data_8VAB # _entry.id 8VAB # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.398 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 8VAB pdb_00008vab 10.2210/pdb8vab/pdb WWPDB D_1000279824 ? ? # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2024-11-06 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 8VAB _pdbx_database_status.recvd_initial_deposition_date 2023-12-11 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_contact_author.id 2 _pdbx_contact_author.email tmmakris@ncsu.edu _pdbx_contact_author.name_first Thomas _pdbx_contact_author.name_last Makris _pdbx_contact_author.name_mi M _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0001-7927-620X # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Phan, H.N.' 1 0000-0002-2949-8944 'Swartz, P.D.' 2 ? 'Makris, T.M.' 3 0000-0001-7927-620X # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Biochemistry _citation.journal_id_ASTM BICHAW _citation.journal_id_CSD 0033 _citation.journal_id_ISSN 0006-2960 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title ;Assembly of a Heterobimetallic Fe/Mn Cofactor in the para -Aminobenzoate Synthase Chlamydia Protein Associating with Death Domains (CADD) Initiates Long-Range Radical Hole-Hopping. ; _citation.year 2024 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1021/acs.biochem.4c00326 _citation.pdbx_database_id_PubMed 39471288 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Phan, H.N.' 1 0000-0002-2949-8944 primary 'Swartz, P.D.' 2 ? primary 'Gangopadhyay, M.' 3 0009-0006-4739-6833 primary 'Guo, Y.' 4 0000-0002-4132-3565 primary 'Smirnov, A.I.' 5 0000-0002-0037-2555 primary 'Makris, T.M.' 6 0000-0001-7927-620X # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man '4-aminobenzoate synthase' 27769.285 1 ? ? ? ? 2 non-polymer syn 'FE (II) ION' 55.845 2 ? ? ? ? 3 water nat water 18.015 32 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MGSSHHHHHHSSGLVPRGSHMMEVFMNFLDQLDLIIQNKHMLEHTFYVKWSKGELTKEQLQAYAKDYYLHIKAFPKYLSA IHSRCDDLEARKLLLDNLMDEENGYPNHIDLWKQFVFALGVTPEELEAHEPSEAAKAKVATFMRWCTGDSLAAGVAALYS YESQIPRIAREKIRGLTEYFGFSNPEDYAYFTEHEEADVRHAREEKALIEMLLKDDADKVLEASQEVTQSLYGFLDSFLD ; _entity_poly.pdbx_seq_one_letter_code_can ;MGSSHHHHHHSSGLVPRGSHMMEVFMNFLDQLDLIIQNKHMLEHTFYVKWSKGELTKEQLQAYAKDYYLHIKAFPKYLSA IHSRCDDLEARKLLLDNLMDEENGYPNHIDLWKQFVFALGVTPEELEAHEPSEAAKAKVATFMRWCTGDSLAAGVAALYS YESQIPRIAREKIRGLTEYFGFSNPEDYAYFTEHEEADVRHAREEKALIEMLLKDDADKVLEASQEVTQSLYGFLDSFLD ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'FE (II) ION' FE2 3 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLY n 1 3 SER n 1 4 SER n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 HIS n 1 9 HIS n 1 10 HIS n 1 11 SER n 1 12 SER n 1 13 GLY n 1 14 LEU n 1 15 VAL n 1 16 PRO n 1 17 ARG n 1 18 GLY n 1 19 SER n 1 20 HIS n 1 21 MET n 1 22 MET n 1 23 GLU n 1 24 VAL n 1 25 PHE n 1 26 MET n 1 27 ASN n 1 28 PHE n 1 29 LEU n 1 30 ASP n 1 31 GLN n 1 32 LEU n 1 33 ASP n 1 34 LEU n 1 35 ILE n 1 36 ILE n 1 37 GLN n 1 38 ASN n 1 39 LYS n 1 40 HIS n 1 41 MET n 1 42 LEU n 1 43 GLU n 1 44 HIS n 1 45 THR n 1 46 PHE n 1 47 TYR n 1 48 VAL n 1 49 LYS n 1 50 TRP n 1 51 SER n 1 52 LYS n 1 53 GLY n 1 54 GLU n 1 55 LEU n 1 56 THR n 1 57 LYS n 1 58 GLU n 1 59 GLN n 1 60 LEU n 1 61 GLN n 1 62 ALA n 1 63 TYR n 1 64 ALA n 1 65 LYS n 1 66 ASP n 1 67 TYR n 1 68 TYR n 1 69 LEU n 1 70 HIS n 1 71 ILE n 1 72 LYS n 1 73 ALA n 1 74 PHE n 1 75 PRO n 1 76 LYS n 1 77 TYR n 1 78 LEU n 1 79 SER n 1 80 ALA n 1 81 ILE n 1 82 HIS n 1 83 SER n 1 84 ARG n 1 85 CYS n 1 86 ASP n 1 87 ASP n 1 88 LEU n 1 89 GLU n 1 90 ALA n 1 91 ARG n 1 92 LYS n 1 93 LEU n 1 94 LEU n 1 95 LEU n 1 96 ASP n 1 97 ASN n 1 98 LEU n 1 99 MET n 1 100 ASP n 1 101 GLU n 1 102 GLU n 1 103 ASN n 1 104 GLY n 1 105 TYR n 1 106 PRO n 1 107 ASN n 1 108 HIS n 1 109 ILE n 1 110 ASP n 1 111 LEU n 1 112 TRP n 1 113 LYS n 1 114 GLN n 1 115 PHE n 1 116 VAL n 1 117 PHE n 1 118 ALA n 1 119 LEU n 1 120 GLY n 1 121 VAL n 1 122 THR n 1 123 PRO n 1 124 GLU n 1 125 GLU n 1 126 LEU n 1 127 GLU n 1 128 ALA n 1 129 HIS n 1 130 GLU n 1 131 PRO n 1 132 SER n 1 133 GLU n 1 134 ALA n 1 135 ALA n 1 136 LYS n 1 137 ALA n 1 138 LYS n 1 139 VAL n 1 140 ALA n 1 141 THR n 1 142 PHE n 1 143 MET n 1 144 ARG n 1 145 TRP n 1 146 CYS n 1 147 THR n 1 148 GLY n 1 149 ASP n 1 150 SER n 1 151 LEU n 1 152 ALA n 1 153 ALA n 1 154 GLY n 1 155 VAL n 1 156 ALA n 1 157 ALA n 1 158 LEU n 1 159 TYR n 1 160 SER n 1 161 TYR n 1 162 GLU n 1 163 SER n 1 164 GLN n 1 165 ILE n 1 166 PRO n 1 167 ARG n 1 168 ILE n 1 169 ALA n 1 170 ARG n 1 171 GLU n 1 172 LYS n 1 173 ILE n 1 174 ARG n 1 175 GLY n 1 176 LEU n 1 177 THR n 1 178 GLU n 1 179 TYR n 1 180 PHE n 1 181 GLY n 1 182 PHE n 1 183 SER n 1 184 ASN n 1 185 PRO n 1 186 GLU n 1 187 ASP n 1 188 TYR n 1 189 ALA n 1 190 TYR n 1 191 PHE n 1 192 THR n 1 193 GLU n 1 194 HIS n 1 195 GLU n 1 196 GLU n 1 197 ALA n 1 198 ASP n 1 199 VAL n 1 200 ARG n 1 201 HIS n 1 202 ALA n 1 203 ARG n 1 204 GLU n 1 205 GLU n 1 206 LYS n 1 207 ALA n 1 208 LEU n 1 209 ILE n 1 210 GLU n 1 211 MET n 1 212 LEU n 1 213 LEU n 1 214 LYS n 1 215 ASP n 1 216 ASP n 1 217 ALA n 1 218 ASP n 1 219 LYS n 1 220 VAL n 1 221 LEU n 1 222 GLU n 1 223 ALA n 1 224 SER n 1 225 GLN n 1 226 GLU n 1 227 VAL n 1 228 THR n 1 229 GLN n 1 230 SER n 1 231 LEU n 1 232 TYR n 1 233 GLY n 1 234 PHE n 1 235 LEU n 1 236 ASP n 1 237 SER n 1 238 PHE n 1 239 LEU n 1 240 ASP n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 240 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene CT_610 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 'Strain D/UW-3/Cx' _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Chlamydia trachomatis' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 813 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 FE2 non-polymer . 'FE (II) ION' ? 'Fe 2' 55.845 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 -19 ? ? ? A . n A 1 2 GLY 2 -18 ? ? ? A . n A 1 3 SER 3 -17 ? ? ? A . n A 1 4 SER 4 -16 ? ? ? A . n A 1 5 HIS 5 -15 ? ? ? A . n A 1 6 HIS 6 -14 ? ? ? A . n A 1 7 HIS 7 -13 ? ? ? A . n A 1 8 HIS 8 -12 ? ? ? A . n A 1 9 HIS 9 -11 ? ? ? A . n A 1 10 HIS 10 -10 ? ? ? A . n A 1 11 SER 11 -9 ? ? ? A . n A 1 12 SER 12 -8 ? ? ? A . n A 1 13 GLY 13 -7 ? ? ? A . n A 1 14 LEU 14 -6 ? ? ? A . n A 1 15 VAL 15 -5 ? ? ? A . n A 1 16 PRO 16 -4 ? ? ? A . n A 1 17 ARG 17 -3 ? ? ? A . n A 1 18 GLY 18 -2 ? ? ? A . n A 1 19 SER 19 -1 ? ? ? A . n A 1 20 HIS 20 0 ? ? ? A . n A 1 21 MET 21 1 ? ? ? A . n A 1 22 MET 22 2 ? ? ? A . n A 1 23 GLU 23 3 ? ? ? A . n A 1 24 VAL 24 4 ? ? ? A . n A 1 25 PHE 25 5 ? ? ? A . n A 1 26 MET 26 6 6 MET MET A . n A 1 27 ASN 27 7 7 ASN ASN A . n A 1 28 PHE 28 8 8 PHE PHE A . n A 1 29 LEU 29 9 9 LEU LEU A . n A 1 30 ASP 30 10 10 ASP ASP A . n A 1 31 GLN 31 11 11 GLN GLN A . n A 1 32 LEU 32 12 12 LEU LEU A . n A 1 33 ASP 33 13 13 ASP ASP A . n A 1 34 LEU 34 14 14 LEU LEU A . n A 1 35 ILE 35 15 15 ILE ILE A . n A 1 36 ILE 36 16 16 ILE ILE A . n A 1 37 GLN 37 17 17 GLN GLN A . n A 1 38 ASN 38 18 18 ASN ASN A . n A 1 39 LYS 39 19 19 LYS LYS A . n A 1 40 HIS 40 20 20 HIS HIS A . n A 1 41 MET 41 21 21 MET MET A . n A 1 42 LEU 42 22 22 LEU LEU A . n A 1 43 GLU 43 23 23 GLU GLU A . n A 1 44 HIS 44 24 24 HIS HIS A . n A 1 45 THR 45 25 25 THR THR A . n A 1 46 PHE 46 26 26 PHE PHE A . n A 1 47 TYR 47 27 27 TYR TYR A . n A 1 48 VAL 48 28 28 VAL VAL A . n A 1 49 LYS 49 29 29 LYS LYS A . n A 1 50 TRP 50 30 30 TRP TRP A . n A 1 51 SER 51 31 31 SER SER A . n A 1 52 LYS 52 32 32 LYS LYS A . n A 1 53 GLY 53 33 33 GLY GLY A . n A 1 54 GLU 54 34 34 GLU GLU A . n A 1 55 LEU 55 35 35 LEU LEU A . n A 1 56 THR 56 36 36 THR THR A . n A 1 57 LYS 57 37 37 LYS LYS A . n A 1 58 GLU 58 38 38 GLU GLU A . n A 1 59 GLN 59 39 39 GLN GLN A . n A 1 60 LEU 60 40 40 LEU LEU A . n A 1 61 GLN 61 41 41 GLN GLN A . n A 1 62 ALA 62 42 42 ALA ALA A . n A 1 63 TYR 63 43 43 TYR TYR A . n A 1 64 ALA 64 44 44 ALA ALA A . n A 1 65 LYS 65 45 45 LYS LYS A . n A 1 66 ASP 66 46 46 ASP ASP A . n A 1 67 TYR 67 47 47 TYR TYR A . n A 1 68 TYR 68 48 48 TYR TYR A . n A 1 69 LEU 69 49 49 LEU LEU A . n A 1 70 HIS 70 50 50 HIS HIS A . n A 1 71 ILE 71 51 51 ILE ILE A . n A 1 72 LYS 72 52 52 LYS LYS A . n A 1 73 ALA 73 53 53 ALA ALA A . n A 1 74 PHE 74 54 54 PHE PHE A . n A 1 75 PRO 75 55 55 PRO PRO A . n A 1 76 LYS 76 56 56 LYS LYS A . n A 1 77 TYR 77 57 57 TYR TYR A . n A 1 78 LEU 78 58 58 LEU LEU A . n A 1 79 SER 79 59 59 SER SER A . n A 1 80 ALA 80 60 60 ALA ALA A . n A 1 81 ILE 81 61 61 ILE ILE A . n A 1 82 HIS 82 62 62 HIS HIS A . n A 1 83 SER 83 63 63 SER SER A . n A 1 84 ARG 84 64 64 ARG ARG A . n A 1 85 CYS 85 65 65 CYS CYS A . n A 1 86 ASP 86 66 66 ASP ASP A . n A 1 87 ASP 87 67 67 ASP ASP A . n A 1 88 LEU 88 68 68 LEU LEU A . n A 1 89 GLU 89 69 69 GLU GLU A . n A 1 90 ALA 90 70 70 ALA ALA A . n A 1 91 ARG 91 71 71 ARG ARG A . n A 1 92 LYS 92 72 72 LYS LYS A . n A 1 93 LEU 93 73 73 LEU LEU A . n A 1 94 LEU 94 74 74 LEU LEU A . n A 1 95 LEU 95 75 75 LEU LEU A . n A 1 96 ASP 96 76 76 ASP ASP A . n A 1 97 ASN 97 77 77 ASN ASN A . n A 1 98 LEU 98 78 78 LEU LEU A . n A 1 99 MET 99 79 79 MET MET A . n A 1 100 ASP 100 80 80 ASP ASP A . n A 1 101 GLU 101 81 81 GLU GLU A . n A 1 102 GLU 102 82 82 GLU GLU A . n A 1 103 ASN 103 83 83 ASN ASN A . n A 1 104 GLY 104 84 84 GLY GLY A . n A 1 105 TYR 105 85 85 TYR TYR A . n A 1 106 PRO 106 86 86 PRO PRO A . n A 1 107 ASN 107 87 87 ASN ASN A . n A 1 108 HIS 108 88 88 HIS HIS A . n A 1 109 ILE 109 89 89 ILE ILE A . n A 1 110 ASP 110 90 90 ASP ASP A . n A 1 111 LEU 111 91 91 LEU LEU A . n A 1 112 TRP 112 92 92 TRP TRP A . n A 1 113 LYS 113 93 93 LYS LYS A . n A 1 114 GLN 114 94 94 GLN GLN A . n A 1 115 PHE 115 95 95 PHE PHE A . n A 1 116 VAL 116 96 96 VAL VAL A . n A 1 117 PHE 117 97 97 PHE PHE A . n A 1 118 ALA 118 98 98 ALA ALA A . n A 1 119 LEU 119 99 99 LEU LEU A . n A 1 120 GLY 120 100 100 GLY GLY A . n A 1 121 VAL 121 101 101 VAL VAL A . n A 1 122 THR 122 102 102 THR THR A . n A 1 123 PRO 123 103 103 PRO PRO A . n A 1 124 GLU 124 104 104 GLU GLU A . n A 1 125 GLU 125 105 105 GLU GLU A . n A 1 126 LEU 126 106 106 LEU LEU A . n A 1 127 GLU 127 107 107 GLU GLU A . n A 1 128 ALA 128 108 108 ALA ALA A . n A 1 129 HIS 129 109 109 HIS HIS A . n A 1 130 GLU 130 110 110 GLU GLU A . n A 1 131 PRO 131 111 111 PRO PRO A . n A 1 132 SER 132 112 112 SER SER A . n A 1 133 GLU 133 113 113 GLU GLU A . n A 1 134 ALA 134 114 114 ALA ALA A . n A 1 135 ALA 135 115 115 ALA ALA A . n A 1 136 LYS 136 116 116 LYS LYS A . n A 1 137 ALA 137 117 117 ALA ALA A . n A 1 138 LYS 138 118 118 LYS LYS A . n A 1 139 VAL 139 119 119 VAL VAL A . n A 1 140 ALA 140 120 120 ALA ALA A . n A 1 141 THR 141 121 121 THR THR A . n A 1 142 PHE 142 122 122 PHE PHE A . n A 1 143 MET 143 123 123 MET MET A . n A 1 144 ARG 144 124 124 ARG ARG A . n A 1 145 TRP 145 125 125 TRP TRP A . n A 1 146 CYS 146 126 126 CYS CYS A . n A 1 147 THR 147 127 127 THR THR A . n A 1 148 GLY 148 128 128 GLY GLY A . n A 1 149 ASP 149 129 129 ASP ASP A . n A 1 150 SER 150 130 130 SER SER A . n A 1 151 LEU 151 131 131 LEU LEU A . n A 1 152 ALA 152 132 132 ALA ALA A . n A 1 153 ALA 153 133 133 ALA ALA A . n A 1 154 GLY 154 134 134 GLY GLY A . n A 1 155 VAL 155 135 135 VAL VAL A . n A 1 156 ALA 156 136 136 ALA ALA A . n A 1 157 ALA 157 137 137 ALA ALA A . n A 1 158 LEU 158 138 138 LEU LEU A . n A 1 159 TYR 159 139 139 TYR TYR A . n A 1 160 SER 160 140 140 SER SER A . n A 1 161 TYR 161 141 141 TYR TYR A . n A 1 162 GLU 162 142 142 GLU GLU A . n A 1 163 SER 163 143 143 SER SER A . n A 1 164 GLN 164 144 144 GLN GLN A . n A 1 165 ILE 165 145 145 ILE ILE A . n A 1 166 PRO 166 146 146 PRO PRO A . n A 1 167 ARG 167 147 147 ARG ARG A . n A 1 168 ILE 168 148 148 ILE ILE A . n A 1 169 ALA 169 149 149 ALA ALA A . n A 1 170 ARG 170 150 150 ARG ARG A . n A 1 171 GLU 171 151 151 GLU GLU A . n A 1 172 LYS 172 152 152 LYS LYS A . n A 1 173 ILE 173 153 153 ILE ILE A . n A 1 174 ARG 174 154 154 ARG ARG A . n A 1 175 GLY 175 155 155 GLY GLY A . n A 1 176 LEU 176 156 156 LEU LEU A . n A 1 177 THR 177 157 157 THR THR A . n A 1 178 GLU 178 158 158 GLU GLU A . n A 1 179 TYR 179 159 159 TYR TYR A . n A 1 180 PHE 180 160 160 PHE PHE A . n A 1 181 GLY 181 161 161 GLY GLY A . n A 1 182 PHE 182 162 162 PHE PHE A . n A 1 183 SER 183 163 163 SER SER A . n A 1 184 ASN 184 164 164 ASN ASN A . n A 1 185 PRO 185 165 165 PRO PRO A . n A 1 186 GLU 186 166 166 GLU GLU A . n A 1 187 ASP 187 167 167 ASP ASP A . n A 1 188 TYR 188 168 168 TYR TYR A . n A 1 189 ALA 189 169 169 ALA ALA A . n A 1 190 TYR 190 170 170 TYR TYR A . n A 1 191 PHE 191 171 171 PHE PHE A . n A 1 192 THR 192 172 172 THR THR A . n A 1 193 GLU 193 173 173 GLU GLU A . n A 1 194 HIS 194 174 174 HIS HIS A . n A 1 195 GLU 195 175 175 GLU GLU A . n A 1 196 GLU 196 176 176 GLU GLU A . n A 1 197 ALA 197 177 177 ALA ALA A . n A 1 198 ASP 198 178 178 ASP ASP A . n A 1 199 VAL 199 179 179 VAL VAL A . n A 1 200 ARG 200 180 180 ARG ARG A . n A 1 201 HIS 201 181 181 HIS HIS A . n A 1 202 ALA 202 182 182 ALA ALA A . n A 1 203 ARG 203 183 183 ARG ARG A . n A 1 204 GLU 204 184 184 GLU GLU A . n A 1 205 GLU 205 185 185 GLU GLU A . n A 1 206 LYS 206 186 186 LYS LYS A . n A 1 207 ALA 207 187 187 ALA ALA A . n A 1 208 LEU 208 188 188 LEU LEU A . n A 1 209 ILE 209 189 189 ILE ILE A . n A 1 210 GLU 210 190 190 GLU GLU A . n A 1 211 MET 211 191 191 MET MET A . n A 1 212 LEU 212 192 192 LEU LEU A . n A 1 213 LEU 213 193 193 LEU LEU A . n A 1 214 LYS 214 194 194 LYS LYS A . n A 1 215 ASP 215 195 195 ASP ASP A . n A 1 216 ASP 216 196 196 ASP ASP A . n A 1 217 ALA 217 197 197 ALA ALA A . n A 1 218 ASP 218 198 198 ASP ASP A . n A 1 219 LYS 219 199 199 LYS LYS A . n A 1 220 VAL 220 200 200 VAL VAL A . n A 1 221 LEU 221 201 201 LEU LEU A . n A 1 222 GLU 222 202 202 GLU GLU A . n A 1 223 ALA 223 203 203 ALA ALA A . n A 1 224 SER 224 204 204 SER SER A . n A 1 225 GLN 225 205 205 GLN GLN A . n A 1 226 GLU 226 206 206 GLU GLU A . n A 1 227 VAL 227 207 207 VAL VAL A . n A 1 228 THR 228 208 208 THR THR A . n A 1 229 GLN 229 209 209 GLN GLN A . n A 1 230 SER 230 210 210 SER SER A . n A 1 231 LEU 231 211 211 LEU LEU A . n A 1 232 TYR 232 212 212 TYR TYR A . n A 1 233 GLY 233 213 213 GLY GLY A . n A 1 234 PHE 234 214 214 PHE PHE A . n A 1 235 LEU 235 215 215 LEU LEU A . n A 1 236 ASP 236 216 216 ASP ASP A . n A 1 237 SER 237 217 217 SER SER A . n A 1 238 PHE 238 218 218 PHE PHE A . n A 1 239 LEU 239 219 219 LEU LEU A . n A 1 240 ASP 240 220 ? ? ? A . n # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id FE2 _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id FE2 _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 FE2 1 301 1 FE2 FE2 A . C 2 FE2 1 302 2 FE2 FE2 A . D 3 HOH 1 401 3 HOH HOH A . D 3 HOH 2 402 28 HOH HOH A . D 3 HOH 3 403 31 HOH HOH A . D 3 HOH 4 404 24 HOH HOH A . D 3 HOH 5 405 6 HOH HOH A . D 3 HOH 6 406 19 HOH HOH A . D 3 HOH 7 407 15 HOH HOH A . D 3 HOH 8 408 22 HOH HOH A . D 3 HOH 9 409 13 HOH HOH A . D 3 HOH 10 410 29 HOH HOH A . D 3 HOH 11 411 11 HOH HOH A . D 3 HOH 12 412 23 HOH HOH A . D 3 HOH 13 413 7 HOH HOH A . D 3 HOH 14 414 4 HOH HOH A . D 3 HOH 15 415 20 HOH HOH A . D 3 HOH 16 416 12 HOH HOH A . D 3 HOH 17 417 25 HOH HOH A . D 3 HOH 18 418 5 HOH HOH A . D 3 HOH 19 419 14 HOH HOH A . D 3 HOH 20 420 17 HOH HOH A . D 3 HOH 21 421 10 HOH HOH A . D 3 HOH 22 422 16 HOH HOH A . D 3 HOH 23 423 21 HOH HOH A . D 3 HOH 24 424 9 HOH HOH A . D 3 HOH 25 425 1 HOH HOH A . D 3 HOH 26 426 2 HOH HOH A . D 3 HOH 27 427 30 HOH HOH A . D 3 HOH 28 428 26 HOH HOH A . D 3 HOH 29 429 8 HOH HOH A . D 3 HOH 30 430 32 HOH HOH A . D 3 HOH 31 431 27 HOH HOH A . D 3 HOH 32 432 18 HOH HOH A . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A GLN 11 ? CG ? A GLN 31 CG 2 1 Y 1 A GLN 11 ? CD ? A GLN 31 CD 3 1 Y 1 A GLN 11 ? OE1 ? A GLN 31 OE1 4 1 Y 1 A GLN 11 ? NE2 ? A GLN 31 NE2 5 1 Y 1 A LYS 19 ? CE ? A LYS 39 CE 6 1 Y 1 A LYS 19 ? NZ ? A LYS 39 NZ 7 1 Y 1 A LEU 22 ? CD1 ? A LEU 42 CD1 8 1 Y 1 A LEU 22 ? CD2 ? A LEU 42 CD2 9 1 Y 1 A VAL 28 ? CG1 ? A VAL 48 CG1 10 1 Y 1 A LYS 29 ? CD ? A LYS 49 CD 11 1 Y 1 A LYS 29 ? CE ? A LYS 49 CE 12 1 Y 1 A LYS 29 ? NZ ? A LYS 49 NZ 13 1 Y 1 A SER 31 ? OG ? A SER 51 OG 14 1 Y 1 A LYS 32 ? CG ? A LYS 52 CG 15 1 Y 1 A LYS 32 ? CD ? A LYS 52 CD 16 1 Y 1 A LYS 32 ? CE ? A LYS 52 CE 17 1 Y 1 A LYS 32 ? NZ ? A LYS 52 NZ 18 1 Y 1 A GLU 34 ? CG ? A GLU 54 CG 19 1 Y 1 A GLU 34 ? CD ? A GLU 54 CD 20 1 Y 1 A GLU 34 ? OE1 ? A GLU 54 OE1 21 1 Y 1 A GLU 34 ? OE2 ? A GLU 54 OE2 22 1 Y 1 A LEU 35 ? CB ? A LEU 55 CB 23 1 Y 1 A LEU 35 ? CG ? A LEU 55 CG 24 1 Y 1 A LEU 35 ? CD1 ? A LEU 55 CD1 25 1 Y 1 A LEU 35 ? CD2 ? A LEU 55 CD2 26 1 Y 1 A THR 36 ? OG1 ? A THR 56 OG1 27 1 Y 1 A THR 36 ? CG2 ? A THR 56 CG2 28 1 Y 1 A LYS 37 ? CG ? A LYS 57 CG 29 1 Y 1 A LYS 37 ? CD ? A LYS 57 CD 30 1 Y 1 A LYS 37 ? CE ? A LYS 57 CE 31 1 Y 1 A LYS 37 ? NZ ? A LYS 57 NZ 32 1 Y 1 A GLU 38 ? CG ? A GLU 58 CG 33 1 Y 1 A GLU 38 ? CD ? A GLU 58 CD 34 1 Y 1 A GLU 38 ? OE1 ? A GLU 58 OE1 35 1 Y 1 A GLU 38 ? OE2 ? A GLU 58 OE2 36 1 Y 1 A LEU 40 ? CD1 ? A LEU 60 CD1 37 1 Y 1 A LEU 40 ? CD2 ? A LEU 60 CD2 38 1 Y 1 A LYS 45 ? CE ? A LYS 65 CE 39 1 Y 1 A LYS 45 ? NZ ? A LYS 65 NZ 40 1 Y 1 A ILE 51 ? CD1 ? A ILE 71 CD1 41 1 Y 1 A LYS 52 ? NZ ? A LYS 72 NZ 42 1 Y 1 A MET 79 ? CE ? A MET 99 CE 43 1 Y 1 A LEU 99 ? CD1 ? A LEU 119 CD1 44 1 Y 1 A LEU 99 ? CD2 ? A LEU 119 CD2 45 1 Y 1 A GLU 104 ? CG ? A GLU 124 CG 46 1 Y 1 A GLU 104 ? CD ? A GLU 124 CD 47 1 Y 1 A GLU 104 ? OE1 ? A GLU 124 OE1 48 1 Y 1 A GLU 104 ? OE2 ? A GLU 124 OE2 49 1 Y 1 A GLU 105 ? CG ? A GLU 125 CG 50 1 Y 1 A GLU 105 ? CD ? A GLU 125 CD 51 1 Y 1 A GLU 105 ? OE1 ? A GLU 125 OE1 52 1 Y 1 A GLU 105 ? OE2 ? A GLU 125 OE2 53 1 Y 1 A GLU 107 ? CG ? A GLU 127 CG 54 1 Y 1 A GLU 107 ? CD ? A GLU 127 CD 55 1 Y 1 A GLU 107 ? OE1 ? A GLU 127 OE1 56 1 Y 1 A GLU 107 ? OE2 ? A GLU 127 OE2 57 1 Y 1 A ALA 108 ? CB ? A ALA 128 CB 58 1 Y 1 A GLU 110 ? CD ? A GLU 130 CD 59 1 Y 1 A GLU 110 ? OE1 ? A GLU 130 OE1 60 1 Y 1 A GLU 110 ? OE2 ? A GLU 130 OE2 61 1 Y 1 A ALA 114 ? CB ? A ALA 134 CB 62 1 Y 1 A MET 123 ? CE ? A MET 143 CE 63 1 Y 1 A ARG 124 ? CG ? A ARG 144 CG 64 1 Y 1 A ARG 124 ? CD ? A ARG 144 CD 65 1 Y 1 A ARG 124 ? NE ? A ARG 144 NE 66 1 Y 1 A ARG 124 ? CZ ? A ARG 144 CZ 67 1 Y 1 A ARG 124 ? NH1 ? A ARG 144 NH1 68 1 Y 1 A ARG 124 ? NH2 ? A ARG 144 NH2 69 1 Y 1 A ARG 147 ? CZ ? A ARG 167 CZ 70 1 Y 1 A ARG 147 ? NH1 ? A ARG 167 NH1 71 1 Y 1 A ARG 147 ? NH2 ? A ARG 167 NH2 72 1 Y 1 A ILE 148 ? CG2 ? A ILE 168 CG2 73 1 Y 1 A ILE 148 ? CD1 ? A ILE 168 CD1 74 1 Y 1 A GLU 151 ? CD ? A GLU 171 CD 75 1 Y 1 A GLU 151 ? OE1 ? A GLU 171 OE1 76 1 Y 1 A GLU 151 ? OE2 ? A GLU 171 OE2 77 1 Y 1 A LYS 152 ? CE ? A LYS 172 CE 78 1 Y 1 A LYS 152 ? NZ ? A LYS 172 NZ 79 1 Y 1 A GLU 158 ? OE1 ? A GLU 178 OE1 80 1 Y 1 A GLU 158 ? OE2 ? A GLU 178 OE2 81 1 Y 1 A SER 163 ? OG ? A SER 183 OG 82 1 Y 1 A GLU 166 ? CG ? A GLU 186 CG 83 1 Y 1 A GLU 166 ? CD ? A GLU 186 CD 84 1 Y 1 A GLU 166 ? OE1 ? A GLU 186 OE1 85 1 Y 1 A GLU 166 ? OE2 ? A GLU 186 OE2 86 1 Y 1 A GLU 176 ? CG ? A GLU 196 CG 87 1 Y 1 A GLU 176 ? CD ? A GLU 196 CD 88 1 Y 1 A GLU 176 ? OE1 ? A GLU 196 OE1 89 1 Y 1 A GLU 176 ? OE2 ? A GLU 196 OE2 90 1 Y 1 A LYS 194 ? CG ? A LYS 214 CG 91 1 Y 1 A LYS 194 ? CD ? A LYS 214 CD 92 1 Y 1 A LYS 194 ? CE ? A LYS 214 CE 93 1 Y 1 A LYS 194 ? NZ ? A LYS 214 NZ 94 1 Y 1 A ASP 195 ? OD2 ? A ASP 215 OD2 95 1 Y 1 A LYS 199 ? CE ? A LYS 219 CE 96 1 Y 1 A LYS 199 ? NZ ? A LYS 219 NZ 97 1 Y 1 A GLN 209 ? OE1 ? A GLN 229 OE1 98 1 Y 1 A GLN 209 ? NE2 ? A GLN 229 NE2 99 1 Y 1 A SER 210 ? OG ? A SER 230 OG # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.20.1_4487 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? CrysalisPro ? ? ? 42.90a 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? 1.12.15 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.20.1_4487 4 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 120.000 _cell.angle_gamma_esd ? _cell.entry_id 8VAB _cell.details ? _cell.formula_units_Z ? _cell.length_a 92.882 _cell.length_a_esd ? _cell.length_b 92.882 _cell.length_b_esd ? _cell.length_c 122.743 _cell.length_c_esd ? _cell.volume 917038.727 _cell.volume_esd ? _cell.Z_PDB 12 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 8VAB _symmetry.cell_setting ? _symmetry.Int_Tables_number 180 _symmetry.space_group_name_Hall 'P 62 2 (x,y,z+1/3)' _symmetry.space_group_name_H-M 'P 62 2 2' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 8VAB _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.75 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 55.30 _exptl_crystal.description 'Hexagonal plates' _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 8.3 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.2M Lithium citrate tribasic tetrahydrate, 20% w/v PEG-3350' _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 291 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER R 4M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2023-04-18 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator M _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.54184 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source 'ROTATING ANODE' _diffrn_source.target ? _diffrn_source.type 'RIGAKU MICROMAX-007 HF' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.54184 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline ? _diffrn_source.pdbx_synchrotron_site ? # _reflns.B_iso_Wilson_estimate 53.60 _reflns.entry_id 8VAB _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.65 _reflns.d_resolution_low 18.11 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 9563 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 98.04 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 18.2 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 8.77 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.213 _reflns.pdbx_Rpim_I_all 0.04942 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.996 _reflns.pdbx_CC_star 0.999 _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs 0.2071 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 2.65 _reflns_shell.d_res_low 2.744 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 2.20 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs ? _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all 1.038 _reflns_shell.pdbx_Rpim_I_all 0.2437 _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.912 _reflns_shell.pdbx_CC_star 0.977 _reflns_shell.pdbx_R_split ? _reflns_shell.percent_possible_all 95.61 _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 1.008 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 53.60 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 8VAB _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.65 _refine.ls_d_res_low 18.11 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 9425 _refine.ls_number_reflns_R_free 943 _refine.ls_number_reflns_R_work 8482 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 98.54 _refine.ls_percent_reflns_R_free 10.01 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2107 _refine.ls_R_factor_R_free 0.2749 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2039 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.34 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values 'GeoStd + Monomer Library + CDL v1.2' _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1000 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 27.3205 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.4250 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 2.65 _refine_hist.d_res_low 18.11 _refine_hist.number_atoms_solvent 32 _refine_hist.number_atoms_total 1686 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 1652 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 2 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.0075 ? 1694 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.8807 ? 2299 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.0476 ? 247 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.0067 ? 298 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 5.2465 ? 231 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free _refine_ls_shell.R_factor_R_free 'X-RAY DIFFRACTION' 2.65 2.79 . . 127 1151 96.45 . . . . 0.2906 . . . . . . . . . . . 0.4546 'X-RAY DIFFRACTION' 2.79 2.96 . . 130 1162 97.29 . . . . 0.2844 . . . . . . . . . . . 0.3559 'X-RAY DIFFRACTION' 2.96 3.19 . . 132 1185 98.36 . . . . 0.2747 . . . . . . . . . . . 0.3368 'X-RAY DIFFRACTION' 3.19 3.51 . . 133 1200 99.26 . . . . 0.2236 . . . . . . . . . . . 0.3525 'X-RAY DIFFRACTION' 3.51 4.01 . . 135 1208 98.97 . . . . 0.1840 . . . . . . . . . . . 0.2572 'X-RAY DIFFRACTION' 4.01 5.04 . . 138 1242 99.57 . . . . 0.1650 . . . . . . . . . . . 0.2124 'X-RAY DIFFRACTION' 5.04 18.11 . . 148 1334 99.80 . . . . 0.1858 . . . . . . . . . . . 0.2335 # _struct.entry_id 8VAB _struct.title 'Crystal structure of FeII/FeII CtCADD from Chlamydia trachomatis' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 8VAB _struct_keywords.text 'FeII reconstituted form, OXIDOREDUCTASE' _struct_keywords.pdbx_keywords OXIDOREDUCTASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 3 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code CADD_CHLTR _struct_ref.pdbx_db_accession O84616 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MMEVFMNFLDQLDLIIQNKHMLEHTFYVKWSKGELTKEQLQAYAKDYYLHIKAFPKYLSAIHSRCDDLEARKLLLDNLMD EENGYPNHIDLWKQFVFALGVTPEELEAHEPSEAAKAKVATFMRWCTGDSLAAGVAALYSYESQIPRIAREKIRGLTEYF GFSNPEDYAYFTEHEEADVRHAREEKALIEMLLKDDADKVLEASQEVTQSLYGFLDSFLD ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 8VAB _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 21 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 240 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession O84616 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 220 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 220 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 8VAB MET A 1 ? UNP O84616 ? ? 'expression tag' -19 1 1 8VAB GLY A 2 ? UNP O84616 ? ? 'expression tag' -18 2 1 8VAB SER A 3 ? UNP O84616 ? ? 'expression tag' -17 3 1 8VAB SER A 4 ? UNP O84616 ? ? 'expression tag' -16 4 1 8VAB HIS A 5 ? UNP O84616 ? ? 'expression tag' -15 5 1 8VAB HIS A 6 ? UNP O84616 ? ? 'expression tag' -14 6 1 8VAB HIS A 7 ? UNP O84616 ? ? 'expression tag' -13 7 1 8VAB HIS A 8 ? UNP O84616 ? ? 'expression tag' -12 8 1 8VAB HIS A 9 ? UNP O84616 ? ? 'expression tag' -11 9 1 8VAB HIS A 10 ? UNP O84616 ? ? 'expression tag' -10 10 1 8VAB SER A 11 ? UNP O84616 ? ? 'expression tag' -9 11 1 8VAB SER A 12 ? UNP O84616 ? ? 'expression tag' -8 12 1 8VAB GLY A 13 ? UNP O84616 ? ? 'expression tag' -7 13 1 8VAB LEU A 14 ? UNP O84616 ? ? 'expression tag' -6 14 1 8VAB VAL A 15 ? UNP O84616 ? ? 'expression tag' -5 15 1 8VAB PRO A 16 ? UNP O84616 ? ? 'expression tag' -4 16 1 8VAB ARG A 17 ? UNP O84616 ? ? 'expression tag' -3 17 1 8VAB GLY A 18 ? UNP O84616 ? ? 'expression tag' -2 18 1 8VAB SER A 19 ? UNP O84616 ? ? 'expression tag' -1 19 1 8VAB HIS A 20 ? UNP O84616 ? ? 'expression tag' 0 20 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 2400 ? 1 MORE -65 ? 1 'SSA (A^2)' 17270 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 4_455 -x-1,-y,z -1.0000000000 0.0000000000 0.0000000000 -92.8820000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASN A 27 ? ASN A 38 ? ASN A 7 ASN A 18 1 ? 12 HELX_P HELX_P2 AA2 HIS A 40 ? GLU A 43 ? HIS A 20 GLU A 23 5 ? 4 HELX_P HELX_P3 AA3 HIS A 44 ? GLY A 53 ? HIS A 24 GLY A 33 1 ? 10 HELX_P HELX_P4 AA4 THR A 56 ? TYR A 67 ? THR A 36 TYR A 47 1 ? 12 HELX_P HELX_P5 AA5 TYR A 67 ? SER A 83 ? TYR A 47 SER A 63 1 ? 17 HELX_P HELX_P6 AA6 ASP A 87 ? ASN A 103 ? ASP A 67 ASN A 83 1 ? 17 HELX_P HELX_P7 AA7 ASN A 107 ? LEU A 119 ? ASN A 87 LEU A 99 1 ? 13 HELX_P HELX_P8 AA8 THR A 122 ? HIS A 129 ? THR A 102 HIS A 109 1 ? 8 HELX_P HELX_P9 AA9 SER A 132 ? THR A 147 ? SER A 112 THR A 127 1 ? 16 HELX_P HELX_P10 AB1 SER A 150 ? SER A 163 ? SER A 130 SER A 143 1 ? 14 HELX_P HELX_P11 AB2 GLN A 164 ? GLU A 178 ? GLN A 144 GLU A 158 1 ? 15 HELX_P HELX_P12 AB3 ASN A 184 ? ASP A 187 ? ASN A 164 ASP A 167 5 ? 4 HELX_P HELX_P13 AB4 TYR A 188 ? LEU A 213 ? TYR A 168 LEU A 193 1 ? 26 HELX_P HELX_P14 AB5 ASP A 216 ? SER A 237 ? ASP A 196 SER A 217 1 ? 22 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A GLU 101 OE1 ? ? ? 1_555 B FE2 . FE ? ? A GLU 81 A FE2 301 1_555 ? ? ? ? ? ? ? 2.450 ? ? metalc2 metalc ? ? A GLU 101 OE2 ? ? ? 1_555 B FE2 . FE ? ? A GLU 81 A FE2 301 1_555 ? ? ? ? ? ? ? 2.723 ? ? metalc3 metalc ? ? A HIS 108 ND1 ? ? ? 1_555 B FE2 . FE ? ? A HIS 88 A FE2 301 1_555 ? ? ? ? ? ? ? 2.253 ? ? metalc4 metalc ? ? A GLU 162 OE2 ? ? ? 1_555 C FE2 . FE ? ? A GLU 142 A FE2 302 1_555 ? ? ? ? ? ? ? 2.023 ? ? metalc5 metalc ? ? A HIS 194 NE2 ? ? ? 1_555 B FE2 . FE ? ? A HIS 174 A FE2 301 1_555 ? ? ? ? ? ? ? 2.098 ? ? metalc6 metalc ? ? A ASP 198 OD1 ? ? ? 1_555 C FE2 . FE ? ? A ASP 178 A FE2 302 1_555 ? ? ? ? ? ? ? 2.148 ? ? metalc7 metalc ? ? A HIS 201 ND1 ? ? ? 1_555 C FE2 . FE ? ? A HIS 181 A FE2 302 1_555 ? ? ? ? ? ? ? 2.646 ? ? metalc8 metalc ? ? B FE2 . FE ? ? ? 1_555 D HOH . O ? ? A FE2 301 A HOH 425 1_555 ? ? ? ? ? ? ? 2.547 ? ? metalc9 metalc ? ? B FE2 . FE ? ? ? 1_555 D HOH . O ? ? A FE2 301 A HOH 426 1_555 ? ? ? ? ? ? ? 2.648 ? ? metalc10 metalc ? ? C FE2 . FE ? ? ? 1_555 D HOH . O ? ? A FE2 302 A HOH 401 1_555 ? ? ? ? ? ? ? 2.272 ? ? metalc11 metalc ? ? C FE2 . FE ? ? ? 1_555 D HOH . O ? ? A FE2 302 A HOH 426 1_555 ? ? ? ? ? ? ? 2.389 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OE1 ? A GLU 101 ? A GLU 81 ? 1_555 FE ? B FE2 . ? A FE2 301 ? 1_555 OE2 ? A GLU 101 ? A GLU 81 ? 1_555 50.0 ? 2 OE1 ? A GLU 101 ? A GLU 81 ? 1_555 FE ? B FE2 . ? A FE2 301 ? 1_555 ND1 ? A HIS 108 ? A HIS 88 ? 1_555 76.9 ? 3 OE2 ? A GLU 101 ? A GLU 81 ? 1_555 FE ? B FE2 . ? A FE2 301 ? 1_555 ND1 ? A HIS 108 ? A HIS 88 ? 1_555 94.5 ? 4 OE1 ? A GLU 101 ? A GLU 81 ? 1_555 FE ? B FE2 . ? A FE2 301 ? 1_555 NE2 ? A HIS 194 ? A HIS 174 ? 1_555 160.5 ? 5 OE2 ? A GLU 101 ? A GLU 81 ? 1_555 FE ? B FE2 . ? A FE2 301 ? 1_555 NE2 ? A HIS 194 ? A HIS 174 ? 1_555 136.1 ? 6 ND1 ? A HIS 108 ? A HIS 88 ? 1_555 FE ? B FE2 . ? A FE2 301 ? 1_555 NE2 ? A HIS 194 ? A HIS 174 ? 1_555 83.9 ? 7 OE1 ? A GLU 101 ? A GLU 81 ? 1_555 FE ? B FE2 . ? A FE2 301 ? 1_555 O ? D HOH . ? A HOH 425 ? 1_555 94.1 ? 8 OE2 ? A GLU 101 ? A GLU 81 ? 1_555 FE ? B FE2 . ? A FE2 301 ? 1_555 O ? D HOH . ? A HOH 425 ? 1_555 66.8 ? 9 ND1 ? A HIS 108 ? A HIS 88 ? 1_555 FE ? B FE2 . ? A FE2 301 ? 1_555 O ? D HOH . ? A HOH 425 ? 1_555 160.4 ? 10 NE2 ? A HIS 194 ? A HIS 174 ? 1_555 FE ? B FE2 . ? A FE2 301 ? 1_555 O ? D HOH . ? A HOH 425 ? 1_555 105.2 ? 11 OE1 ? A GLU 101 ? A GLU 81 ? 1_555 FE ? B FE2 . ? A FE2 301 ? 1_555 O ? D HOH . ? A HOH 426 ? 1_555 81.3 ? 12 OE2 ? A GLU 101 ? A GLU 81 ? 1_555 FE ? B FE2 . ? A FE2 301 ? 1_555 O ? D HOH . ? A HOH 426 ? 1_555 130.4 ? 13 ND1 ? A HIS 108 ? A HIS 88 ? 1_555 FE ? B FE2 . ? A FE2 301 ? 1_555 O ? D HOH . ? A HOH 426 ? 1_555 80.9 ? 14 NE2 ? A HIS 194 ? A HIS 174 ? 1_555 FE ? B FE2 . ? A FE2 301 ? 1_555 O ? D HOH . ? A HOH 426 ? 1_555 92.8 ? 15 O ? D HOH . ? A HOH 425 ? 1_555 FE ? B FE2 . ? A FE2 301 ? 1_555 O ? D HOH . ? A HOH 426 ? 1_555 115.2 ? 16 OE2 ? A GLU 162 ? A GLU 142 ? 1_555 FE ? C FE2 . ? A FE2 302 ? 1_555 OD1 ? A ASP 198 ? A ASP 178 ? 1_555 89.2 ? 17 OE2 ? A GLU 162 ? A GLU 142 ? 1_555 FE ? C FE2 . ? A FE2 302 ? 1_555 ND1 ? A HIS 201 ? A HIS 181 ? 1_555 71.1 ? 18 OD1 ? A ASP 198 ? A ASP 178 ? 1_555 FE ? C FE2 . ? A FE2 302 ? 1_555 ND1 ? A HIS 201 ? A HIS 181 ? 1_555 72.2 ? 19 OE2 ? A GLU 162 ? A GLU 142 ? 1_555 FE ? C FE2 . ? A FE2 302 ? 1_555 O ? D HOH . ? A HOH 401 ? 1_555 81.2 ? 20 OD1 ? A ASP 198 ? A ASP 178 ? 1_555 FE ? C FE2 . ? A FE2 302 ? 1_555 O ? D HOH . ? A HOH 401 ? 1_555 152.9 ? 21 ND1 ? A HIS 201 ? A HIS 181 ? 1_555 FE ? C FE2 . ? A FE2 302 ? 1_555 O ? D HOH . ? A HOH 401 ? 1_555 80.6 ? 22 OE2 ? A GLU 162 ? A GLU 142 ? 1_555 FE ? C FE2 . ? A FE2 302 ? 1_555 O ? D HOH . ? A HOH 426 ? 1_555 141.6 ? 23 OD1 ? A ASP 198 ? A ASP 178 ? 1_555 FE ? C FE2 . ? A FE2 302 ? 1_555 O ? D HOH . ? A HOH 426 ? 1_555 81.5 ? 24 ND1 ? A HIS 201 ? A HIS 181 ? 1_555 FE ? C FE2 . ? A FE2 302 ? 1_555 O ? D HOH . ? A HOH 426 ? 1_555 70.6 ? 25 O ? D HOH . ? A HOH 401 ? 1_555 FE ? C FE2 . ? A FE2 302 ? 1_555 O ? D HOH . ? A HOH 426 ? 1_555 90.4 ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id TYR _struct_mon_prot_cis.label_seq_id 105 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id TYR _struct_mon_prot_cis.auth_seq_id 85 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 106 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 86 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle -0.45 # _pdbx_entry_details.entry_id 8VAB _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_protein_modification N # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 OD2 _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 ASP _pdbx_validate_close_contact.auth_seq_id_1 46 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 OG _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 SER _pdbx_validate_close_contact.auth_seq_id_2 112 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 2.16 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LYS A 19 ? ? -153.94 69.42 2 1 THR A 157 ? ? -84.15 -71.28 3 1 GLU A 158 ? ? -75.96 25.34 4 1 TYR A 159 ? ? -155.02 -36.66 # loop_ _space_group_symop.id _space_group_symop.operation_xyz 1 x,y,z 2 x-y,x,z+1/3 3 y,-x+y,z+2/3 4 -y,x-y,z+2/3 5 -x+y,-x,z+1/3 6 x-y,-y,-z 7 -x,-x+y,-z+1/3 8 -x,-y,z 9 y,x,-z+2/3 10 -y,-x,-z+2/3 11 -x+y,y,-z 12 x,x-y,-z+1/3 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET -19 ? A MET 1 2 1 Y 1 A GLY -18 ? A GLY 2 3 1 Y 1 A SER -17 ? A SER 3 4 1 Y 1 A SER -16 ? A SER 4 5 1 Y 1 A HIS -15 ? A HIS 5 6 1 Y 1 A HIS -14 ? A HIS 6 7 1 Y 1 A HIS -13 ? A HIS 7 8 1 Y 1 A HIS -12 ? A HIS 8 9 1 Y 1 A HIS -11 ? A HIS 9 10 1 Y 1 A HIS -10 ? A HIS 10 11 1 Y 1 A SER -9 ? A SER 11 12 1 Y 1 A SER -8 ? A SER 12 13 1 Y 1 A GLY -7 ? A GLY 13 14 1 Y 1 A LEU -6 ? A LEU 14 15 1 Y 1 A VAL -5 ? A VAL 15 16 1 Y 1 A PRO -4 ? A PRO 16 17 1 Y 1 A ARG -3 ? A ARG 17 18 1 Y 1 A GLY -2 ? A GLY 18 19 1 Y 1 A SER -1 ? A SER 19 20 1 Y 1 A HIS 0 ? A HIS 20 21 1 Y 1 A MET 1 ? A MET 21 22 1 Y 1 A MET 2 ? A MET 22 23 1 Y 1 A GLU 3 ? A GLU 23 24 1 Y 1 A VAL 4 ? A VAL 24 25 1 Y 1 A PHE 5 ? A PHE 25 26 1 Y 1 A ASP 220 ? A ASP 240 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 FE2 FE FE N N 88 GLN N N N N 89 GLN CA C N S 90 GLN C C N N 91 GLN O O N N 92 GLN CB C N N 93 GLN CG C N N 94 GLN CD C N N 95 GLN OE1 O N N 96 GLN NE2 N N N 97 GLN OXT O N N 98 GLN H H N N 99 GLN H2 H N N 100 GLN HA H N N 101 GLN HB2 H N N 102 GLN HB3 H N N 103 GLN HG2 H N N 104 GLN HG3 H N N 105 GLN HE21 H N N 106 GLN HE22 H N N 107 GLN HXT H N N 108 GLU N N N N 109 GLU CA C N S 110 GLU C C N N 111 GLU O O N N 112 GLU CB C N N 113 GLU CG C N N 114 GLU CD C N N 115 GLU OE1 O N N 116 GLU OE2 O N N 117 GLU OXT O N N 118 GLU H H N N 119 GLU H2 H N N 120 GLU HA H N N 121 GLU HB2 H N N 122 GLU HB3 H N N 123 GLU HG2 H N N 124 GLU HG3 H N N 125 GLU HE2 H N N 126 GLU HXT H N N 127 GLY N N N N 128 GLY CA C N N 129 GLY C C N N 130 GLY O O N N 131 GLY OXT O N N 132 GLY H H N N 133 GLY H2 H N N 134 GLY HA2 H N N 135 GLY HA3 H N N 136 GLY HXT H N N 137 HIS N N N N 138 HIS CA C N S 139 HIS C C N N 140 HIS O O N N 141 HIS CB C N N 142 HIS CG C Y N 143 HIS ND1 N Y N 144 HIS CD2 C Y N 145 HIS CE1 C Y N 146 HIS NE2 N Y N 147 HIS OXT O N N 148 HIS H H N N 149 HIS H2 H N N 150 HIS HA H N N 151 HIS HB2 H N N 152 HIS HB3 H N N 153 HIS HD1 H N N 154 HIS HD2 H N N 155 HIS HE1 H N N 156 HIS HE2 H N N 157 HIS HXT H N N 158 HOH O O N N 159 HOH H1 H N N 160 HOH H2 H N N 161 ILE N N N N 162 ILE CA C N S 163 ILE C C N N 164 ILE O O N N 165 ILE CB C N S 166 ILE CG1 C N N 167 ILE CG2 C N N 168 ILE CD1 C N N 169 ILE OXT O N N 170 ILE H H N N 171 ILE H2 H N N 172 ILE HA H N N 173 ILE HB H N N 174 ILE HG12 H N N 175 ILE HG13 H N N 176 ILE HG21 H N N 177 ILE HG22 H N N 178 ILE HG23 H N N 179 ILE HD11 H N N 180 ILE HD12 H N N 181 ILE HD13 H N N 182 ILE HXT H N N 183 LEU N N N N 184 LEU CA C N S 185 LEU C C N N 186 LEU O O N N 187 LEU CB C N N 188 LEU CG C N N 189 LEU CD1 C N N 190 LEU CD2 C N N 191 LEU OXT O N N 192 LEU H H N N 193 LEU H2 H N N 194 LEU HA H N N 195 LEU HB2 H N N 196 LEU HB3 H N N 197 LEU HG H N N 198 LEU HD11 H N N 199 LEU HD12 H N N 200 LEU HD13 H N N 201 LEU HD21 H N N 202 LEU HD22 H N N 203 LEU HD23 H N N 204 LEU HXT H N N 205 LYS N N N N 206 LYS CA C N S 207 LYS C C N N 208 LYS O O N N 209 LYS CB C N N 210 LYS CG C N N 211 LYS CD C N N 212 LYS CE C N N 213 LYS NZ N N N 214 LYS OXT O N N 215 LYS H H N N 216 LYS H2 H N N 217 LYS HA H N N 218 LYS HB2 H N N 219 LYS HB3 H N N 220 LYS HG2 H N N 221 LYS HG3 H N N 222 LYS HD2 H N N 223 LYS HD3 H N N 224 LYS HE2 H N N 225 LYS HE3 H N N 226 LYS HZ1 H N N 227 LYS HZ2 H N N 228 LYS HZ3 H N N 229 LYS HXT H N N 230 MET N N N N 231 MET CA C N S 232 MET C C N N 233 MET O O N N 234 MET CB C N N 235 MET CG C N N 236 MET SD S N N 237 MET CE C N N 238 MET OXT O N N 239 MET H H N N 240 MET H2 H N N 241 MET HA H N N 242 MET HB2 H N N 243 MET HB3 H N N 244 MET HG2 H N N 245 MET HG3 H N N 246 MET HE1 H N N 247 MET HE2 H N N 248 MET HE3 H N N 249 MET HXT H N N 250 PHE N N N N 251 PHE CA C N S 252 PHE C C N N 253 PHE O O N N 254 PHE CB C N N 255 PHE CG C Y N 256 PHE CD1 C Y N 257 PHE CD2 C Y N 258 PHE CE1 C Y N 259 PHE CE2 C Y N 260 PHE CZ C Y N 261 PHE OXT O N N 262 PHE H H N N 263 PHE H2 H N N 264 PHE HA H N N 265 PHE HB2 H N N 266 PHE HB3 H N N 267 PHE HD1 H N N 268 PHE HD2 H N N 269 PHE HE1 H N N 270 PHE HE2 H N N 271 PHE HZ H N N 272 PHE HXT H N N 273 PRO N N N N 274 PRO CA C N S 275 PRO C C N N 276 PRO O O N N 277 PRO CB C N N 278 PRO CG C N N 279 PRO CD C N N 280 PRO OXT O N N 281 PRO H H N N 282 PRO HA H N N 283 PRO HB2 H N N 284 PRO HB3 H N N 285 PRO HG2 H N N 286 PRO HG3 H N N 287 PRO HD2 H N N 288 PRO HD3 H N N 289 PRO HXT H N N 290 SER N N N N 291 SER CA C N S 292 SER C C N N 293 SER O O N N 294 SER CB C N N 295 SER OG O N N 296 SER OXT O N N 297 SER H H N N 298 SER H2 H N N 299 SER HA H N N 300 SER HB2 H N N 301 SER HB3 H N N 302 SER HG H N N 303 SER HXT H N N 304 THR N N N N 305 THR CA C N S 306 THR C C N N 307 THR O O N N 308 THR CB C N R 309 THR OG1 O N N 310 THR CG2 C N N 311 THR OXT O N N 312 THR H H N N 313 THR H2 H N N 314 THR HA H N N 315 THR HB H N N 316 THR HG1 H N N 317 THR HG21 H N N 318 THR HG22 H N N 319 THR HG23 H N N 320 THR HXT H N N 321 TRP N N N N 322 TRP CA C N S 323 TRP C C N N 324 TRP O O N N 325 TRP CB C N N 326 TRP CG C Y N 327 TRP CD1 C Y N 328 TRP CD2 C Y N 329 TRP NE1 N Y N 330 TRP CE2 C Y N 331 TRP CE3 C Y N 332 TRP CZ2 C Y N 333 TRP CZ3 C Y N 334 TRP CH2 C Y N 335 TRP OXT O N N 336 TRP H H N N 337 TRP H2 H N N 338 TRP HA H N N 339 TRP HB2 H N N 340 TRP HB3 H N N 341 TRP HD1 H N N 342 TRP HE1 H N N 343 TRP HE3 H N N 344 TRP HZ2 H N N 345 TRP HZ3 H N N 346 TRP HH2 H N N 347 TRP HXT H N N 348 TYR N N N N 349 TYR CA C N S 350 TYR C C N N 351 TYR O O N N 352 TYR CB C N N 353 TYR CG C Y N 354 TYR CD1 C Y N 355 TYR CD2 C Y N 356 TYR CE1 C Y N 357 TYR CE2 C Y N 358 TYR CZ C Y N 359 TYR OH O N N 360 TYR OXT O N N 361 TYR H H N N 362 TYR H2 H N N 363 TYR HA H N N 364 TYR HB2 H N N 365 TYR HB3 H N N 366 TYR HD1 H N N 367 TYR HD2 H N N 368 TYR HE1 H N N 369 TYR HE2 H N N 370 TYR HH H N N 371 TYR HXT H N N 372 VAL N N N N 373 VAL CA C N S 374 VAL C C N N 375 VAL O O N N 376 VAL CB C N N 377 VAL CG1 C N N 378 VAL CG2 C N N 379 VAL OXT O N N 380 VAL H H N N 381 VAL H2 H N N 382 VAL HA H N N 383 VAL HB H N N 384 VAL HG11 H N N 385 VAL HG12 H N N 386 VAL HG13 H N N 387 VAL HG21 H N N 388 VAL HG22 H N N 389 VAL HG23 H N N 390 VAL HXT H N N 391 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MET N CA sing N N 218 MET N H sing N N 219 MET N H2 sing N N 220 MET CA C sing N N 221 MET CA CB sing N N 222 MET CA HA sing N N 223 MET C O doub N N 224 MET C OXT sing N N 225 MET CB CG sing N N 226 MET CB HB2 sing N N 227 MET CB HB3 sing N N 228 MET CG SD sing N N 229 MET CG HG2 sing N N 230 MET CG HG3 sing N N 231 MET SD CE sing N N 232 MET CE HE1 sing N N 233 MET CE HE2 sing N N 234 MET CE HE3 sing N N 235 MET OXT HXT sing N N 236 PHE N CA sing N N 237 PHE N H sing N N 238 PHE N H2 sing N N 239 PHE CA C sing N N 240 PHE CA CB sing N N 241 PHE CA HA sing N N 242 PHE C O doub N N 243 PHE C OXT sing N N 244 PHE CB CG sing N N 245 PHE CB HB2 sing N N 246 PHE CB HB3 sing N N 247 PHE CG CD1 doub Y N 248 PHE CG CD2 sing Y N 249 PHE CD1 CE1 sing Y N 250 PHE CD1 HD1 sing N N 251 PHE CD2 CE2 doub Y N 252 PHE CD2 HD2 sing N N 253 PHE CE1 CZ doub Y N 254 PHE CE1 HE1 sing N N 255 PHE CE2 CZ sing Y N 256 PHE CE2 HE2 sing N N 257 PHE CZ HZ sing N N 258 PHE OXT HXT sing N N 259 PRO N CA sing N N 260 PRO N CD sing N N 261 PRO N H sing N N 262 PRO CA C sing N N 263 PRO CA CB sing N N 264 PRO CA HA sing N N 265 PRO C O doub N N 266 PRO C OXT sing N N 267 PRO CB CG sing N N 268 PRO CB HB2 sing N N 269 PRO CB HB3 sing N N 270 PRO CG CD sing N N 271 PRO CG HG2 sing N N 272 PRO CG HG3 sing N N 273 PRO CD HD2 sing N N 274 PRO CD HD3 sing N N 275 PRO OXT HXT sing N N 276 SER N CA sing N N 277 SER N H sing N N 278 SER N H2 sing N N 279 SER CA C sing N N 280 SER CA CB sing N N 281 SER CA HA sing N N 282 SER C O doub N N 283 SER C OXT sing N N 284 SER CB OG sing N N 285 SER CB HB2 sing N N 286 SER CB HB3 sing N N 287 SER OG HG sing N N 288 SER OXT HXT sing N N 289 THR N CA sing N N 290 THR N H sing N N 291 THR N H2 sing N N 292 THR CA C sing N N 293 THR CA CB sing N N 294 THR CA HA sing N N 295 THR C O doub N N 296 THR C OXT sing N N 297 THR CB OG1 sing N N 298 THR CB CG2 sing N N 299 THR CB HB sing N N 300 THR OG1 HG1 sing N N 301 THR CG2 HG21 sing N N 302 THR CG2 HG22 sing N N 303 THR CG2 HG23 sing N N 304 THR OXT HXT sing N N 305 TRP N CA sing N N 306 TRP N H sing N N 307 TRP N H2 sing N N 308 TRP CA C sing N N 309 TRP CA CB sing N N 310 TRP CA HA sing N N 311 TRP C O doub N N 312 TRP C OXT sing N N 313 TRP CB CG sing N N 314 TRP CB HB2 sing N N 315 TRP CB HB3 sing N N 316 TRP CG CD1 doub Y N 317 TRP CG CD2 sing Y N 318 TRP CD1 NE1 sing Y N 319 TRP CD1 HD1 sing N N 320 TRP CD2 CE2 doub Y N 321 TRP CD2 CE3 sing Y N 322 TRP NE1 CE2 sing Y N 323 TRP NE1 HE1 sing N N 324 TRP CE2 CZ2 sing Y N 325 TRP CE3 CZ3 doub Y N 326 TRP CE3 HE3 sing N N 327 TRP CZ2 CH2 doub Y N 328 TRP CZ2 HZ2 sing N N 329 TRP CZ3 CH2 sing Y N 330 TRP CZ3 HZ3 sing N N 331 TRP CH2 HH2 sing N N 332 TRP OXT HXT sing N N 333 TYR N CA sing N N 334 TYR N H sing N N 335 TYR N H2 sing N N 336 TYR CA C sing N N 337 TYR CA CB sing N N 338 TYR CA HA sing N N 339 TYR C O doub N N 340 TYR C OXT sing N N 341 TYR CB CG sing N N 342 TYR CB HB2 sing N N 343 TYR CB HB3 sing N N 344 TYR CG CD1 doub Y N 345 TYR CG CD2 sing Y N 346 TYR CD1 CE1 sing Y N 347 TYR CD1 HD1 sing N N 348 TYR CD2 CE2 doub Y N 349 TYR CD2 HD2 sing N N 350 TYR CE1 CZ doub Y N 351 TYR CE1 HE1 sing N N 352 TYR CE2 CZ sing Y N 353 TYR CE2 HE2 sing N N 354 TYR CZ OH sing N N 355 TYR OH HH sing N N 356 TYR OXT HXT sing N N 357 VAL N CA sing N N 358 VAL N H sing N N 359 VAL N H2 sing N N 360 VAL CA C sing N N 361 VAL CA CB sing N N 362 VAL CA HA sing N N 363 VAL C O doub N N 364 VAL C OXT sing N N 365 VAL CB CG1 sing N N 366 VAL CB CG2 sing N N 367 VAL CB HB sing N N 368 VAL CG1 HG11 sing N N 369 VAL CG1 HG12 sing N N 370 VAL CG1 HG13 sing N N 371 VAL CG2 HG21 sing N N 372 VAL CG2 HG22 sing N N 373 VAL CG2 HG23 sing N N 374 VAL OXT HXT sing N N 375 # _pdbx_audit_support.funding_organization 'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' _pdbx_audit_support.country 'United States' _pdbx_audit_support.grant_number GM135315 _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 8VA8 _pdbx_initial_refinement_model.details ? # _space_group.name_H-M_alt 'P 62 2 2' _space_group.name_Hall 'P 62 2 (x,y,z+1/3)' _space_group.IT_number 180 _space_group.crystal_system hexagonal _space_group.id 1 # _atom_sites.entry_id 8VAB _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 0.010766 _atom_sites.fract_transf_matrix[1][2] 0.006216 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.012432 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.008147 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.scat_dispersion_real _atom_type.scat_dispersion_imag _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c _atom_type.scat_source _atom_type.scat_dispersion_source C ? ? 3.54356 2.42580 ? ? 25.62398 1.50364 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? FE ? ? 20.90327 4.99816 ? ? 2.55100 38.46870 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? N ? ? 4.01032 2.96436 ? ? 19.97189 1.75589 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O ? ? 7.96527 ? ? ? 9.05267 ? ? ? 0.0 ;1-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? S ? ? 9.55732 6.39887 ? ? 1.23737 29.19336 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? # loop_