data_8TT7 # _entry.id 8TT7 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 8TT7 pdb_00008tt7 10.2210/pdb8tt7/pdb WWPDB D_1000276591 ? ? BMRB 52075 ? 10.13018/BMR52075 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2023-11-01 2 'Structure model' 1 1 2023-11-15 3 'Structure model' 1 2 2024-05-15 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 3 'Structure model' database_2 # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_volume' 2 2 'Structure model' '_citation.page_first' 3 2 'Structure model' '_citation.page_last' 4 3 'Structure model' '_database_2.pdbx_DOI' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr . _pdbx_database_status.entry_id 8TT7 _pdbx_database_status.recvd_initial_deposition_date 2023-08-12 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs . _pdbx_database_status.status_code_nmr_data REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_database_related.db_name BMRB _pdbx_database_related.details . _pdbx_database_related.db_id 52075 _pdbx_database_related.content_type unspecified # _pdbx_contact_author.id 2 _pdbx_contact_author.email andrei.alexandrescu@uconn.edu _pdbx_contact_author.name_first Andrei _pdbx_contact_author.name_last Alexandrescu _pdbx_contact_author.name_mi T _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-8425-9276 # _audit_author.name 'Alexandrescu, A.T.' _audit_author.pdbx_ordinal 1 _audit_author.identifier_ORCID 0000-0002-8425-9276 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country NE _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Biomol.Nmr Assign.' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 1874-270X _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 17 _citation.language ? _citation.page_first 301 _citation.page_last 307 _citation.title 'Solution NMR assignments and structure for the dimeric kinesin neck domain.' _citation.year 2023 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1007/s12104-023-10159-x _citation.pdbx_database_id_PubMed 37861970 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Seo, D.' 1 ? primary 'Kammerer, R.A.' 2 0000-0003-4570-5197 primary 'Alexandrescu, A.T.' 3 0000-0002-8425-9276 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Kinesin heavy chain isoform 5C' _entity.formula_weight 6338.247 _entity.pdbx_number_of_molecules 2 _entity.pdbx_ec 3.6.4.- _entity.pdbx_mutation ? _entity.pdbx_fragment 'Neck domain, residues 325-376' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Kinesin heavy chain neuron-specific 2,Kinesin-1' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GSKTIKNTVSVNLELTAEEWKKKYEKEKEKNKALKSVIQHLEVELNRWRNGEAV _entity_poly.pdbx_seq_one_letter_code_can GSKTIKNTVSVNLELTAEEWKKKYEKEKEKNKALKSVIQHLEVELNRWRNGEAV _entity_poly.pdbx_strand_id A,B _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 LYS n 1 4 THR n 1 5 ILE n 1 6 LYS n 1 7 ASN n 1 8 THR n 1 9 VAL n 1 10 SER n 1 11 VAL n 1 12 ASN n 1 13 LEU n 1 14 GLU n 1 15 LEU n 1 16 THR n 1 17 ALA n 1 18 GLU n 1 19 GLU n 1 20 TRP n 1 21 LYS n 1 22 LYS n 1 23 LYS n 1 24 TYR n 1 25 GLU n 1 26 LYS n 1 27 GLU n 1 28 LYS n 1 29 GLU n 1 30 LYS n 1 31 ASN n 1 32 LYS n 1 33 ALA n 1 34 LEU n 1 35 LYS n 1 36 SER n 1 37 VAL n 1 38 ILE n 1 39 GLN n 1 40 HIS n 1 41 LEU n 1 42 GLU n 1 43 VAL n 1 44 GLU n 1 45 LEU n 1 46 ASN n 1 47 ARG n 1 48 TRP n 1 49 ARG n 1 50 ASN n 1 51 GLY n 1 52 GLU n 1 53 ALA n 1 54 VAL n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 54 _entity_src_gen.gene_src_common_name 'Norway rat' _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'Kif5c, Nkhc2' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Rattus norvegicus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 10116 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'JM109(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ;The plasmid is a derivative of pET-32a (Novagen) that encodes E. coli thioredoxin with an N-terminal 6-His tag and a thrombin cleavage site, followed by a unique multiple cloning site ; _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pHisTrx2 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 LYS 3 3 3 LYS LYS A . n A 1 4 THR 4 4 4 THR THR A . n A 1 5 ILE 5 5 5 ILE ILE A . n A 1 6 LYS 6 6 6 LYS LYS A . n A 1 7 ASN 7 7 7 ASN ASN A . n A 1 8 THR 8 8 8 THR THR A . n A 1 9 VAL 9 9 9 VAL VAL A . n A 1 10 SER 10 10 10 SER SER A . n A 1 11 VAL 11 11 11 VAL VAL A . n A 1 12 ASN 12 12 12 ASN ASN A . n A 1 13 LEU 13 13 13 LEU LEU A . n A 1 14 GLU 14 14 14 GLU GLU A . n A 1 15 LEU 15 15 15 LEU LEU A . n A 1 16 THR 16 16 16 THR THR A . n A 1 17 ALA 17 17 17 ALA ALA A . n A 1 18 GLU 18 18 18 GLU GLU A . n A 1 19 GLU 19 19 19 GLU GLU A . n A 1 20 TRP 20 20 20 TRP TRP A . n A 1 21 LYS 21 21 21 LYS LYS A . n A 1 22 LYS 22 22 22 LYS LYS A . n A 1 23 LYS 23 23 23 LYS LYS A . n A 1 24 TYR 24 24 24 TYR TYR A . n A 1 25 GLU 25 25 25 GLU GLU A . n A 1 26 LYS 26 26 26 LYS LYS A . n A 1 27 GLU 27 27 27 GLU GLU A . n A 1 28 LYS 28 28 28 LYS LYS A . n A 1 29 GLU 29 29 29 GLU GLU A . n A 1 30 LYS 30 30 30 LYS LYS A . n A 1 31 ASN 31 31 31 ASN ASN A . n A 1 32 LYS 32 32 32 LYS LYS A . n A 1 33 ALA 33 33 33 ALA ALA A . n A 1 34 LEU 34 34 34 LEU LEU A . n A 1 35 LYS 35 35 35 LYS LYS A . n A 1 36 SER 36 36 36 SER SER A . n A 1 37 VAL 37 37 37 VAL VAL A . n A 1 38 ILE 38 38 38 ILE ILE A . n A 1 39 GLN 39 39 39 GLN GLN A . n A 1 40 HIS 40 40 40 HIS HIS A . n A 1 41 LEU 41 41 41 LEU LEU A . n A 1 42 GLU 42 42 42 GLU GLU A . n A 1 43 VAL 43 43 43 VAL VAL A . n A 1 44 GLU 44 44 44 GLU GLU A . n A 1 45 LEU 45 45 45 LEU LEU A . n A 1 46 ASN 46 46 46 ASN ASN A . n A 1 47 ARG 47 47 47 ARG ARG A . n A 1 48 TRP 48 48 48 TRP TRP A . n A 1 49 ARG 49 49 49 ARG ARG A . n A 1 50 ASN 50 50 50 ASN ASN A . n A 1 51 GLY 51 51 51 GLY GLY A . n A 1 52 GLU 52 52 52 GLU GLU A . n A 1 53 ALA 53 53 53 ALA ALA A . n A 1 54 VAL 54 54 54 VAL VAL A . n B 1 1 GLY 1 1 1 GLY GLY B . n B 1 2 SER 2 2 2 SER SER B . n B 1 3 LYS 3 3 3 LYS LYS B . n B 1 4 THR 4 4 4 THR THR B . n B 1 5 ILE 5 5 5 ILE ILE B . n B 1 6 LYS 6 6 6 LYS LYS B . n B 1 7 ASN 7 7 7 ASN ASN B . n B 1 8 THR 8 8 8 THR THR B . n B 1 9 VAL 9 9 9 VAL VAL B . n B 1 10 SER 10 10 10 SER SER B . n B 1 11 VAL 11 11 11 VAL VAL B . n B 1 12 ASN 12 12 12 ASN ASN B . n B 1 13 LEU 13 13 13 LEU LEU B . n B 1 14 GLU 14 14 14 GLU GLU B . n B 1 15 LEU 15 15 15 LEU LEU B . n B 1 16 THR 16 16 16 THR THR B . n B 1 17 ALA 17 17 17 ALA ALA B . n B 1 18 GLU 18 18 18 GLU GLU B . n B 1 19 GLU 19 19 19 GLU GLU B . n B 1 20 TRP 20 20 20 TRP TRP B . n B 1 21 LYS 21 21 21 LYS LYS B . n B 1 22 LYS 22 22 22 LYS LYS B . n B 1 23 LYS 23 23 23 LYS LYS B . n B 1 24 TYR 24 24 24 TYR TYR B . n B 1 25 GLU 25 25 25 GLU GLU B . n B 1 26 LYS 26 26 26 LYS LYS B . n B 1 27 GLU 27 27 27 GLU GLU B . n B 1 28 LYS 28 28 28 LYS LYS B . n B 1 29 GLU 29 29 29 GLU GLU B . n B 1 30 LYS 30 30 30 LYS LYS B . n B 1 31 ASN 31 31 31 ASN ASN B . n B 1 32 LYS 32 32 32 LYS LYS B . n B 1 33 ALA 33 33 33 ALA ALA B . n B 1 34 LEU 34 34 34 LEU LEU B . n B 1 35 LYS 35 35 35 LYS LYS B . n B 1 36 SER 36 36 36 SER SER B . n B 1 37 VAL 37 37 37 VAL VAL B . n B 1 38 ILE 38 38 38 ILE ILE B . n B 1 39 GLN 39 39 39 GLN GLN B . n B 1 40 HIS 40 40 40 HIS HIS B . n B 1 41 LEU 41 41 41 LEU LEU B . n B 1 42 GLU 42 42 42 GLU GLU B . n B 1 43 VAL 43 43 43 VAL VAL B . n B 1 44 GLU 44 44 44 GLU GLU B . n B 1 45 LEU 45 45 45 LEU LEU B . n B 1 46 ASN 46 46 46 ASN ASN B . n B 1 47 ARG 47 47 47 ARG ARG B . n B 1 48 TRP 48 48 48 TRP TRP B . n B 1 49 ARG 49 49 49 ARG ARG B . n B 1 50 ASN 50 50 50 ASN ASN B . n B 1 51 GLY 51 51 51 GLY GLY B . n B 1 52 GLU 52 52 52 GLU GLU B . n B 1 53 ALA 53 53 53 ALA ALA B . n B 1 54 VAL 54 54 54 VAL VAL B . n # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 8TT7 _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 8TT7 _struct.title 'NMR Assignments and Structure for the Dimeric Kinesin Neck Domain' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 8TT7 _struct_keywords.text 'microtubule motors, intracellular transport, MOTOR PROTEIN' _struct_keywords.pdbx_keywords 'MOTOR PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code KIF5C_RAT _struct_ref.pdbx_db_accession P56536 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code KTIKNTVSVNLELTAEEWKKKYEKEKEKNKALKSVIQHLEVELNRWRNGEAV _struct_ref.pdbx_align_begin 325 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 8TT7 A 3 ? 54 ? P56536 325 ? 376 ? 3 54 2 1 8TT7 B 3 ? 54 ? P56536 325 ? 376 ? 3 54 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 8TT7 GLY A 1 ? UNP P56536 ? ? 'expression tag' 1 1 1 8TT7 SER A 2 ? UNP P56536 ? ? 'expression tag' 2 2 2 8TT7 GLY B 1 ? UNP P56536 ? ? 'expression tag' 1 3 2 8TT7 SER B 2 ? UNP P56536 ? ? 'expression tag' 2 4 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'NMR Distance Restraints' _pdbx_struct_assembly_auth_evidence.details ;Actually the correct answer here would be "according to the literature". This option was not given: Tripet B, Vale RD, Hodges RS (1997) Demonstration of coiled-coil interactions within the kinesin neck region using synthetic peptides. Implications for motor activity J Biol Chem 272:8946-8956 doi:10.1074/jbc.272.14.8946 Kozielski F et al. (1997) The crystal structure of dimeric kinesin and implications for microtubule-dependent motility Cell 91:985-994 doi:10.1016/s0092-8674(00)80489-4 ; # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0 _pdbx_struct_oper_list.matrix[1][2] 0.0 _pdbx_struct_oper_list.matrix[1][3] 0.0 _pdbx_struct_oper_list.vector[1] 0.0 _pdbx_struct_oper_list.matrix[2][1] 0.0 _pdbx_struct_oper_list.matrix[2][2] 1.0 _pdbx_struct_oper_list.matrix[2][3] 0.0 _pdbx_struct_oper_list.vector[2] 0.0 _pdbx_struct_oper_list.matrix[3][1] 0.0 _pdbx_struct_oper_list.matrix[3][2] 0.0 _pdbx_struct_oper_list.matrix[3][3] 1.0 _pdbx_struct_oper_list.vector[3] 0.0 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 THR A 16 ? ASN A 50 ? THR A 16 ASN A 50 1 ? 35 HELX_P HELX_P2 AA2 THR B 16 ? ASN B 50 ? THR B 16 ASN B 50 1 ? 35 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LYS A 6 ? ? 54.44 125.64 2 1 LEU A 13 ? ? -76.18 -102.75 3 1 LYS B 6 ? ? 54.50 125.53 4 1 LEU B 13 ? ? -76.14 -102.82 5 2 THR A 4 ? ? 69.98 108.57 6 2 ASN A 12 ? ? 37.43 -101.12 7 2 LEU A 13 ? ? 96.21 -105.44 8 2 GLU A 14 ? ? -39.63 144.14 9 2 GLU A 52 ? ? -70.27 -79.38 10 2 THR B 4 ? ? 69.89 108.69 11 2 ASN B 12 ? ? 37.38 -101.14 12 2 LEU B 13 ? ? 96.26 -105.34 13 2 GLU B 14 ? ? -39.66 144.01 14 2 GLU B 52 ? ? -70.34 -79.32 15 3 LYS A 3 ? ? -174.21 78.75 16 3 LYS B 3 ? ? -174.11 78.82 17 4 THR A 4 ? ? 56.12 14.40 18 4 GLU A 14 ? ? -66.96 98.26 19 4 GLU A 52 ? ? 69.26 61.71 20 4 THR B 4 ? ? 56.21 14.33 21 4 GLU B 14 ? ? -66.96 98.31 22 4 GLU B 52 ? ? 69.18 61.76 23 5 LYS A 3 ? ? 39.39 -170.51 24 5 LEU A 13 ? ? 66.07 -147.46 25 5 LYS B 3 ? ? 39.46 -170.54 26 5 LEU B 13 ? ? 65.95 -147.41 27 6 LEU A 13 ? ? -127.06 -71.68 28 6 THR A 16 ? ? -111.65 -162.93 29 6 GLU A 52 ? ? -156.07 -146.40 30 6 LEU B 13 ? ? -127.13 -71.68 31 6 THR B 16 ? ? -111.86 -162.78 32 6 GLU B 52 ? ? -156.06 -146.37 33 7 ASN A 12 ? ? 58.85 96.33 34 7 LEU A 13 ? ? -104.25 -163.57 35 7 GLU A 52 ? ? 150.53 -101.56 36 7 ASN B 12 ? ? 58.76 96.35 37 7 LEU B 13 ? ? -104.22 -163.53 38 7 GLU B 52 ? ? 150.63 -101.43 39 8 LEU A 13 ? ? 26.19 79.48 40 8 GLU A 14 ? ? -61.17 89.80 41 8 GLU A 52 ? ? 63.47 70.17 42 8 LEU B 13 ? ? 26.18 79.51 43 8 GLU B 14 ? ? -60.78 89.41 44 8 GLU B 52 ? ? 63.41 70.21 45 9 ASN A 12 ? ? -67.96 73.71 46 9 LEU A 13 ? ? 50.58 117.52 47 9 ASN B 12 ? ? -67.88 73.67 48 9 LEU B 13 ? ? 50.47 117.48 49 10 LYS A 3 ? ? -92.42 -89.11 50 10 LEU A 13 ? ? -40.20 168.59 51 10 LYS B 3 ? ? -92.41 -88.99 52 10 LEU B 13 ? ? -40.15 168.61 53 11 SER A 2 ? ? 21.14 98.60 54 11 THR A 4 ? ? 25.90 79.98 55 11 LYS A 6 ? ? 46.69 -84.37 56 11 ASN A 12 ? ? -153.83 21.64 57 11 SER B 2 ? ? 21.21 98.54 58 11 THR B 4 ? ? 26.00 79.93 59 11 LYS B 6 ? ? 46.58 -84.30 60 11 ASN B 12 ? ? -153.71 21.74 61 12 LYS A 3 ? ? 68.78 -5.99 62 12 LYS A 6 ? ? 28.04 -88.56 63 12 LEU A 13 ? ? 19.31 -87.98 64 12 GLU A 52 ? ? 67.26 166.03 65 12 LYS B 3 ? ? 68.64 -5.76 66 12 LYS B 6 ? ? 28.05 -88.63 67 12 LEU B 13 ? ? 19.42 -88.05 68 12 GLU B 52 ? ? 67.22 166.07 69 14 LYS A 3 ? ? 46.10 26.54 70 14 LEU A 13 ? ? 58.39 89.34 71 14 GLU A 29 ? ? -76.78 -71.45 72 14 TRP A 48 ? ? -33.34 -28.65 73 14 ARG A 49 ? ? -57.58 -6.79 74 14 GLU A 52 ? ? 31.36 33.96 75 14 LYS B 3 ? ? 46.06 26.50 76 14 LEU B 13 ? ? 58.42 89.36 77 14 GLU B 29 ? ? -76.57 -71.72 78 14 TRP B 48 ? ? -33.38 -28.77 79 14 ARG B 49 ? ? -57.52 -6.73 80 14 GLU B 52 ? ? 31.34 34.13 81 15 LYS A 3 ? ? 34.00 37.54 82 15 THR A 4 ? ? -36.25 -75.50 83 15 LYS B 3 ? ? 34.06 37.48 84 15 THR B 4 ? ? -36.20 -75.53 85 16 ASN A 12 ? ? 45.68 -82.03 86 16 LEU A 13 ? ? 89.28 -81.56 87 16 TRP A 48 ? ? -29.80 -45.79 88 16 ARG A 49 ? ? -46.62 -7.89 89 16 ASN B 12 ? ? 45.62 -81.94 90 16 LEU B 13 ? ? 89.27 -81.50 91 16 TRP B 48 ? ? -29.47 -45.99 92 16 ARG B 49 ? ? -46.59 -7.84 93 17 ASN A 12 ? ? -105.43 49.15 94 17 ASN B 12 ? ? -105.44 49.09 95 18 ASN A 12 ? ? 79.95 -156.88 96 18 GLU A 14 ? ? -27.81 147.14 97 18 GLU A 42 ? ? -34.57 -39.52 98 18 TRP A 48 ? ? -37.52 -33.11 99 18 GLU A 52 ? ? -147.12 -54.15 100 18 ASN B 12 ? ? 79.94 -156.83 101 18 GLU B 14 ? ? -27.84 147.23 102 18 GLU B 42 ? ? -34.58 -39.47 103 18 TRP B 48 ? ? -37.46 -33.10 104 18 GLU B 52 ? ? -147.10 -54.11 105 19 ASN A 12 ? ? 53.74 9.89 106 19 ASN B 12 ? ? 53.96 9.83 107 20 SER A 2 ? ? 30.65 -154.45 108 20 THR A 4 ? ? 54.02 98.77 109 20 LEU A 13 ? ? -148.40 -38.56 110 20 SER B 2 ? ? 30.77 -154.45 111 20 THR B 4 ? ? 53.90 98.74 112 20 LEU B 13 ? ? -148.53 -38.63 # _pdbx_nmr_ensemble.entry_id 8TT7 _pdbx_nmr_ensemble.conformers_calculated_total_number 50 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 8TT7 _pdbx_nmr_representative.selection_criteria 'closest to the average' # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system _pdbx_nmr_sample_details.label _pdbx_nmr_sample_details.type _pdbx_nmr_sample_details.details 1 '0.75 mM [U-13C; U-15N] Kinesin_neck, 90% H2O/10% D2O' '90% H2O/10% D2O' 'H2O sample' solution ? 2 '0.75 mM [U-13C; U-15N] Kinesin_neck, 100% D2O' '100% D2O' 'D2O sample' solution ? 3 '0.75 mM [U-15N] Kinesin_neck, 90% H2O/10% D2O' '90% H2O/10% D2O' 'H2O sample2' solution ? 4 '0.75 mM [U-15N] Kinesin_neck, 100% D2O' '100% D2O' 'D2O sample2' solution 'Used for HX experiments at 23 C (296K)' # loop_ _pdbx_nmr_exptl_sample.solution_id _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling 1 Kinesin_neck 0.75 ? mM '[U-13C; U-15N]' 2 Kinesin_neck 0.75 ? mM '[U-13C; U-15N]' 3 Kinesin_neck 0.75 ? mM '[U-15N]' 4 Kinesin_neck 0.75 ? mM '[U-15N]' # loop_ _pdbx_nmr_exptl_sample_conditions.conditions_id _pdbx_nmr_exptl_sample_conditions.temperature _pdbx_nmr_exptl_sample_conditions.pressure_units _pdbx_nmr_exptl_sample_conditions.pressure _pdbx_nmr_exptl_sample_conditions.pH _pdbx_nmr_exptl_sample_conditions.ionic_strength _pdbx_nmr_exptl_sample_conditions.details _pdbx_nmr_exptl_sample_conditions.ionic_strength_err _pdbx_nmr_exptl_sample_conditions.ionic_strength_units _pdbx_nmr_exptl_sample_conditions.label _pdbx_nmr_exptl_sample_conditions.pH_err _pdbx_nmr_exptl_sample_conditions.pH_units _pdbx_nmr_exptl_sample_conditions.pressure_err _pdbx_nmr_exptl_sample_conditions.temperature_err _pdbx_nmr_exptl_sample_conditions.temperature_units 1 310 atm 1 6.1 150 '13C/15N in H2O used for backbone assignments' ? mM H2O ? pH ? ? K 2 310 atm 1 6.1 150 '15N/13C used for side chain assignments and 13C-NOESY' ? mM D2O ? pD ? ? K 3 310 atm 1 6.1 150 '15N-sample for TOCSY-HSQC and NOESY-HSQC' ? mM 'H2O sample 2' ? pH ? ? K 4 296 atm 1 6.1 150 '15N-sample for HX experiments at 296K' ? mM 'D2O sample 2' ? pD ? ? K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 3 3 '2D 1H-15N HSQC' 1 isotropic 2 1 1 '3D HNCACB' 1 isotropic 3 1 1 '3D HNCA' 1 isotropic 4 1 1 '3D HN(CO)CA' 1 isotropic 5 3 3 '3D 1H-15N TOCSY' 1 isotropic 6 3 3 '3D 1H-15N NOESY' 1 isotropic 7 2 2 '2D 1H-13C HSQC' 2 isotropic 8 2 2 '3D HCACO' 3 isotropic 9 2 2 '3D HCCH-TOCSY' 2 isotropic 10 2 2 '3D 1H-13C NOESY' 2 isotropic 11 4 4 'Hydrogen Exchange N-HSQC' 1 isotropic # _pdbx_nmr_refine.details ;sa.inp script of X-Plor NIH tutorial followed by 3 cycles of refine.inp (from X-PLOR NIH). Structures with no violations selected for next round. multiple cycles of prot_sa_refine.inp from this site (https://nesgwiki.chem.buffalo.edu/index.php/Structure_Refinement_Using_XPLOR-NIH) until no violations. Structures have no differences the human eye can see but have better PDB quality bars. ; _pdbx_nmr_refine.entry_id 8TT7 _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 refinement 'X-PLOR NIH' ? 'Schwieters, Kuszewski, Tjandra and Clore' 5 processing 'In-house / custom' ? 'iNMR from MNova' 6 processing NMRPipe ? 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' 7 processing Felix ? 'Accelrys Software Inc.' 2 'structure calculation' 'X-PLOR NIH' ? 'Schwieters, Kuszewski, Tjandra and Clore' 3 'chemical shift assignment' 'CcpNmr Analysis' ? CCPN 4 'peak picking' 'CcpNmr Analysis' ? CCPN 8 collection VnmrJ ? Varian 9 collection TopSpin ? 'Bruker Biospin' 10 'data analysis' 'CcpNmr Analysis' ? CCPN # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 GLN N N N N 58 GLN CA C N S 59 GLN C C N N 60 GLN O O N N 61 GLN CB C N N 62 GLN CG C N N 63 GLN CD C N N 64 GLN OE1 O N N 65 GLN NE2 N N N 66 GLN OXT O N N 67 GLN H H N N 68 GLN H2 H N N 69 GLN HA H N N 70 GLN HB2 H N N 71 GLN HB3 H N N 72 GLN HG2 H N N 73 GLN HG3 H N N 74 GLN HE21 H N N 75 GLN HE22 H N N 76 GLN HXT H N N 77 GLU N N N N 78 GLU CA C N S 79 GLU C C N N 80 GLU O O N N 81 GLU CB C N N 82 GLU CG C N N 83 GLU CD C N N 84 GLU OE1 O N N 85 GLU OE2 O N N 86 GLU OXT O N N 87 GLU H H N N 88 GLU H2 H N N 89 GLU HA H N N 90 GLU HB2 H N N 91 GLU HB3 H N N 92 GLU HG2 H N N 93 GLU HG3 H N N 94 GLU HE2 H N N 95 GLU HXT H N N 96 GLY N N N N 97 GLY CA C N N 98 GLY C C N N 99 GLY O O N N 100 GLY OXT O N N 101 GLY H H N N 102 GLY H2 H N N 103 GLY HA2 H N N 104 GLY HA3 H N N 105 GLY HXT H N N 106 HIS N N N N 107 HIS CA C N S 108 HIS C C N N 109 HIS O O N N 110 HIS CB C N N 111 HIS CG C Y N 112 HIS ND1 N Y N 113 HIS CD2 C Y N 114 HIS CE1 C Y N 115 HIS NE2 N Y N 116 HIS OXT O N N 117 HIS H H N N 118 HIS H2 H N N 119 HIS HA H N N 120 HIS HB2 H N N 121 HIS HB3 H N N 122 HIS HD1 H N N 123 HIS HD2 H N N 124 HIS HE1 H N N 125 HIS HE2 H N N 126 HIS HXT H N N 127 ILE N N N N 128 ILE CA C N S 129 ILE C C N N 130 ILE O O N N 131 ILE CB C N S 132 ILE CG1 C N N 133 ILE CG2 C N N 134 ILE CD1 C N N 135 ILE OXT O N N 136 ILE H H N N 137 ILE H2 H N N 138 ILE HA H N N 139 ILE HB H N N 140 ILE HG12 H N N 141 ILE HG13 H N N 142 ILE HG21 H N N 143 ILE HG22 H N N 144 ILE HG23 H N N 145 ILE HD11 H N N 146 ILE HD12 H N N 147 ILE HD13 H N N 148 ILE HXT H N N 149 LEU N N N N 150 LEU CA C N S 151 LEU C C N N 152 LEU O O N N 153 LEU CB C N N 154 LEU CG C N N 155 LEU CD1 C N N 156 LEU CD2 C N N 157 LEU OXT O N N 158 LEU H H N N 159 LEU H2 H N N 160 LEU HA H N N 161 LEU HB2 H N N 162 LEU HB3 H N N 163 LEU HG H N N 164 LEU HD11 H N N 165 LEU HD12 H N N 166 LEU HD13 H N N 167 LEU HD21 H N N 168 LEU HD22 H N N 169 LEU HD23 H N N 170 LEU HXT H N N 171 LYS N N N N 172 LYS CA C N S 173 LYS C C N N 174 LYS O O N N 175 LYS CB C N N 176 LYS CG C N N 177 LYS CD C N N 178 LYS CE C N N 179 LYS NZ N N N 180 LYS OXT O N N 181 LYS H H N N 182 LYS H2 H N N 183 LYS HA H N N 184 LYS HB2 H N N 185 LYS HB3 H N N 186 LYS HG2 H N N 187 LYS HG3 H N N 188 LYS HD2 H N N 189 LYS HD3 H N N 190 LYS HE2 H N N 191 LYS HE3 H N N 192 LYS HZ1 H N N 193 LYS HZ2 H N N 194 LYS HZ3 H N N 195 LYS HXT H N N 196 SER N N N N 197 SER CA C N S 198 SER C C N N 199 SER O O N N 200 SER CB C N N 201 SER OG O N N 202 SER OXT O N N 203 SER H H N N 204 SER H2 H N N 205 SER HA H N N 206 SER HB2 H N N 207 SER HB3 H N N 208 SER HG H N N 209 SER HXT H N N 210 THR N N N N 211 THR CA C N S 212 THR C C N N 213 THR O O N N 214 THR CB C N R 215 THR OG1 O N N 216 THR CG2 C N N 217 THR OXT O N N 218 THR H H N N 219 THR H2 H N N 220 THR HA H N N 221 THR HB H N N 222 THR HG1 H N N 223 THR HG21 H N N 224 THR HG22 H N N 225 THR HG23 H N N 226 THR HXT H N N 227 TRP N N N N 228 TRP CA C N S 229 TRP C C N N 230 TRP O O N N 231 TRP CB C N N 232 TRP CG C Y N 233 TRP CD1 C Y N 234 TRP CD2 C Y N 235 TRP NE1 N Y N 236 TRP CE2 C Y N 237 TRP CE3 C Y N 238 TRP CZ2 C Y N 239 TRP CZ3 C Y N 240 TRP CH2 C Y N 241 TRP OXT O N N 242 TRP H H N N 243 TRP H2 H N N 244 TRP HA H N N 245 TRP HB2 H N N 246 TRP HB3 H N N 247 TRP HD1 H N N 248 TRP HE1 H N N 249 TRP HE3 H N N 250 TRP HZ2 H N N 251 TRP HZ3 H N N 252 TRP HH2 H N N 253 TRP HXT H N N 254 TYR N N N N 255 TYR CA C N S 256 TYR C C N N 257 TYR O O N N 258 TYR CB C N N 259 TYR CG C Y N 260 TYR CD1 C Y N 261 TYR CD2 C Y N 262 TYR CE1 C Y N 263 TYR CE2 C Y N 264 TYR CZ C Y N 265 TYR OH O N N 266 TYR OXT O N N 267 TYR H H N N 268 TYR H2 H N N 269 TYR HA H N N 270 TYR HB2 H N N 271 TYR HB3 H N N 272 TYR HD1 H N N 273 TYR HD2 H N N 274 TYR HE1 H N N 275 TYR HE2 H N N 276 TYR HH H N N 277 TYR HXT H N N 278 VAL N N N N 279 VAL CA C N S 280 VAL C C N N 281 VAL O O N N 282 VAL CB C N N 283 VAL CG1 C N N 284 VAL CG2 C N N 285 VAL OXT O N N 286 VAL H H N N 287 VAL H2 H N N 288 VAL HA H N N 289 VAL HB H N N 290 VAL HG11 H N N 291 VAL HG12 H N N 292 VAL HG13 H N N 293 VAL HG21 H N N 294 VAL HG22 H N N 295 VAL HG23 H N N 296 VAL HXT H N N 297 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 GLN N CA sing N N 55 GLN N H sing N N 56 GLN N H2 sing N N 57 GLN CA C sing N N 58 GLN CA CB sing N N 59 GLN CA HA sing N N 60 GLN C O doub N N 61 GLN C OXT sing N N 62 GLN CB CG sing N N 63 GLN CB HB2 sing N N 64 GLN CB HB3 sing N N 65 GLN CG CD sing N N 66 GLN CG HG2 sing N N 67 GLN CG HG3 sing N N 68 GLN CD OE1 doub N N 69 GLN CD NE2 sing N N 70 GLN NE2 HE21 sing N N 71 GLN NE2 HE22 sing N N 72 GLN OXT HXT sing N N 73 GLU N CA sing N N 74 GLU N H sing N N 75 GLU N H2 sing N N 76 GLU CA C sing N N 77 GLU CA CB sing N N 78 GLU CA HA sing N N 79 GLU C O doub N N 80 GLU C OXT sing N N 81 GLU CB CG sing N N 82 GLU CB HB2 sing N N 83 GLU CB HB3 sing N N 84 GLU CG CD sing N N 85 GLU CG HG2 sing N N 86 GLU CG HG3 sing N N 87 GLU CD OE1 doub N N 88 GLU CD OE2 sing N N 89 GLU OE2 HE2 sing N N 90 GLU OXT HXT sing N N 91 GLY N CA sing N N 92 GLY N H sing N N 93 GLY N H2 sing N N 94 GLY CA C sing N N 95 GLY CA HA2 sing N N 96 GLY CA HA3 sing N N 97 GLY C O doub N N 98 GLY C OXT sing N N 99 GLY OXT HXT sing N N 100 HIS N CA sing N N 101 HIS N H sing N N 102 HIS N H2 sing N N 103 HIS CA C sing N N 104 HIS CA CB sing N N 105 HIS CA HA sing N N 106 HIS C O doub N N 107 HIS C OXT sing N N 108 HIS CB CG sing N N 109 HIS CB HB2 sing N N 110 HIS CB HB3 sing N N 111 HIS CG ND1 sing Y N 112 HIS CG CD2 doub Y N 113 HIS ND1 CE1 doub Y N 114 HIS ND1 HD1 sing N N 115 HIS CD2 NE2 sing Y N 116 HIS CD2 HD2 sing N N 117 HIS CE1 NE2 sing Y N 118 HIS CE1 HE1 sing N N 119 HIS NE2 HE2 sing N N 120 HIS OXT HXT sing N N 121 ILE N CA sing N N 122 ILE N H sing N N 123 ILE N H2 sing N N 124 ILE CA C sing N N 125 ILE CA CB sing N N 126 ILE CA HA sing N N 127 ILE C O doub N N 128 ILE C OXT sing N N 129 ILE CB CG1 sing N N 130 ILE CB CG2 sing N N 131 ILE CB HB sing N N 132 ILE CG1 CD1 sing N N 133 ILE CG1 HG12 sing N N 134 ILE CG1 HG13 sing N N 135 ILE CG2 HG21 sing N N 136 ILE CG2 HG22 sing N N 137 ILE CG2 HG23 sing N N 138 ILE CD1 HD11 sing N N 139 ILE CD1 HD12 sing N N 140 ILE CD1 HD13 sing N N 141 ILE OXT HXT sing N N 142 LEU N CA sing N N 143 LEU N H sing N N 144 LEU N H2 sing N N 145 LEU CA C sing N N 146 LEU CA CB sing N N 147 LEU CA HA sing N N 148 LEU C O doub N N 149 LEU C OXT sing N N 150 LEU CB CG sing N N 151 LEU CB HB2 sing N N 152 LEU CB HB3 sing N N 153 LEU CG CD1 sing N N 154 LEU CG CD2 sing N N 155 LEU CG HG sing N N 156 LEU CD1 HD11 sing N N 157 LEU CD1 HD12 sing N N 158 LEU CD1 HD13 sing N N 159 LEU CD2 HD21 sing N N 160 LEU CD2 HD22 sing N N 161 LEU CD2 HD23 sing N N 162 LEU OXT HXT sing N N 163 LYS N CA sing N N 164 LYS N H sing N N 165 LYS N H2 sing N N 166 LYS CA C sing N N 167 LYS CA CB sing N N 168 LYS CA HA sing N N 169 LYS C O doub N N 170 LYS C OXT sing N N 171 LYS CB CG sing N N 172 LYS CB HB2 sing N N 173 LYS CB HB3 sing N N 174 LYS CG CD sing N N 175 LYS CG HG2 sing N N 176 LYS CG HG3 sing N N 177 LYS CD CE sing N N 178 LYS CD HD2 sing N N 179 LYS CD HD3 sing N N 180 LYS CE NZ sing N N 181 LYS CE HE2 sing N N 182 LYS CE HE3 sing N N 183 LYS NZ HZ1 sing N N 184 LYS NZ HZ2 sing N N 185 LYS NZ HZ3 sing N N 186 LYS OXT HXT sing N N 187 SER N CA sing N N 188 SER N H sing N N 189 SER N H2 sing N N 190 SER CA C sing N N 191 SER CA CB sing N N 192 SER CA HA sing N N 193 SER C O doub N N 194 SER C OXT sing N N 195 SER CB OG sing N N 196 SER CB HB2 sing N N 197 SER CB HB3 sing N N 198 SER OG HG sing N N 199 SER OXT HXT sing N N 200 THR N CA sing N N 201 THR N H sing N N 202 THR N H2 sing N N 203 THR CA C sing N N 204 THR CA CB sing N N 205 THR CA HA sing N N 206 THR C O doub N N 207 THR C OXT sing N N 208 THR CB OG1 sing N N 209 THR CB CG2 sing N N 210 THR CB HB sing N N 211 THR OG1 HG1 sing N N 212 THR CG2 HG21 sing N N 213 THR CG2 HG22 sing N N 214 THR CG2 HG23 sing N N 215 THR OXT HXT sing N N 216 TRP N CA sing N N 217 TRP N H sing N N 218 TRP N H2 sing N N 219 TRP CA C sing N N 220 TRP CA CB sing N N 221 TRP CA HA sing N N 222 TRP C O doub N N 223 TRP C OXT sing N N 224 TRP CB CG sing N N 225 TRP CB HB2 sing N N 226 TRP CB HB3 sing N N 227 TRP CG CD1 doub Y N 228 TRP CG CD2 sing Y N 229 TRP CD1 NE1 sing Y N 230 TRP CD1 HD1 sing N N 231 TRP CD2 CE2 doub Y N 232 TRP CD2 CE3 sing Y N 233 TRP NE1 CE2 sing Y N 234 TRP NE1 HE1 sing N N 235 TRP CE2 CZ2 sing Y N 236 TRP CE3 CZ3 doub Y N 237 TRP CE3 HE3 sing N N 238 TRP CZ2 CH2 doub Y N 239 TRP CZ2 HZ2 sing N N 240 TRP CZ3 CH2 sing Y N 241 TRP CZ3 HZ3 sing N N 242 TRP CH2 HH2 sing N N 243 TRP OXT HXT sing N N 244 TYR N CA sing N N 245 TYR N H sing N N 246 TYR N H2 sing N N 247 TYR CA C sing N N 248 TYR CA CB sing N N 249 TYR CA HA sing N N 250 TYR C O doub N N 251 TYR C OXT sing N N 252 TYR CB CG sing N N 253 TYR CB HB2 sing N N 254 TYR CB HB3 sing N N 255 TYR CG CD1 doub Y N 256 TYR CG CD2 sing Y N 257 TYR CD1 CE1 sing Y N 258 TYR CD1 HD1 sing N N 259 TYR CD2 CE2 doub Y N 260 TYR CD2 HD2 sing N N 261 TYR CE1 CZ doub Y N 262 TYR CE1 HE1 sing N N 263 TYR CE2 CZ sing Y N 264 TYR CE2 HE2 sing N N 265 TYR CZ OH sing N N 266 TYR OH HH sing N N 267 TYR OXT HXT sing N N 268 VAL N CA sing N N 269 VAL N H sing N N 270 VAL N H2 sing N N 271 VAL CA C sing N N 272 VAL CA CB sing N N 273 VAL CA HA sing N N 274 VAL C O doub N N 275 VAL C OXT sing N N 276 VAL CB CG1 sing N N 277 VAL CB CG2 sing N N 278 VAL CB HB sing N N 279 VAL CG1 HG11 sing N N 280 VAL CG1 HG12 sing N N 281 VAL CG1 HG13 sing N N 282 VAL CG2 HG21 sing N N 283 VAL CG2 HG22 sing N N 284 VAL CG2 HG23 sing N N 285 VAL OXT HXT sing N N 286 # _pdbx_audit_support.funding_organization 'National Science Foundation (NSF, United States)' _pdbx_audit_support.country 'United States' _pdbx_audit_support.grant_number 'MB 0236316' _pdbx_audit_support.ordinal 1 # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.type _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.details 1 INOVA ? Varian 600 'w/ cryoprobe' 2 'AVANCE NEO' ? Bruker 600 'w/ cryoprobe' 3 AVANCE ? Bruker 500 'room temp probe' # _atom_sites.entry_id 8TT7 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C H N O # loop_