LEU C O doub N N 172 LEU C OXT sing N N 173 LEU CB CG sing N N 174 LEU CB HB2 sing N N 175 LEU CB HB3 sing N N 176 LEU CG CD1 sing N N 177 LEU CG CD2 sing N N 178 LEU CG HG sing N N 179 LEU CD1 HD11 sing N N 180 LEU CD1 HD12 sing N N 181 LEU CD1 HD13 sing N N 182 LEU CD2 HD21 sing N N 183 LEU CD2 HD22 sing N N 184 LEU CD2 HD23 sing N N 185 LEU OXT HXT sing N N 186 LYS N CA sing N N 187 LYS N H sing N N 188 LYS N H2 sing N N 189 LYS CA C sing N N 190 LYS CA CB sing N N 191 LYS CA HA sing N N 192 LYS C O doub N N 193 LYS C OXT sing N N 194 LYS CB CG sing N N 195 LYS CB HB2 sing N N 196 LYS CB HB3 sing N N 197 LYS CG CD sing N N 198 LYS CG HG2 sing N N 199 LYS CG HG3 sing N N 200 LYS CD CE sing N N 201 LYS CD HD2 sing N N 202 LYS CD HD3 sing N N 203 LYS CE NZ sing N N 204 LYS CE HE2 sing N N 205 LYS CE HE3 sing N N 206 LYS NZ HZ1 sing N N 207 LYS NZ HZ2 sing N N 208 LYS NZ HZ3 sing N N 209 LYS OXT HXT sing N N 210 MET N CA sing N N 211 MET N H sing N N 212 MET N H2 sing N N 213 MET CA C sing N N 214 MET CA CB sing N N 215 MET CA HA sing N N 216 MET C O doub N N 217 MET C OXT sing N N 218 MET CB CG sing N N 219 MET CB HB2 sing N N 220 MET CB HB3 sing N N 221 MET CG SD sing N N 222 MET CG HG2 sing N N 223 MET CG HG3 sing N N 224 MET SD CE sing N N 225 MET CE HE1 sing N N 226 MET CE HE2 sing N N 227 MET CE HE3 sing N N 228 MET OXT HXT sing N N 229 PHE N CA sing N N 230 PHE N H sing N N 231 PHE N H2 sing N N 232 PHE CA C sing N N 233 PHE CA CB sing N N 234 PHE CA HA sing N N 235 PHE C O doub N N 236 PHE C OXT sing N N 237 PHE CB CG sing N N 238 PHE CB HB2 sing N N 239 PHE CB HB3 sing N N 240 PHE CG CD1 doub Y N 241 PHE CG CD2 sing Y N 242 PHE CD1 CE1 sing Y N 243 PHE CD1 HD1 sing N N 244 PHE CD2 CE2 doub Y N 245 PHE CD2 HD2 sing N N 246 PHE CE1 CZ doub Y N 247 PHE CE1 HE1 sing N N 248 PHE CE2 CZ sing Y N 249 PHE CE2 HE2 sing N N 250 PHE CZ HZ sing N N 251 PHE OXT HXT sing N N 252 PRO N CA sing N N 253 PRO N CD sing N N 254 PRO N H sing N N 255 PRO CA C sing N N 256 PRO CA CB sing N N 257 PRO CA HA sing N N 258 PRO C O doub N N 259 PRO C OXT sing N N 260 PRO CB CG sing N N 261 PRO CB HB2 sing N N 262 PRO CB HB3 sing N N 263 PRO CG CD sing N N 264 PRO CG HG2 sing N N 265 PRO CG HG3 sing N N 266 PRO CD HD2 sing N N 267 PRO CD HD3 sing N N 268 PRO OXT HXT sing N N 269 SER N CA sing N N 270 SER N H sing N N 271 SER N H2 sing N N 272 SER CA C sing N N 273 SER CA CB sing N N 274 SER CA HA sing N N 275 SER C O doub N N 276 SER C OXT sing N N 277 SER CB OG sing N N 278 SER CB HB2 sing N N 279 SER CB HB3 sing N N 280 SER OG HG sing N N 281 SER OXT HXT sing N N 282 THR N CA sing N N 283 THR N H sing N N 284 THR N H2 sing N N 285 THR CA C sing N N 286 THR CA CB sing N N 287 THR CA HA sing N N 288 THR C O doub N N 289 THR C OXT sing N N 290 THR CB OG1 sing N N 291 THR CB CG2 sing N N 292 THR CB HB sing N N 293 THR OG1 HG1 sing N N 294 THR CG2 HG21 sing N N 295 THR CG2 HG22 sing N N 296 THR CG2 HG23 sing N N 297 THR OXT HXT sing N N 298 TRP N CA sing N N 299 TRP N H sing N N 300 TRP N H2 sing N N 301 TRP CA C sing N N 302 TRP CA CB sing N N 303 TRP CA HA sing N N 304 TRP C O doub N N 305 TRP C OXT sing N N 306 TRP CB CG sing N N 307 TRP CB HB2 sing N N 308 TRP CB HB3 sing N N 309 TRP CG CD1 doub Y N 310 TRP CG CD2 sing Y N 311 TRP CD1 NE1 sing Y N 312 TRP CD1 HD1 sing N N 313 TRP CD2 CE2 doub Y N 314 TRP CD2 CE3 sing Y N 315 TRP NE1 CE2 sing Y N 316 TRP NE1 HE1 sing N N 317 TRP CE2 CZ2 sing Y N 318 TRP CE3 CZ3 doub Y N 319 TRP CE3 HE3 sing N N 320 TRP CZ2 CH2 doub Y N 321 TRP CZ2 HZ2 sing N N 322 TRP CZ3 CH2 sing Y N 323 TRP CZ3 HZ3 sing N N 324 TRP CH2 HH2 sing N N 325 TRP OXT HXT sing N N 326 TYR N CA sing N N 327 TYR N H sing N N 328 TYR N H2 sing N N 329 TYR CA C sing N N 330 TYR CA CB sing N N 331 TYR CA HA sing N N 332 TYR C O doub N N 333 TYR C OXT sing N N 334 TYR CB CG sing N N 335 TYR CB HB2 sing N N 336 TYR CB HB3 sing N N 337 TYR CG CD1 doub Y N 338 TYR CG CD2 sing Y N 339 TYR CD1 CE1 sing Y N 340 TYR CD1 HD1 sing N N 341 TYR CD2 CE2 doub Y N 342 TYR CD2 HD2 sing N N 343 TYR CE1 CZ doub Y N 344 TYR CE1 HE1 sing N N 345 TYR CE2 CZ sing Y N 346 TYR CE2 HE2 sing N N 347 TYR CZ OH sing N N 348 TYR OH HH sing N N 349 TYR OXT HXT sing N N 350 VAL N CA sing N N 351 VAL N H sing N N 352 VAL N H2 sing N N 353 VAL CA C sing N N 354 VAL CA CB sing N N 355 VAL CA HA sing N N 356 VAL C O doub N N 357 VAL C OXT sing N N 358 VAL CB CG1 sing N N 359 VAL CB CG2 sing N N 360 VAL CB HB sing N N 361 VAL CG1 HG11 sing N N 362 VAL CG1 HG12 sing N N 363 VAL CG1 HG13 sing N N 364 VAL CG2 HG21 sing N N 365 VAL CG2 HG22 sing N N 366 VAL CG2 HG23 sing N N 367 VAL OXT HXT sing N N 368 # _pdbx_audit_support.funding_organization 'Canadian Institutes of Health Research (CIHR)' _pdbx_audit_support.country Canada _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 5AZF _pdbx_initial_refinement_model.details ? # _space_group.name_H-M_alt 'P 1 21 1' _space_group.name_Hall 'P 2yb' _space_group.IT_number 4 _space_group.crystal_system monoclinic _space_group.id 1 # _atom_sites.entry_id 8TGF _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.029420 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.005241 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.026349 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.022484 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.scat_dispersion_real _atom_type.scat_dispersion_imag _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c _atom_type.scat_source _atom_type.scat_dispersion_source C ? ? 3.54356 2.42580 ? ? 25.62398 1.50364 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? H ? ? 0.51345 0.48472 ? ? 24.73122 6.32584 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? N ? ? 4.01032 2.96436 ? ? 19.97189 1.75589 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O ? ? 4.49882 3.47563 ? ? 15.80542 1.70748 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? S ? ? 9.55732 6.39887 ? ? 1.23737 29.19336 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? # loop_