data_8UTK # _entry.id 8UTK # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.397 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 8UTK pdb_00008utk 10.2210/pdb8utk/pdb WWPDB D_1000278765 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2024-07-10 2 'Structure model' 1 1 2024-08-21 3 'Structure model' 1 2 2024-08-28 4 'Structure model' 1 3 2024-10-16 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' 3 4 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 3 'Structure model' citation 3 4 'Structure model' pdbx_entry_details 4 4 'Structure model' pdbx_modification_feature # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_volume' 2 2 'Structure model' '_citation.page_first' 3 2 'Structure model' '_citation.page_last' 4 3 'Structure model' '_citation.page_last' 5 4 'Structure model' '_pdbx_entry_details.has_protein_modification' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 8UTK _pdbx_database_status.recvd_initial_deposition_date 2023-10-31 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_contact_author.id 2 _pdbx_contact_author.email dabaker@uw.edu _pdbx_contact_author.name_first David _pdbx_contact_author.name_last Baker _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0001-7896-6217 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Bera, A.K.' 1 ? 'Berger, S.A.' 2 ? 'Kang, A.' 3 ? 'Baker, D.' 4 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Cell _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 1097-4172 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 187 _citation.language ? _citation.page_first 4305 _citation.page_last ? _citation.title 'Preclinical proof of principle for orally delivered Th17 antagonist miniproteins.' _citation.year 2024 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1016/j.cell.2024.05.052 _citation.pdbx_database_id_PubMed 38936360 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Berger, S.' 1 ? primary 'Seeger, F.' 2 ? primary 'Yu, T.Y.' 3 ? primary 'Aydin, M.' 4 ? primary 'Yang, H.' 5 ? primary 'Rosenblum, D.' 6 ? primary 'Guenin-Mace, L.' 7 ? primary 'Glassman, C.' 8 ? primary 'Arguinchona, L.' 9 ? primary 'Sniezek, C.' 10 ? primary 'Blackstone, A.' 11 ? primary 'Carter, L.' 12 ? primary 'Ravichandran, R.' 13 ? primary 'Ahlrichs, M.' 14 ? primary 'Murphy, M.' 15 ? primary 'Pultz, I.S.' 16 ? primary 'Kang, A.' 17 ? primary 'Bera, A.K.' 18 ? primary 'Stewart, L.' 19 ? primary 'Garcia, K.C.' 20 ? primary 'Naik, S.' 21 ? primary 'Spangler, J.B.' 22 ? primary 'Beigel, F.' 23 ? primary 'Siebeck, M.' 24 ? primary 'Gropp, R.' 25 ? primary 'Baker, D.' 26 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 23R-B04dslf02IB 6398.668 2 ? ? ? ? 2 non-polymer syn '1-(2-METHOXY-ETHOXY)-2-{2-[2-(2-METHOXY-ETHOXY]-ETHOXY}-ETHANE' 266.331 1 ? ? ? ? 3 non-polymer syn 'SULFATE ION' 96.063 1 ? ? ? ? 4 non-polymer syn '1-METHOXY-2-[2-(2-METHOXY-ETHOXY]-ETHANE' 178.226 1 ? ? ? ? 5 water nat water 18.015 25 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code MPLWQVFYLLNTCIKRTGDPTCKKLAKALRECLKKGDLKACNELADKAVKYINSLE _entity_poly.pdbx_seq_one_letter_code_can MPLWQVFYLLNTCIKRTGDPTCKKLAKALRECLKKGDLKACNELADKAVKYINSLE _entity_poly.pdbx_strand_id A,B _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 '1-(2-METHOXY-ETHOXY)-2-{2-[2-(2-METHOXY-ETHOXY]-ETHOXY}-ETHANE' PG6 3 'SULFATE ION' SO4 4 '1-METHOXY-2-[2-(2-METHOXY-ETHOXY]-ETHANE' PG5 5 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 PRO n 1 3 LEU n 1 4 TRP n 1 5 GLN n 1 6 VAL n 1 7 PHE n 1 8 TYR n 1 9 LEU n 1 10 LEU n 1 11 ASN n 1 12 THR n 1 13 CYS n 1 14 ILE n 1 15 LYS n 1 16 ARG n 1 17 THR n 1 18 GLY n 1 19 ASP n 1 20 PRO n 1 21 THR n 1 22 CYS n 1 23 LYS n 1 24 LYS n 1 25 LEU n 1 26 ALA n 1 27 LYS n 1 28 ALA n 1 29 LEU n 1 30 ARG n 1 31 GLU n 1 32 CYS n 1 33 LEU n 1 34 LYS n 1 35 LYS n 1 36 GLY n 1 37 ASP n 1 38 LEU n 1 39 LYS n 1 40 ALA n 1 41 CYS n 1 42 ASN n 1 43 GLU n 1 44 LEU n 1 45 ALA n 1 46 ASP n 1 47 LYS n 1 48 ALA n 1 49 VAL n 1 50 LYS n 1 51 TYR n 1 52 ILE n 1 53 ASN n 1 54 SER n 1 55 LEU n 1 56 GLU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 56 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'synthetic construct' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 32630 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PG5 non-polymer . '1-METHOXY-2-[2-(2-METHOXY-ETHOXY]-ETHANE' ? 'C8 H18 O4' 178.226 PG6 non-polymer . '1-(2-METHOXY-ETHOXY)-2-{2-[2-(2-METHOXY-ETHOXY]-ETHOXY}-ETHANE' ? 'C12 H26 O6' 266.331 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SO4 non-polymer . 'SULFATE ION' ? 'O4 S -2' 96.063 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 PRO 2 2 2 PRO PRO A . n A 1 3 LEU 3 3 3 LEU LEU A . n A 1 4 TRP 4 4 4 TRP TRP A . n A 1 5 GLN 5 5 5 GLN GLN A . n A 1 6 VAL 6 6 6 VAL VAL A . n A 1 7 PHE 7 7 7 PHE PHE A . n A 1 8 TYR 8 8 8 TYR TYR A . n A 1 9 LEU 9 9 9 LEU LEU A . n A 1 10 LEU 10 10 10 LEU LEU A . n A 1 11 ASN 11 11 11 ASN ASN A . n A 1 12 THR 12 12 12 THR THR A . n A 1 13 CYS 13 13 13 CYS CYS A . n A 1 14 ILE 14 14 14 ILE ILE A . n A 1 15 LYS 15 15 15 LYS LYS A . n A 1 16 ARG 16 16 16 ARG ARG A . n A 1 17 THR 17 17 17 THR THR A . n A 1 18 GLY 18 18 18 GLY GLY A . n A 1 19 ASP 19 19 19 ASP ASP A . n A 1 20 PRO 20 20 20 PRO PRO A . n A 1 21 THR 21 21 21 THR THR A . n A 1 22 CYS 22 22 22 CYS CYS A . n A 1 23 LYS 23 23 23 LYS LYS A . n A 1 24 LYS 24 24 24 LYS LYS A . n A 1 25 LEU 25 25 25 LEU LEU A . n A 1 26 ALA 26 26 26 ALA ALA A . n A 1 27 LYS 27 27 27 LYS LYS A . n A 1 28 ALA 28 28 28 ALA ALA A . n A 1 29 LEU 29 29 29 LEU LEU A . n A 1 30 ARG 30 30 30 ARG ARG A . n A 1 31 GLU 31 31 31 GLU GLU A . n A 1 32 CYS 32 32 32 CYS CYS A . n A 1 33 LEU 33 33 33 LEU LEU A . n A 1 34 LYS 34 34 34 LYS LYS A . n A 1 35 LYS 35 35 35 LYS LYS A . n A 1 36 GLY 36 36 36 GLY GLY A . n A 1 37 ASP 37 37 37 ASP ASP A . n A 1 38 LEU 38 38 38 LEU LEU A . n A 1 39 LYS 39 39 39 LYS LYS A . n A 1 40 ALA 40 40 40 ALA ALA A . n A 1 41 CYS 41 41 41 CYS CYS A . n A 1 42 ASN 42 42 42 ASN ASN A . n A 1 43 GLU 43 43 43 GLU GLU A . n A 1 44 LEU 44 44 44 LEU LEU A . n A 1 45 ALA 45 45 45 ALA ALA A . n A 1 46 ASP 46 46 46 ASP ASP A . n A 1 47 LYS 47 47 47 LYS LYS A . n A 1 48 ALA 48 48 48 ALA ALA A . n A 1 49 VAL 49 49 49 VAL VAL A . n A 1 50 LYS 50 50 50 LYS LYS A . n A 1 51 TYR 51 51 51 TYR TYR A . n A 1 52 ILE 52 52 52 ILE ILE A . n A 1 53 ASN 53 53 53 ASN ASN A . n A 1 54 SER 54 54 54 SER SER A . n A 1 55 LEU 55 55 55 LEU LEU A . n A 1 56 GLU 56 56 56 GLU GLU A . n B 1 1 MET 1 1 ? ? ? B . n B 1 2 PRO 2 2 2 PRO PRO B . n B 1 3 LEU 3 3 3 LEU LEU B . n B 1 4 TRP 4 4 4 TRP TRP B . n B 1 5 GLN 5 5 5 GLN GLN B . n B 1 6 VAL 6 6 6 VAL VAL B . n B 1 7 PHE 7 7 7 PHE PHE B . n B 1 8 TYR 8 8 8 TYR TYR B . n B 1 9 LEU 9 9 9 LEU LEU B . n B 1 10 LEU 10 10 10 LEU LEU B . n B 1 11 ASN 11 11 11 ASN ASN B . n B 1 12 THR 12 12 12 THR THR B . n B 1 13 CYS 13 13 13 CYS CYS B . n B 1 14 ILE 14 14 14 ILE ILE B . n B 1 15 LYS 15 15 15 LYS LYS B . n B 1 16 ARG 16 16 16 ARG ARG B . n B 1 17 THR 17 17 17 THR THR B . n B 1 18 GLY 18 18 18 GLY GLY B . n B 1 19 ASP 19 19 19 ASP ASP B . n B 1 20 PRO 20 20 20 PRO PRO B . n B 1 21 THR 21 21 21 THR THR B . n B 1 22 CYS 22 22 22 CYS CYS B . n B 1 23 LYS 23 23 23 LYS LYS B . n B 1 24 LYS 24 24 24 LYS LYS B . n B 1 25 LEU 25 25 25 LEU LEU B . n B 1 26 ALA 26 26 26 ALA ALA B . n B 1 27 LYS 27 27 27 LYS LYS B . n B 1 28 ALA 28 28 28 ALA ALA B . n B 1 29 LEU 29 29 29 LEU LEU B . n B 1 30 ARG 30 30 30 ARG ARG B . n B 1 31 GLU 31 31 31 GLU GLU B . n B 1 32 CYS 32 32 32 CYS CYS B . n B 1 33 LEU 33 33 33 LEU LEU B . n B 1 34 LYS 34 34 34 LYS LYS B . n B 1 35 LYS 35 35 35 LYS LYS B . n B 1 36 GLY 36 36 36 GLY GLY B . n B 1 37 ASP 37 37 37 ASP ASP B . n B 1 38 LEU 38 38 38 LEU LEU B . n B 1 39 LYS 39 39 39 LYS LYS B . n B 1 40 ALA 40 40 40 ALA ALA B . n B 1 41 CYS 41 41 41 CYS CYS B . n B 1 42 ASN 42 42 42 ASN ASN B . n B 1 43 GLU 43 43 43 GLU GLU B . n B 1 44 LEU 44 44 44 LEU LEU B . n B 1 45 ALA 45 45 45 ALA ALA B . n B 1 46 ASP 46 46 46 ASP ASP B . n B 1 47 LYS 47 47 47 LYS LYS B . n B 1 48 ALA 48 48 48 ALA ALA B . n B 1 49 VAL 49 49 49 VAL VAL B . n B 1 50 LYS 50 50 50 LYS LYS B . n B 1 51 TYR 51 51 51 TYR TYR B . n B 1 52 ILE 52 52 52 ILE ILE B . n B 1 53 ASN 53 53 53 ASN ASN B . n B 1 54 SER 54 54 54 SER SER B . n B 1 55 LEU 55 55 55 LEU LEU B . n B 1 56 GLU 56 56 56 GLU GLU B . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 2 PG6 1 101 2 PG6 PG6 A . D 3 SO4 1 101 101 SO4 SO4 B . E 4 PG5 1 102 3 PG5 PG5 B . F 5 HOH 1 201 13 HOH HOH A . F 5 HOH 2 202 3 HOH HOH A . F 5 HOH 3 203 23 HOH HOH A . F 5 HOH 4 204 25 HOH HOH A . F 5 HOH 5 205 24 HOH HOH A . F 5 HOH 6 206 11 HOH HOH A . F 5 HOH 7 207 9 HOH HOH A . F 5 HOH 8 208 5 HOH HOH A . F 5 HOH 9 209 18 HOH HOH A . F 5 HOH 10 210 7 HOH HOH A . G 5 HOH 1 201 12 HOH HOH B . G 5 HOH 2 202 8 HOH HOH B . G 5 HOH 3 203 4 HOH HOH B . G 5 HOH 4 204 2 HOH HOH B . G 5 HOH 5 205 20 HOH HOH B . G 5 HOH 6 206 1 HOH HOH B . G 5 HOH 7 207 15 HOH HOH B . G 5 HOH 8 208 10 HOH HOH B . G 5 HOH 9 209 19 HOH HOH B . G 5 HOH 10 210 21 HOH HOH B . G 5 HOH 11 211 14 HOH HOH B . G 5 HOH 12 212 22 HOH HOH B . G 5 HOH 13 213 17 HOH HOH B . G 5 HOH 14 214 6 HOH HOH B . G 5 HOH 15 215 16 HOH HOH B . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 N 1 A PG6 101 ? O6 ? C PG6 1 O6 2 1 N 1 A PG6 101 ? C12 ? C PG6 1 C12 3 1 N 1 B PG5 102 ? C1 ? E PG5 1 C1 4 1 N 1 B PG5 102 ? C8 ? E PG5 1 C8 # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.19.1_4122 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 120.000 _cell.angle_gamma_esd ? _cell.entry_id 8UTK _cell.details ? _cell.formula_units_Z ? _cell.length_a 55.414 _cell.length_a_esd ? _cell.length_b 55.414 _cell.length_b_esd ? _cell.length_c 85.834 _cell.length_c_esd ? _cell.volume 228259.564 _cell.volume_esd ? _cell.Z_PDB 12 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 8UTK _symmetry.cell_setting ? _symmetry.Int_Tables_number 152 _symmetry.space_group_name_Hall ;P 31 2" ; _symmetry.space_group_name_H-M 'P 31 2 1' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 8UTK _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.97 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 58.6 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 4.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.2 M Lithium sulfate 0.1 M Sodium acetate pH 4.5 and 50% (v/v) PEG 400.' _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 293 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER2 X 16M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2021-03-19 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97918 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'APS BEAMLINE 24-ID-C' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.97918 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 24-ID-C _diffrn_source.pdbx_synchrotron_site APS # _reflns.B_iso_Wilson_estimate 38.93 _reflns.entry_id 8UTK _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.94 _reflns.d_resolution_low 47.99 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 11624 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 98.79 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 20.0 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 3.62 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all 0.1164 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.979 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs 0.511 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 1.94 _reflns_shell.d_res_low 2.009 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 0.77 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 1121 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 20.4 _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all 0.5828 _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.372 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.percent_possible_all 98.16 _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 2.587 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 44.43 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 8UTK _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.94 _refine.ls_d_res_low 47.99 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 11621 _refine.ls_number_reflns_R_free 601 _refine.ls_number_reflns_R_work 11020 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 98.79 _refine.ls_percent_reflns_R_free 5.17 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2205 _refine.ls_R_factor_R_free 0.2673 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2180 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.36 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values 'GeoStd + Monomer Library + CDL v1.2' _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 31.6012 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.2540 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 1.94 _refine_hist.d_res_low 47.99 _refine_hist.number_atoms_solvent 25 _refine_hist.number_atoms_total 928 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 872 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 31 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.0064 ? 916 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.7718 ? 1219 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.0386 ? 139 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.0046 ? 143 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 13.7059 ? 361 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free _refine_ls_shell.R_factor_R_free 'X-RAY DIFFRACTION' 1.94 2.14 . . 152 2672 98.09 . . . . 0.3259 . . . . . . . . . . . 0.3276 'X-RAY DIFFRACTION' 2.14 2.44 . . 143 2701 98.51 . . . . 0.2099 . . . . . . . . . . . 0.2877 'X-RAY DIFFRACTION' 2.44 3.08 . . 157 2751 99.05 . . . . 0.2429 . . . . . . . . . . . 0.2940 'X-RAY DIFFRACTION' 3.08 47.99 . . 149 2896 99.54 . . . . 0.1961 . . . . . . . . . . . 0.2419 # _struct.entry_id 8UTK _struct.title 'IL-23R minibinder - 23R-B04dslf02IB' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 8UTK _struct_keywords.text 'Computational design, selective inhibitors, IL-2 IL-17 cytokines DE NOVO PROTEIN, DE NOVO PROTEIN' _struct_keywords.pdbx_keywords 'DE NOVO PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? C N N 2 ? D N N 3 ? E N N 4 ? F N N 5 ? G N N 5 ? # _struct_ref.id 1 _struct_ref.db_name PDB _struct_ref.db_code 8UTK _struct_ref.pdbx_db_accession 8UTK _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin 1 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 8UTK A 1 ? 56 ? 8UTK 1 ? 56 ? 1 56 2 1 8UTK B 1 ? 56 ? 8UTK 1 ? 56 ? 1 56 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 1890 ? 1 MORE -20 ? 1 'SSA (A^2)' 7360 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F,G # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 PRO A 2 ? GLY A 18 ? PRO A 2 GLY A 18 1 ? 17 HELX_P HELX_P2 AA2 ASP A 19 ? GLY A 36 ? ASP A 19 GLY A 36 1 ? 18 HELX_P HELX_P3 AA3 ASP A 37 ? GLU A 56 ? ASP A 37 GLU A 56 1 ? 20 HELX_P HELX_P4 AA4 LEU B 3 ? GLY B 18 ? LEU B 3 GLY B 18 1 ? 16 HELX_P HELX_P5 AA5 ASP B 19 ? LYS B 35 ? ASP B 19 LYS B 35 1 ? 17 HELX_P HELX_P6 AA6 ASP B 37 ? GLU B 56 ? ASP B 37 GLU B 56 1 ? 20 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 13 SG ? ? ? 1_555 A CYS 22 SG ? ? A CYS 13 A CYS 22 1_555 ? ? ? ? ? ? ? 2.077 ? ? disulf2 disulf ? ? A CYS 32 SG ? ? ? 1_555 A CYS 41 SG ? ? A CYS 32 A CYS 41 1_555 ? ? ? ? ? ? ? 2.087 ? ? disulf3 disulf ? ? B CYS 13 SG ? ? ? 1_555 B CYS 22 SG ? ? B CYS 13 B CYS 22 1_555 ? ? ? ? ? ? ? 2.092 ? ? disulf4 disulf ? ? B CYS 32 SG A ? ? 1_555 B CYS 41 SG ? ? B CYS 32 B CYS 41 1_555 ? ? ? ? ? ? ? 2.051 ? ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 CYS A 13 ? CYS A 22 ? CYS A 13 ? 1_555 CYS A 22 ? 1_555 SG SG . . . None 'Disulfide bridge' 2 CYS A 32 ? CYS A 41 ? CYS A 32 ? 1_555 CYS A 41 ? 1_555 SG SG . . . None 'Disulfide bridge' 3 CYS B 13 ? CYS B 22 ? CYS B 13 ? 1_555 CYS B 22 ? 1_555 SG SG . . . None 'Disulfide bridge' 4 CYS B 32 A CYS B 41 ? CYS B 32 ? 1_555 CYS B 41 ? 1_555 SG SG . . . None 'Disulfide bridge' # _pdbx_entry_details.entry_id 8UTK _pdbx_entry_details.has_ligand_of_interest N _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_protein_modification Y # loop_ _space_group_symop.id _space_group_symop.operation_xyz 1 x,y,z 2 -y,x-y,z+1/3 3 -x+y,-x,z+2/3 4 x-y,-y,-z+2/3 5 -x,-x+y,-z+1/3 6 y,x,-z # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 B MET 1 ? B MET 1 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HOH O O N N 137 HOH H1 H N N 138 HOH H2 H N N 139 ILE N N N N 140 ILE CA C N S 141 ILE C C N N 142 ILE O O N N 143 ILE CB C N S 144 ILE CG1 C N N 145 ILE CG2 C N N 146 ILE CD1 C N N 147 ILE OXT O N N 148 ILE H H N N 149 ILE H2 H N N 150 ILE HA H N N 151 ILE HB H N N 152 ILE HG12 H N N 153 ILE HG13 H N N 154 ILE HG21 H N N 155 ILE HG22 H N N 156 ILE HG23 H N N 157 ILE HD11 H N N 158 ILE HD12 H N N 159 ILE HD13 H N N 160 ILE HXT H N N 161 LEU N N N N 162 LEU CA C N S 163 LEU C C N N 164 LEU O O N N 165 LEU CB C N N 166 LEU CG C N N 167 LEU CD1 C N N 168 LEU CD2 C N N 169 LEU OXT O N N 170 LEU H H N N 171 LEU H2 H N N 172 LEU HA H N N 173 LEU HB2 H N N 174 LEU HB3 H N N 175 LEU HG H N N 176 LEU HD11 H N N 177 LEU HD12 H N N 178 LEU HD13 H N N 179 LEU HD21 H N N 180 LEU HD22 H N N 181 LEU HD23 H N N 182 LEU HXT H N N 183 LYS N N N N 184 LYS CA C N S 185 LYS C C N N 186 LYS O O N N 187 LYS CB C N N 188 LYS CG C N N 189 LYS CD C N N 190 LYS CE C N N 191 LYS NZ N N N 192 LYS OXT O N N 193 LYS H H N N 194 LYS H2 H N N 195 LYS HA H N N 196 LYS HB2 H N N 197 LYS HB3 H N N 198 LYS HG2 H N N 199 LYS HG3 H N N 200 LYS HD2 H N N 201 LYS HD3 H N N 202 LYS HE2 H N N 203 LYS HE3 H N N 204 LYS HZ1 H N N 205 LYS HZ2 H N N 206 LYS HZ3 H N N 207 LYS HXT H N N 208 MET N N N N 209 MET CA C N S 210 MET C C N N 211 MET O O N N 212 MET CB C N N 213 MET CG C N N 214 MET SD S N N 215 MET CE C N N 216 MET OXT O N N 217 MET H H N N 218 MET H2 H N N 219 MET HA H N N 220 MET HB2 H N N 221 MET HB3 H N N 222 MET HG2 H N N 223 MET HG3 H N N 224 MET HE1 H N N 225 MET HE2 H N N 226 MET HE3 H N N 227 MET HXT H N N 228 PG5 C1 C N N 229 PG5 O1 O N N 230 PG5 C2 C N N 231 PG5 C3 C N N 232 PG5 O2 O N N 233 PG5 C4 C N N 234 PG5 C5 C N N 235 PG5 O3 O N N 236 PG5 C6 C N N 237 PG5 C7 C N N 238 PG5 O4 O N N 239 PG5 C8 C N N 240 PG5 H11 H N N 241 PG5 H12 H N N 242 PG5 H13 H N N 243 PG5 H21 H N N 244 PG5 H22 H N N 245 PG5 H31 H N N 246 PG5 H32 H N N 247 PG5 H41 H N N 248 PG5 H42 H N N 249 PG5 H51 H N N 250 PG5 H52 H N N 251 PG5 H61 H N N 252 PG5 H62 H N N 253 PG5 H71 H N N 254 PG5 H72 H N N 255 PG5 H81 H N N 256 PG5 H82 H N N 257 PG5 H83 H N N 258 PG6 C1 C N N 259 PG6 O1 O N N 260 PG6 C2 C N N 261 PG6 C3 C N N 262 PG6 O2 O N N 263 PG6 C4 C N N 264 PG6 C5 C N N 265 PG6 O3 O N N 266 PG6 C6 C N N 267 PG6 C7 C N N 268 PG6 O4 O N N 269 PG6 C8 C N N 270 PG6 C9 C N N 271 PG6 O5 O N N 272 PG6 C10 C N N 273 PG6 C11 C N N 274 PG6 O6 O N N 275 PG6 C12 C N N 276 PG6 H11 H N N 277 PG6 H12 H N N 278 PG6 H13 H N N 279 PG6 H21 H N N 280 PG6 H22 H N N 281 PG6 H31 H N N 282 PG6 H32 H N N 283 PG6 H41 H N N 284 PG6 H42 H N N 285 PG6 H51 H N N 286 PG6 H52 H N N 287 PG6 H61 H N N 288 PG6 H62 H N N 289 PG6 H71 H N N 290 PG6 H72 H N N 291 PG6 H81 H N N 292 PG6 H82 H N N 293 PG6 H91 H N N 294 PG6 H92 H N N 295 PG6 H101 H N N 296 PG6 H102 H N N 297 PG6 H111 H N N 298 PG6 H112 H N N 299 PG6 H121 H N N 300 PG6 H122 H N N 301 PG6 H123 H N N 302 PHE N N N N 303 PHE CA C N S 304 PHE C C N N 305 PHE O O N N 306 PHE CB C N N 307 PHE CG C Y N 308 PHE CD1 C Y N 309 PHE CD2 C Y N 310 PHE CE1 C Y N 311 PHE CE2 C Y N 312 PHE CZ C Y N 313 PHE OXT O N N 314 PHE H H N N 315 PHE H2 H N N 316 PHE HA H N N 317 PHE HB2 H N N 318 PHE HB3 H N N 319 PHE HD1 H N N 320 PHE HD2 H N N 321 PHE HE1 H N N 322 PHE HE2 H N N 323 PHE HZ H N N 324 PHE HXT H N N 325 PRO N N N N 326 PRO CA C N S 327 PRO C C N N 328 PRO O O N N 329 PRO CB C N N 330 PRO CG C N N 331 PRO CD C N N 332 PRO OXT O N N 333 PRO H H N N 334 PRO HA H N N 335 PRO HB2 H N N 336 PRO HB3 H N N 337 PRO HG2 H N N 338 PRO HG3 H N N 339 PRO HD2 H N N 340 PRO HD3 H N N 341 PRO HXT H N N 342 SER N N N N 343 SER CA C N S 344 SER C C N N 345 SER O O N N 346 SER CB C N N 347 SER OG O N N 348 SER OXT O N N 349 SER H H N N 350 SER H2 H N N 351 SER HA H N N 352 SER HB2 H N N 353 SER HB3 H N N 354 SER HG H N N 355 SER HXT H N N 356 SO4 S S N N 357 SO4 O1 O N N 358 SO4 O2 O N N 359 SO4 O3 O N N 360 SO4 O4 O N N 361 THR N N N N 362 THR CA C N S 363 THR C C N N 364 THR O O N N 365 THR CB C N R 366 THR OG1 O N N 367 THR CG2 C N N 368 THR OXT O N N 369 THR H H N N 370 THR H2 H N N 371 THR HA H N N 372 THR HB H N N 373 THR HG1 H N N 374 THR HG21 H N N 375 THR HG22 H N N 376 THR HG23 H N N 377 THR HXT H N N 378 TRP N N N N 379 TRP CA C N S 380 TRP C C N N 381 TRP O O N N 382 TRP CB C N N 383 TRP CG C Y N 384 TRP CD1 C Y N 385 TRP CD2 C Y N 386 TRP NE1 N Y N 387 TRP CE2 C Y N 388 TRP CE3 C Y N 389 TRP CZ2 C Y N 390 TRP CZ3 C Y N 391 TRP CH2 C Y N 392 TRP OXT O N N 393 TRP H H N N 394 TRP H2 H N N 395 TRP HA H N N 396 TRP HB2 H N N 397 TRP HB3 H N N 398 TRP HD1 H N N 399 TRP HE1 H N N 400 TRP HE3 H N N 401 TRP HZ2 H N N 402 TRP HZ3 H N N 403 TRP HH2 H N N 404 TRP HXT H N N 405 TYR N N N N 406 TYR CA C N S 407 TYR C C N N 408 TYR O O N N 409 TYR CB C N N 410 TYR CG C Y N 411 TYR CD1 C Y N 412 TYR CD2 C Y N 413 TYR CE1 C Y N 414 TYR CE2 C Y N 415 TYR CZ C Y N 416 TYR OH O N N 417 TYR OXT O N N 418 TYR H H N N 419 TYR H2 H N N 420 TYR HA H N N 421 TYR HB2 H N N 422 TYR HB3 H N N 423 TYR HD1 H N N 424 TYR HD2 H N N 425 TYR HE1 H N N 426 TYR HE2 H N N 427 TYR HH H N N 428 TYR HXT H N N 429 VAL N N N N 430 VAL CA C N S 431 VAL C C N N 432 VAL O O N N 433 VAL CB C N N 434 VAL CG1 C N N 435 VAL CG2 C N N 436 VAL OXT O N N 437 VAL H H N N 438 VAL H2 H N N 439 VAL HA H N N 440 VAL HB H N N 441 VAL HG11 H N N 442 VAL HG12 H N N 443 VAL HG13 H N N 444 VAL HG21 H N N 445 VAL HG22 H N N 446 VAL HG23 H N N 447 VAL HXT H N N 448 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HOH O H1 sing N N 129 HOH O H2 sing N N 130 ILE N CA sing N N 131 ILE N H sing N N 132 ILE N H2 sing N N 133 ILE CA C sing N N 134 ILE CA CB sing N N 135 ILE CA HA sing N N 136 ILE C O doub N N 137 ILE C OXT sing N N 138 ILE CB CG1 sing N N 139 ILE CB CG2 sing N N 140 ILE CB HB sing N N 141 ILE CG1 CD1 sing N N 142 ILE CG1 HG12 sing N N 143 ILE CG1 HG13 sing N N 144 ILE CG2 HG21 sing N N 145 ILE CG2 HG22 sing N N 146 ILE CG2 HG23 sing N N 147 ILE CD1 HD11 sing N N 148 ILE CD1 HD12 sing N N 149 ILE CD1 HD13 sing N N 150 ILE OXT HXT sing N N 151 LEU N CA sing N N 152 LEU N H sing N N 153 LEU N H2 sing N N 154 LEU CA C sing N N 155 LEU CA CB sing N N 156 LEU CA HA sing N N 157 LEU C O doub N N 158 LEU C OXT sing N N 159 LEU CB CG sing N N 160 LEU CB HB2 sing N N 161 LEU CB HB3 sing N N 162 LEU CG CD1 sing N N 163 LEU CG CD2 sing N N 164 LEU CG HG sing N N 165 LEU CD1 HD11 sing N N 166 LEU CD1 HD12 sing N N 167 LEU CD1 HD13 sing N N 168 LEU CD2 HD21 sing N N 169 LEU CD2 HD22 sing N N 170 LEU CD2 HD23 sing N N 171 LEU OXT HXT sing N N 172 LYS N CA sing N N 173 LYS N H sing N N 174 LYS N H2 sing N N 175 LYS CA C sing N N 176 LYS CA CB sing N N 177 LYS CA HA sing N N 178 LYS C O doub N N 179 LYS C OXT sing N N 180 LYS CB CG sing N N 181 LYS CB HB2 sing N N 182 LYS CB HB3 sing N N 183 LYS CG CD sing N N 184 LYS CG HG2 sing N N 185 LYS CG HG3 sing N N 186 LYS CD CE sing N N 187 LYS CD HD2 sing N N 188 LYS CD HD3 sing N N 189 LYS CE NZ sing N N 190 LYS CE HE2 sing N N 191 LYS CE HE3 sing N N 192 LYS NZ HZ1 sing N N 193 LYS NZ HZ2 sing N N 194 LYS NZ HZ3 sing N N 195 LYS OXT HXT sing N N 196 MET N CA sing N N 197 MET N H sing N N 198 MET N H2 sing N N 199 MET CA C sing N N 200 MET CA CB sing N N 201 MET CA HA sing N N 202 MET C O doub N N 203 MET C OXT sing N N 204 MET CB CG sing N N 205 MET CB HB2 sing N N 206 MET CB HB3 sing N N 207 MET CG SD sing N N 208 MET CG HG2 sing N N 209 MET CG HG3 sing N N 210 MET SD CE sing N N 211 MET CE HE1 sing N N 212 MET CE HE2 sing N N 213 MET CE HE3 sing N N 214 MET OXT HXT sing N N 215 PG5 C1 O1 sing N N 216 PG5 C1 H11 sing N N 217 PG5 C1 H12 sing N N 218 PG5 C1 H13 sing N N 219 PG5 O1 C2 sing N N 220 PG5 C2 C3 sing N N 221 PG5 C2 H21 sing N N 222 PG5 C2 H22 sing N N 223 PG5 C3 O2 sing N N 224 PG5 C3 H31 sing N N 225 PG5 C3 H32 sing N N 226 PG5 O2 C4 sing N N 227 PG5 C4 C5 sing N N 228 PG5 C4 H41 sing N N 229 PG5 C4 H42 sing N N 230 PG5 C5 O3 sing N N 231 PG5 C5 H51 sing N N 232 PG5 C5 H52 sing N N 233 PG5 O3 C6 sing N N 234 PG5 C6 C7 sing N N 235 PG5 C6 H61 sing N N 236 PG5 C6 H62 sing N N 237 PG5 C7 O4 sing N N 238 PG5 C7 H71 sing N N 239 PG5 C7 H72 sing N N 240 PG5 O4 C8 sing N N 241 PG5 C8 H81 sing N N 242 PG5 C8 H82 sing N N 243 PG5 C8 H83 sing N N 244 PG6 C1 O1 sing N N 245 PG6 C1 H11 sing N N 246 PG6 C1 H12 sing N N 247 PG6 C1 H13 sing N N 248 PG6 O1 C2 sing N N 249 PG6 C2 C3 sing N N 250 PG6 C2 H21 sing N N 251 PG6 C2 H22 sing N N 252 PG6 C3 O2 sing N N 253 PG6 C3 H31 sing N N 254 PG6 C3 H32 sing N N 255 PG6 O2 C4 sing N N 256 PG6 C4 C5 sing N N 257 PG6 C4 H41 sing N N 258 PG6 C4 H42 sing N N 259 PG6 C5 O3 sing N N 260 PG6 C5 H51 sing N N 261 PG6 C5 H52 sing N N 262 PG6 O3 C6 sing N N 263 PG6 C6 C7 sing N N 264 PG6 C6 H61 sing N N 265 PG6 C6 H62 sing N N 266 PG6 C7 O4 sing N N 267 PG6 C7 H71 sing N N 268 PG6 C7 H72 sing N N 269 PG6 O4 C8 sing N N 270 PG6 C8 C9 sing N N 271 PG6 C8 H81 sing N N 272 PG6 C8 H82 sing N N 273 PG6 C9 O5 sing N N 274 PG6 C9 H91 sing N N 275 PG6 C9 H92 sing N N 276 PG6 O5 C10 sing N N 277 PG6 C10 C11 sing N N 278 PG6 C10 H101 sing N N 279 PG6 C10 H102 sing N N 280 PG6 C11 O6 sing N N 281 PG6 C11 H111 sing N N 282 PG6 C11 H112 sing N N 283 PG6 O6 C12 sing N N 284 PG6 C12 H121 sing N N 285 PG6 C12 H122 sing N N 286 PG6 C12 H123 sing N N 287 PHE N CA sing N N 288 PHE N H sing N N 289 PHE N H2 sing N N 290 PHE CA C sing N N 291 PHE CA CB sing N N 292 PHE CA HA sing N N 293 PHE C O doub N N 294 PHE C OXT sing N N 295 PHE CB CG sing N N 296 PHE CB HB2 sing N N 297 PHE CB HB3 sing N N 298 PHE CG CD1 doub Y N 299 PHE CG CD2 sing Y N 300 PHE CD1 CE1 sing Y N 301 PHE CD1 HD1 sing N N 302 PHE CD2 CE2 doub Y N 303 PHE CD2 HD2 sing N N 304 PHE CE1 CZ doub Y N 305 PHE CE1 HE1 sing N N 306 PHE CE2 CZ sing Y N 307 PHE CE2 HE2 sing N N 308 PHE CZ HZ sing N N 309 PHE OXT HXT sing N N 310 PRO N CA sing N N 311 PRO N CD sing N N 312 PRO N H sing N N 313 PRO CA C sing N N 314 PRO CA CB sing N N 315 PRO CA HA sing N N 316 PRO C O doub N N 317 PRO C OXT sing N N 318 PRO CB CG sing N N 319 PRO CB HB2 sing N N 320 PRO CB HB3 sing N N 321 PRO CG CD sing N N 322 PRO CG HG2 sing N N 323 PRO CG HG3 sing N N 324 PRO CD HD2 sing N N 325 PRO CD HD3 sing N N 326 PRO OXT HXT sing N N 327 SER N CA sing N N 328 SER N H sing N N 329 SER N H2 sing N N 330 SER CA C sing N N 331 SER CA CB sing N N 332 SER CA HA sing N N 333 SER C O doub N N 334 SER C OXT sing N N 335 SER CB OG sing N N 336 SER CB HB2 sing N N 337 SER CB HB3 sing N N 338 SER OG HG sing N N 339 SER OXT HXT sing N N 340 SO4 S O1 doub N N 341 SO4 S O2 doub N N 342 SO4 S O3 sing N N 343 SO4 S O4 sing N N 344 THR N CA sing N N 345 THR N H sing N N 346 THR N H2 sing N N 347 THR CA C sing N N 348 THR CA CB sing N N 349 THR CA HA sing N N 350 THR C O doub N N 351 THR C OXT sing N N 352 THR CB OG1 sing N N 353 THR CB CG2 sing N N 354 THR CB HB sing N N 355 THR OG1 HG1 sing N N 356 THR CG2 HG21 sing N N 357 THR CG2 HG22 sing N N 358 THR CG2 HG23 sing N N 359 THR OXT HXT sing N N 360 TRP N CA sing N N 361 TRP N H sing N N 362 TRP N H2 sing N N 363 TRP CA C sing N N 364 TRP CA CB sing N N 365 TRP CA HA sing N N 366 TRP C O doub N N 367 TRP C OXT sing N N 368 TRP CB CG sing N N 369 TRP CB HB2 sing N N 370 TRP CB HB3 sing N N 371 TRP CG CD1 doub Y N 372 TRP CG CD2 sing Y N 373 TRP CD1 NE1 sing Y N 374 TRP CD1 HD1 sing N N 375 TRP CD2 CE2 doub Y N 376 TRP CD2 CE3 sing Y N 377 TRP NE1 CE2 sing Y N 378 TRP NE1 HE1 sing N N 379 TRP CE2 CZ2 sing Y N 380 TRP CE3 CZ3 doub Y N 381 TRP CE3 HE3 sing N N 382 TRP CZ2 CH2 doub Y N 383 TRP CZ2 HZ2 sing N N 384 TRP CZ3 CH2 sing Y N 385 TRP CZ3 HZ3 sing N N 386 TRP CH2 HH2 sing N N 387 TRP OXT HXT sing N N 388 TYR N CA sing N N 389 TYR N H sing N N 390 TYR N H2 sing N N 391 TYR CA C sing N N 392 TYR CA CB sing N N 393 TYR CA HA sing N N 394 TYR C O doub N N 395 TYR C OXT sing N N 396 TYR CB CG sing N N 397 TYR CB HB2 sing N N 398 TYR CB HB3 sing N N 399 TYR CG CD1 doub Y N 400 TYR CG CD2 sing Y N 401 TYR CD1 CE1 sing Y N 402 TYR CD1 HD1 sing N N 403 TYR CD2 CE2 doub Y N 404 TYR CD2 HD2 sing N N 405 TYR CE1 CZ doub Y N 406 TYR CE1 HE1 sing N N 407 TYR CE2 CZ sing Y N 408 TYR CE2 HE2 sing N N 409 TYR CZ OH sing N N 410 TYR OH HH sing N N 411 TYR OXT HXT sing N N 412 VAL N CA sing N N 413 VAL N H sing N N 414 VAL N H2 sing N N 415 VAL CA C sing N N 416 VAL CA CB sing N N 417 VAL CA HA sing N N 418 VAL C O doub N N 419 VAL C OXT sing N N 420 VAL CB CG1 sing N N 421 VAL CB CG2 sing N N 422 VAL CB HB sing N N 423 VAL CG1 HG11 sing N N 424 VAL CG1 HG12 sing N N 425 VAL CG1 HG13 sing N N 426 VAL CG2 HG21 sing N N 427 VAL CG2 HG22 sing N N 428 VAL CG2 HG23 sing N N 429 VAL OXT HXT sing N N 430 # _pdbx_audit_support.funding_organization 'Howard Hughes Medical Institute (HHMI)' _pdbx_audit_support.country 'United States' _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type other _pdbx_initial_refinement_model.source_name Other _pdbx_initial_refinement_model.accession_code ? _pdbx_initial_refinement_model.details 'De no vo designed model' # _space_group.name_H-M_alt 'P 31 2 1' _space_group.name_Hall ;P 31 2" ; _space_group.IT_number 152 _space_group.crystal_system trigonal _space_group.id 1 # _atom_sites.entry_id 8UTK _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 0.018046 _atom_sites.fract_transf_matrix[1][2] 0.010419 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.020838 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.011650 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.scat_dispersion_real _atom_type.scat_dispersion_imag _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c _atom_type.scat_source _atom_type.scat_dispersion_source C ? ? 3.54356 2.42580 ? ? 25.62398 1.50364 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? N ? ? 4.01032 2.96436 ? ? 19.97189 1.75589 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O ? ? 4.49882 3.47563 ? ? 15.80542 1.70748 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? S ? ? 9.55732 6.39887 ? ? 1.23737 29.19336 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? # loop_