data_8ULM # _entry.id 8ULM # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.380 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 8ULM pdb_00008ulm 10.2210/pdb8ulm/pdb WWPDB D_1000278334 ? ? BMRB 31111 ? ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.details _pdbx_database_related.db_id _pdbx_database_related.content_type PDB 'different disulfide bond pattern' 7th8 unspecified BMRB ;Chickpea (Cicer arientinum) nodule-specific cysteine-rich peptide NCR13: Solution NMR structure of the isomer with C4:C23, C15:C30, and C10:C28 disulfide bonds ; 31111 unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr . _pdbx_database_status.entry_id 8ULM _pdbx_database_status.recvd_initial_deposition_date 2023-10-16 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs . _pdbx_database_status.status_code_nmr_data REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Buchko, G.W.' 1 0000-0002-3639-1061 'Zhou, M.' 2 ? 'Shah, D.M.' 3 0000-0001-9503-4729 'Velivelli, S.L.S.' 4 0000-0002-6831-241X # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title ;Solution NMR structures of the Chickpea (Cicer arientinum) nodule-specific cysteine-rich peptide NCR13 in two different disulfide bonding patterns ; _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Buchko, G.W.' 1 0000-0002-3639-1061 primary 'Zhou, M.' 2 ? primary 'Velivelli, S.L.S.' 3 0000-0002-6831-241X primary 'Shah, D.M.' 4 0000-0001-9503-4729 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Nodule cysteine-rich protein 13' _entity.formula_weight 3741.605 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ATKPCQSDKDCKKFACRKPKVPKCINGFCKCVR _entity_poly.pdbx_seq_one_letter_code_can ATKPCQSDKDCKKFACRKPKVPKCINGFCKCVR _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ALA n 1 2 THR n 1 3 LYS n 1 4 PRO n 1 5 CYS n 1 6 GLN n 1 7 SER n 1 8 ASP n 1 9 LYS n 1 10 ASP n 1 11 CYS n 1 12 LYS n 1 13 LYS n 1 14 PHE n 1 15 ALA n 1 16 CYS n 1 17 ARG n 1 18 LYS n 1 19 PRO n 1 20 LYS n 1 21 VAL n 1 22 PRO n 1 23 LYS n 1 24 CYS n 1 25 ILE n 1 26 ASN n 1 27 GLY n 1 28 PHE n 1 29 CYS n 1 30 LYS n 1 31 CYS n 1 32 VAL n 1 33 ARG n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 33 _entity_src_gen.gene_src_common_name chickpea _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene NCR13 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Cicer arietinum' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 3827 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Komagataella pastoris' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 4922 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code A0A0U8SNQ0_CICAR _struct_ref.pdbx_db_accession A0A0U8SNQ0 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ATKPCQSDKDCKKFACRKPKVPKCINGFCKCVR _struct_ref.pdbx_align_begin 24 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 8ULM _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 33 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession A0A0U8SNQ0 _struct_ref_seq.db_align_beg 24 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 56 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 0 _struct_ref_seq.pdbx_auth_seq_align_end 32 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 '2D 1H-15N HSQC' 1 anisotropic 2 1 2 '2D 1H-13C HSQC aliphatic' 1 anisotropic 3 1 2 '2D 1H-13C HSQC aromatic' 1 anisotropic 4 1 2 '2D 1H-1H NOESY' 1 anisotropic 5 1 2 '2D 1H-1H TOCSY' 1 anisotropic 6 1 2 '2D 1H-15N HSQC' 1 anisotropic 10 1 1 '3D 1H-15N TOCSY' 1 anisotropic 9 1 1 '2D 1H-1H NOESY' 1 anisotropic 8 1 1 '2D 1H-1H TOCSY' 1 anisotropic 11 1 1 '3D 1H-13C NOESY' 1 anisotropic # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 293 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 5.3 _pdbx_nmr_exptl_sample_conditions.ionic_strength 70 _pdbx_nmr_exptl_sample_conditions.details ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_err 2 _pdbx_nmr_exptl_sample_conditions.ionic_strength_units mM _pdbx_nmr_exptl_sample_conditions.label 1 _pdbx_nmr_exptl_sample_conditions.pH_err 0.1 _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system _pdbx_nmr_sample_details.label _pdbx_nmr_sample_details.type _pdbx_nmr_sample_details.details 1 '20 mM sodium acetate, 50 mM sodium chloride, 93% H2O/7% D2O' '93% H2O/7% D2O' DEF13_B1 solution ? 2 '20 mM sodium acetate, 50 mM sodium chloride, 100% D2O' '100% D2O' DEF13_B1 solution ? # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model INOVA _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Varian _pdbx_nmr_spectrometer.field_strength 600 _pdbx_nmr_spectrometer.details ? # _pdbx_nmr_refine.entry_id 8ULM _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ;It was not possible to verify the disulfide bonding pattern using mass spectrometry or other methods. Therefore the alphafold predicted disulfide pattern was used in the structure calculations. The structure was first solved using CYANA and then refined in explicit water adding 10% to the upper bound of the NOE restraints. ; _pdbx_nmr_refine.software_ordinal 3 # _pdbx_nmr_ensemble.entry_id 8ULM _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'target function' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 8ULM _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'closest to the average' # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 processing Felix 2007 'Accelrys Software Inc.' 2 'structure calculation' CYANA 2.1 'Guntert, Mumenthaler and Wuthrich' 3 refinement CNS ? 'Brunger, Adams, Clore, Gros, Nilges and Read' 4 'peak picking' Poky ? 'Manthey, Tonelli, Clos II, Rahimi, Markley and Lee' 5 'data analysis' PSVS 3.135 'Bhattacharya and Montelione' 6 'data analysis' TALOS+ ? unknown # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 8ULM _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 8ULM _struct.title ;Chickpea (Cicer arientinum) nodule-specific cysteine-rich peptide NCR13: Solution NMR structure of the isomer with C4:C23, C15:C30, and C10:C28 disulfide bonds ; _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 8ULM _struct_keywords.text 'antifunal activity, ENDOSYMBIOTIC, DISULFIDE-RICH, ANTIMICROBIAL PROTEIN, NCR peptide, ANTIFUNGAL PROTEIN' _struct_keywords.pdbx_keywords 'ANTIFUNGAL PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id AA1 _struct_conf.beg_label_comp_id GLN _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 6 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id CYS _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 11 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id GLN _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 5 _struct_conf.end_auth_comp_id CYS _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 10 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 5 SG ? ? ? 1_555 A CYS 24 SG ? ? A CYS 4 A CYS 23 1_555 ? ? ? ? ? ? ? 2.228 ? ? disulf2 disulf ? ? A CYS 11 SG ? ? ? 1_555 A CYS 29 SG ? ? A CYS 10 A CYS 28 1_555 ? ? ? ? ? ? ? 2.229 ? ? disulf3 disulf ? ? A CYS 16 SG ? ? ? 1_555 A CYS 31 SG ? ? A CYS 15 A CYS 30 1_555 ? ? ? ? ? ? ? 2.229 ? ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 LYS 18 A . ? LYS 17 A PRO 19 A ? PRO 18 A 1 -3.37 2 LYS 18 A . ? LYS 17 A PRO 19 A ? PRO 18 A 2 1.91 3 LYS 18 A . ? LYS 17 A PRO 19 A ? PRO 18 A 3 0.51 4 LYS 18 A . ? LYS 17 A PRO 19 A ? PRO 18 A 4 0.61 5 LYS 18 A . ? LYS 17 A PRO 19 A ? PRO 18 A 5 1.87 6 LYS 18 A . ? LYS 17 A PRO 19 A ? PRO 18 A 6 1.19 7 LYS 18 A . ? LYS 17 A PRO 19 A ? PRO 18 A 7 1.77 8 LYS 18 A . ? LYS 17 A PRO 19 A ? PRO 18 A 8 1.47 9 LYS 18 A . ? LYS 17 A PRO 19 A ? PRO 18 A 9 3.79 10 LYS 18 A . ? LYS 17 A PRO 19 A ? PRO 18 A 10 3.73 11 LYS 18 A . ? LYS 17 A PRO 19 A ? PRO 18 A 11 4.89 12 LYS 18 A . ? LYS 17 A PRO 19 A ? PRO 18 A 12 0.62 13 LYS 18 A . ? LYS 17 A PRO 19 A ? PRO 18 A 13 1.44 14 LYS 18 A . ? LYS 17 A PRO 19 A ? PRO 18 A 14 0.11 15 LYS 18 A . ? LYS 17 A PRO 19 A ? PRO 18 A 15 -2.29 16 LYS 18 A . ? LYS 17 A PRO 19 A ? PRO 18 A 16 2.31 17 LYS 18 A . ? LYS 17 A PRO 19 A ? PRO 18 A 17 -1.34 18 LYS 18 A . ? LYS 17 A PRO 19 A ? PRO 18 A 18 4.58 19 LYS 18 A . ? LYS 17 A PRO 19 A ? PRO 18 A 19 3.23 20 LYS 18 A . ? LYS 17 A PRO 19 A ? PRO 18 A 20 1.94 # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id AA1 _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 VAL A 21 ? ILE A 25 ? VAL A 20 ILE A 24 AA1 2 PHE A 28 ? VAL A 32 ? PHE A 27 VAL A 31 # _pdbx_struct_sheet_hbond.sheet_id AA1 _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id LYS _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 23 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id LYS _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 22 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id LYS _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 30 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id LYS _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 29 # _atom_sites.entry_id 8ULM _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ALA 1 0 0 ALA ALA A . n A 1 2 THR 2 1 1 THR THR A . n A 1 3 LYS 3 2 2 LYS LYS A . n A 1 4 PRO 4 3 3 PRO PRO A . n A 1 5 CYS 5 4 4 CYS CYS A . n A 1 6 GLN 6 5 5 GLN GLN A . n A 1 7 SER 7 6 6 SER SER A . n A 1 8 ASP 8 7 7 ASP ASP A . n A 1 9 LYS 9 8 8 LYS LYS A . n A 1 10 ASP 10 9 9 ASP ASP A . n A 1 11 CYS 11 10 10 CYS CYS A . n A 1 12 LYS 12 11 11 LYS LYS A . n A 1 13 LYS 13 12 12 LYS LYS A . n A 1 14 PHE 14 13 13 PHE PHE A . n A 1 15 ALA 15 14 14 ALA ALA A . n A 1 16 CYS 16 15 15 CYS CYS A . n A 1 17 ARG 17 16 16 ARG ARG A . n A 1 18 LYS 18 17 17 LYS LYS A . n A 1 19 PRO 19 18 18 PRO PRO A . n A 1 20 LYS 20 19 19 LYS LYS A . n A 1 21 VAL 21 20 20 VAL VAL A . n A 1 22 PRO 22 21 21 PRO PRO A . n A 1 23 LYS 23 22 22 LYS LYS A . n A 1 24 CYS 24 23 23 CYS CYS A . n A 1 25 ILE 25 24 24 ILE ILE A . n A 1 26 ASN 26 25 25 ASN ASN A . n A 1 27 GLY 27 26 26 GLY GLY A . n A 1 28 PHE 28 27 27 PHE PHE A . n A 1 29 CYS 29 28 28 CYS CYS A . n A 1 30 LYS 30 29 29 LYS LYS A . n A 1 31 CYS 31 30 30 CYS CYS A . n A 1 32 VAL 32 31 31 VAL VAL A . n A 1 33 ARG 33 32 32 ARG ARG A . n # _pdbx_contact_author.id 2 _pdbx_contact_author.email garry.buchko@pnnl.gov _pdbx_contact_author.name_first Garry _pdbx_contact_author.name_last Buchko _pdbx_contact_author.name_mi W _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-3639-1061 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0 _pdbx_struct_oper_list.matrix[1][2] 0.0 _pdbx_struct_oper_list.matrix[1][3] 0.0 _pdbx_struct_oper_list.vector[1] 0.0 _pdbx_struct_oper_list.matrix[2][1] 0.0 _pdbx_struct_oper_list.matrix[2][2] 1.0 _pdbx_struct_oper_list.matrix[2][3] 0.0 _pdbx_struct_oper_list.vector[2] 0.0 _pdbx_struct_oper_list.matrix[3][1] 0.0 _pdbx_struct_oper_list.matrix[3][2] 0.0 _pdbx_struct_oper_list.matrix[3][3] 1.0 _pdbx_struct_oper_list.vector[3] 0.0 # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2023-11-01 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_nmr_exptl_sample.solution_id _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling 1 'sodium acetate' 20 ? mM 'natural abundance' 1 'sodium chloride' 50 ? mM 'natural abundance' 2 'sodium acetate' 20 ? mM 'natural abundance' 2 'sodium chloride' 50 ? mM 'natural abundance' # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PRO A 3 ? ? -67.07 -160.19 2 1 PHE A 13 ? ? -38.83 98.08 3 1 LYS A 19 ? ? -176.02 142.96 4 2 PRO A 3 ? ? -71.51 -165.50 5 2 GLN A 5 ? ? 65.93 65.92 6 2 PHE A 13 ? ? -38.96 99.16 7 3 PRO A 3 ? ? -73.89 -159.67 8 3 PHE A 13 ? ? -38.37 98.91 9 3 ARG A 16 ? ? -63.16 98.84 10 3 LYS A 19 ? ? -172.86 143.82 11 4 PRO A 3 ? ? -78.73 -167.44 12 4 PHE A 13 ? ? -38.61 97.62 13 4 LYS A 19 ? ? -174.16 130.68 14 5 GLN A 5 ? ? 72.32 30.06 15 5 PHE A 13 ? ? -38.88 98.30 16 6 PRO A 3 ? ? -77.93 -163.12 17 6 PHE A 13 ? ? -38.55 98.20 18 6 LYS A 19 ? ? -172.68 145.58 19 7 PRO A 3 ? ? -69.90 -163.32 20 7 PHE A 13 ? ? -39.22 98.05 21 7 LYS A 19 ? ? -179.83 122.13 22 8 PRO A 3 ? ? -62.75 -160.83 23 8 GLN A 5 ? ? 62.12 67.27 24 8 PHE A 13 ? ? -38.99 98.07 25 9 PRO A 3 ? ? -65.72 -171.41 26 9 GLN A 5 ? ? 68.38 66.90 27 9 PHE A 13 ? ? -38.80 98.12 28 9 ARG A 16 ? ? -64.56 96.19 29 9 LYS A 19 ? ? -176.89 149.73 30 10 PRO A 3 ? ? -72.55 -157.96 31 10 GLN A 5 ? ? 73.79 41.69 32 10 PHE A 13 ? ? -39.29 98.78 33 10 ARG A 16 ? ? -65.07 96.10 34 10 LYS A 19 ? ? 178.56 139.87 35 11 PHE A 13 ? ? -38.92 98.37 36 11 ARG A 16 ? ? -66.78 96.70 37 11 LYS A 19 ? ? 177.82 127.44 38 12 PRO A 3 ? ? -76.35 -161.75 39 12 PHE A 13 ? ? -39.11 98.61 40 12 LYS A 19 ? ? -175.56 142.69 41 13 THR A 1 ? ? -73.64 -83.16 42 13 LYS A 2 ? ? -156.42 88.94 43 13 PRO A 3 ? ? -59.48 -174.41 44 13 GLN A 5 ? ? 67.69 65.96 45 13 PHE A 13 ? ? -38.98 97.74 46 14 PRO A 3 ? ? -52.84 179.10 47 14 GLN A 5 ? ? 63.65 63.03 48 14 PHE A 13 ? ? -38.84 98.79 49 14 ARG A 16 ? ? -64.43 99.76 50 14 LYS A 19 ? ? -170.55 133.09 51 15 PRO A 3 ? ? -67.13 -164.03 52 15 GLN A 5 ? ? 72.39 40.56 53 15 PHE A 13 ? ? -39.16 100.00 54 16 PHE A 13 ? ? -38.61 97.91 55 16 LYS A 19 ? ? -178.46 141.67 56 17 PRO A 3 ? ? -79.11 -165.84 57 17 PHE A 13 ? ? -38.22 98.36 58 17 LYS A 19 ? ? -173.12 142.85 59 18 PRO A 3 ? ? -70.38 -158.40 60 18 PHE A 13 ? ? -38.64 97.92 61 18 ARG A 16 ? ? -65.16 99.92 62 18 LYS A 19 ? ? 177.51 137.46 63 18 PRO A 21 ? ? -69.00 92.89 64 19 PRO A 3 ? ? -78.78 -156.39 65 19 PHE A 13 ? ? -39.42 98.37 66 19 LYS A 19 ? ? -175.81 123.86 67 19 PRO A 21 ? ? -64.34 94.50 68 20 PHE A 13 ? ? -38.75 97.98 69 20 LYS A 19 ? ? 178.97 124.43 # loop_ _pdbx_validate_peptide_omega.id _pdbx_validate_peptide_omega.PDB_model_num _pdbx_validate_peptide_omega.auth_comp_id_1 _pdbx_validate_peptide_omega.auth_asym_id_1 _pdbx_validate_peptide_omega.auth_seq_id_1 _pdbx_validate_peptide_omega.PDB_ins_code_1 _pdbx_validate_peptide_omega.label_alt_id_1 _pdbx_validate_peptide_omega.auth_comp_id_2 _pdbx_validate_peptide_omega.auth_asym_id_2 _pdbx_validate_peptide_omega.auth_seq_id_2 _pdbx_validate_peptide_omega.PDB_ins_code_2 _pdbx_validate_peptide_omega.label_alt_id_2 _pdbx_validate_peptide_omega.omega 1 6 LYS A 12 ? ? PHE A 13 ? ? -149.30 2 9 LYS A 12 ? ? PHE A 13 ? ? -148.25 3 14 LYS A 12 ? ? PHE A 13 ? ? -149.69 4 16 LYS A 12 ? ? PHE A 13 ? ? -145.97 5 18 LYS A 12 ? ? PHE A 13 ? ? -146.42 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLY N N N N 108 GLY CA C N N 109 GLY C C N N 110 GLY O O N N 111 GLY OXT O N N 112 GLY H H N N 113 GLY H2 H N N 114 GLY HA2 H N N 115 GLY HA3 H N N 116 GLY HXT H N N 117 ILE N N N N 118 ILE CA C N S 119 ILE C C N N 120 ILE O O N N 121 ILE CB C N S 122 ILE CG1 C N N 123 ILE CG2 C N N 124 ILE CD1 C N N 125 ILE OXT O N N 126 ILE H H N N 127 ILE H2 H N N 128 ILE HA H N N 129 ILE HB H N N 130 ILE HG12 H N N 131 ILE HG13 H N N 132 ILE HG21 H N N 133 ILE HG22 H N N 134 ILE HG23 H N N 135 ILE HD11 H N N 136 ILE HD12 H N N 137 ILE HD13 H N N 138 ILE HXT H N N 139 LYS N N N N 140 LYS CA C N S 141 LYS C C N N 142 LYS O O N N 143 LYS CB C N N 144 LYS CG C N N 145 LYS CD C N N 146 LYS CE C N N 147 LYS NZ N N N 148 LYS OXT O N N 149 LYS H H N N 150 LYS H2 H N N 151 LYS HA H N N 152 LYS HB2 H N N 153 LYS HB3 H N N 154 LYS HG2 H N N 155 LYS HG3 H N N 156 LYS HD2 H N N 157 LYS HD3 H N N 158 LYS HE2 H N N 159 LYS HE3 H N N 160 LYS HZ1 H N N 161 LYS HZ2 H N N 162 LYS HZ3 H N N 163 LYS HXT H N N 164 PHE N N N N 165 PHE CA C N S 166 PHE C C N N 167 PHE O O N N 168 PHE CB C N N 169 PHE CG C Y N 170 PHE CD1 C Y N 171 PHE CD2 C Y N 172 PHE CE1 C Y N 173 PHE CE2 C Y N 174 PHE CZ C Y N 175 PHE OXT O N N 176 PHE H H N N 177 PHE H2 H N N 178 PHE HA H N N 179 PHE HB2 H N N 180 PHE HB3 H N N 181 PHE HD1 H N N 182 PHE HD2 H N N 183 PHE HE1 H N N 184 PHE HE2 H N N 185 PHE HZ H N N 186 PHE HXT H N N 187 PRO N N N N 188 PRO CA C N S 189 PRO C C N N 190 PRO O O N N 191 PRO CB C N N 192 PRO CG C N N 193 PRO CD C N N 194 PRO OXT O N N 195 PRO H H N N 196 PRO HA H N N 197 PRO HB2 H N N 198 PRO HB3 H N N 199 PRO HG2 H N N 200 PRO HG3 H N N 201 PRO HD2 H N N 202 PRO HD3 H N N 203 PRO HXT H N N 204 SER N N N N 205 SER CA C N S 206 SER C C N N 207 SER O O N N 208 SER CB C N N 209 SER OG O N N 210 SER OXT O N N 211 SER H H N N 212 SER H2 H N N 213 SER HA H N N 214 SER HB2 H N N 215 SER HB3 H N N 216 SER HG H N N 217 SER HXT H N N 218 THR N N N N 219 THR CA C N S 220 THR C C N N 221 THR O O N N 222 THR CB C N R 223 THR OG1 O N N 224 THR CG2 C N N 225 THR OXT O N N 226 THR H H N N 227 THR H2 H N N 228 THR HA H N N 229 THR HB H N N 230 THR HG1 H N N 231 THR HG21 H N N 232 THR HG22 H N N 233 THR HG23 H N N 234 THR HXT H N N 235 VAL N N N N 236 VAL CA C N S 237 VAL C C N N 238 VAL O O N N 239 VAL CB C N N 240 VAL CG1 C N N 241 VAL CG2 C N N 242 VAL OXT O N N 243 VAL H H N N 244 VAL H2 H N N 245 VAL HA H N N 246 VAL HB H N N 247 VAL HG11 H N N 248 VAL HG12 H N N 249 VAL HG13 H N N 250 VAL HG21 H N N 251 VAL HG22 H N N 252 VAL HG23 H N N 253 VAL HXT H N N 254 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLY N CA sing N N 102 GLY N H sing N N 103 GLY N H2 sing N N 104 GLY CA C sing N N 105 GLY CA HA2 sing N N 106 GLY CA HA3 sing N N 107 GLY C O doub N N 108 GLY C OXT sing N N 109 GLY OXT HXT sing N N 110 ILE N CA sing N N 111 ILE N H sing N N 112 ILE N H2 sing N N 113 ILE CA C sing N N 114 ILE CA CB sing N N 115 ILE CA HA sing N N 116 ILE C O doub N N 117 ILE C OXT sing N N 118 ILE CB CG1 sing N N 119 ILE CB CG2 sing N N 120 ILE CB HB sing N N 121 ILE CG1 CD1 sing N N 122 ILE CG1 HG12 sing N N 123 ILE CG1 HG13 sing N N 124 ILE CG2 HG21 sing N N 125 ILE CG2 HG22 sing N N 126 ILE CG2 HG23 sing N N 127 ILE CD1 HD11 sing N N 128 ILE CD1 HD12 sing N N 129 ILE CD1 HD13 sing N N 130 ILE OXT HXT sing N N 131 LYS N CA sing N N 132 LYS N H sing N N 133 LYS N H2 sing N N 134 LYS CA C sing N N 135 LYS CA CB sing N N 136 LYS CA HA sing N N 137 LYS C O doub N N 138 LYS C OXT sing N N 139 LYS CB CG sing N N 140 LYS CB HB2 sing N N 141 LYS CB HB3 sing N N 142 LYS CG CD sing N N 143 LYS CG HG2 sing N N 144 LYS CG HG3 sing N N 145 LYS CD CE sing N N 146 LYS CD HD2 sing N N 147 LYS CD HD3 sing N N 148 LYS CE NZ sing N N 149 LYS CE HE2 sing N N 150 LYS CE HE3 sing N N 151 LYS NZ HZ1 sing N N 152 LYS NZ HZ2 sing N N 153 LYS NZ HZ3 sing N N 154 LYS OXT HXT sing N N 155 PHE N CA sing N N 156 PHE N H sing N N 157 PHE N H2 sing N N 158 PHE CA C sing N N 159 PHE CA CB sing N N 160 PHE CA HA sing N N 161 PHE C O doub N N 162 PHE C OXT sing N N 163 PHE CB CG sing N N 164 PHE CB HB2 sing N N 165 PHE CB HB3 sing N N 166 PHE CG CD1 doub Y N 167 PHE CG CD2 sing Y N 168 PHE CD1 CE1 sing Y N 169 PHE CD1 HD1 sing N N 170 PHE CD2 CE2 doub Y N 171 PHE CD2 HD2 sing N N 172 PHE CE1 CZ doub Y N 173 PHE CE1 HE1 sing N N 174 PHE CE2 CZ sing Y N 175 PHE CE2 HE2 sing N N 176 PHE CZ HZ sing N N 177 PHE OXT HXT sing N N 178 PRO N CA sing N N 179 PRO N CD sing N N 180 PRO N H sing N N 181 PRO CA C sing N N 182 PRO CA CB sing N N 183 PRO CA HA sing N N 184 PRO C O doub N N 185 PRO C OXT sing N N 186 PRO CB CG sing N N 187 PRO CB HB2 sing N N 188 PRO CB HB3 sing N N 189 PRO CG CD sing N N 190 PRO CG HG2 sing N N 191 PRO CG HG3 sing N N 192 PRO CD HD2 sing N N 193 PRO CD HD3 sing N N 194 PRO OXT HXT sing N N 195 SER N CA sing N N 196 SER N H sing N N 197 SER N H2 sing N N 198 SER CA C sing N N 199 SER CA CB sing N N 200 SER CA HA sing N N 201 SER C O doub N N 202 SER C OXT sing N N 203 SER CB OG sing N N 204 SER CB HB2 sing N N 205 SER CB HB3 sing N N 206 SER OG HG sing N N 207 SER OXT HXT sing N N 208 THR N CA sing N N 209 THR N H sing N N 210 THR N H2 sing N N 211 THR CA C sing N N 212 THR CA CB sing N N 213 THR CA HA sing N N 214 THR C O doub N N 215 THR C OXT sing N N 216 THR CB OG1 sing N N 217 THR CB CG2 sing N N 218 THR CB HB sing N N 219 THR OG1 HG1 sing N N 220 THR CG2 HG21 sing N N 221 THR CG2 HG22 sing N N 222 THR CG2 HG23 sing N N 223 THR OXT HXT sing N N 224 VAL N CA sing N N 225 VAL N H sing N N 226 VAL N H2 sing N N 227 VAL CA C sing N N 228 VAL CA CB sing N N 229 VAL CA HA sing N N 230 VAL C O doub N N 231 VAL C OXT sing N N 232 VAL CB CG1 sing N N 233 VAL CB CG2 sing N N 234 VAL CB HB sing N N 235 VAL CG1 HG11 sing N N 236 VAL CG1 HG12 sing N N 237 VAL CG1 HG13 sing N N 238 VAL CG2 HG21 sing N N 239 VAL CG2 HG22 sing N N 240 VAL CG2 HG23 sing N N 241 VAL OXT HXT sing N N 242 # _pdbx_audit_support.funding_organization 'Other government' _pdbx_audit_support.country 'United States' _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'NMR Distance Restraints' _pdbx_struct_assembly_auth_evidence.details 'not applicable' #