data_8VL4 # _entry.id 8VL4 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.404 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 8VL4 pdb_00008vl4 10.2210/pdb8vl4/pdb WWPDB D_1000280462 ? ? BMRB 31137 ? 10.13018/BMR31137 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date _pdbx_audit_revision_history.part_number 1 'Structure model' 1 0 2024-08-07 ? 2 'Structure model' 1 1 2024-12-04 ? 3 'Structure model' 1 2 2025-08-20 ? # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 2 'Structure model' 'Structure summary' 3 3 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 2 'Structure model' pdbx_entry_details 4 3 'Structure model' citation # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_ASTM' 4 2 'Structure model' '_citation.journal_id_CSD' 5 2 'Structure model' '_citation.journal_id_ISSN' 6 2 'Structure model' '_citation.pdbx_database_id_DOI' 7 2 'Structure model' '_citation.pdbx_database_id_PubMed' 8 2 'Structure model' '_citation.title' 9 2 'Structure model' '_citation.year' 10 3 'Structure model' '_citation.journal_volume' 11 3 'Structure model' '_citation.page_first' 12 3 'Structure model' '_citation.page_last' 13 3 'Structure model' '_citation.year' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr . _pdbx_database_status.entry_id 8VL4 _pdbx_database_status.recvd_initial_deposition_date 2024-01-11 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs . _pdbx_database_status.status_code_nmr_data REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_database_related.db_name BMRB _pdbx_database_related.details 'Solution NMR Structure of de novo design protein 312 parent' _pdbx_database_related.db_id 31137 _pdbx_database_related.content_type unspecified # _pdbx_contact_author.id 2 _pdbx_contact_author.email andrew.mcshan@chemistry.gatech.edu _pdbx_contact_author.name_first Andrew _pdbx_contact_author.name_last McShan _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-3212-9867 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'McShan, A.C.' 1 0000-0002-3212-9867 'Simma, M.K.' 2 0000-0002-7549-1671 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Nat.Biotechnol. _citation.journal_id_ASTM NABIF9 _citation.journal_id_CSD 2119 _citation.journal_id_ISSN 1087-0156 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 43 _citation.language ? _citation.page_first 1288 _citation.page_last 1298 _citation.title 'Multistate and functional protein design using RoseTTAFold sequence space diffusion.' _citation.year 2025 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1038/s41587-024-02395-w _citation.pdbx_database_id_PubMed 39322764 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Lisanza, S.L.' 1 ? primary 'Gershon, J.M.' 2 ? primary 'Tipps, S.W.K.' 3 0000-0001-9056-8959 primary 'Sims, J.N.' 4 ? primary 'Arnoldt, L.' 5 0000-0001-6218-7729 primary 'Hendel, S.J.' 6 ? primary 'Simma, M.K.' 7 ? primary 'Liu, G.' 8 ? primary 'Yase, M.' 9 ? primary 'Wu, H.' 10 ? primary 'Tharp, C.D.' 11 ? primary 'Li, X.' 12 ? primary 'Kang, A.' 13 0000-0001-5487-0499 primary 'Brackenbrough, E.' 14 ? primary 'Bera, A.K.' 15 0000-0001-9473-2912 primary 'Gerben, S.' 16 0000-0003-0313-6248 primary 'Wittmann, B.J.' 17 0000-0001-8144-9157 primary 'McShan, A.C.' 18 0000-0002-3212-9867 primary 'Baker, D.' 19 0000-0001-7896-6217 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'De novo design protein 312 parent' _entity.formula_weight 12981.034 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GLLTREEIEAALKEAGFTEEEIRKVLAWLERVGGERKVLKVAGKILIIVEKRAGSRLLLLYAGRVIEKEGMSREEVEAIK QLISAGATVEEIEAIIKRIEARGSHHWGSHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;GLLTREEIEAALKEAGFTEEEIRKVLAWLERVGGERKVLKVAGKILIIVEKRAGSRLLLLYAGRVIEKEGMSREEVEAIK QLISAGATVEEIEAIIKRIEARGSHHWGSHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 LEU n 1 3 LEU n 1 4 THR n 1 5 ARG n 1 6 GLU n 1 7 GLU n 1 8 ILE n 1 9 GLU n 1 10 ALA n 1 11 ALA n 1 12 LEU n 1 13 LYS n 1 14 GLU n 1 15 ALA n 1 16 GLY n 1 17 PHE n 1 18 THR n 1 19 GLU n 1 20 GLU n 1 21 GLU n 1 22 ILE n 1 23 ARG n 1 24 LYS n 1 25 VAL n 1 26 LEU n 1 27 ALA n 1 28 TRP n 1 29 LEU n 1 30 GLU n 1 31 ARG n 1 32 VAL n 1 33 GLY n 1 34 GLY n 1 35 GLU n 1 36 ARG n 1 37 LYS n 1 38 VAL n 1 39 LEU n 1 40 LYS n 1 41 VAL n 1 42 ALA n 1 43 GLY n 1 44 LYS n 1 45 ILE n 1 46 LEU n 1 47 ILE n 1 48 ILE n 1 49 VAL n 1 50 GLU n 1 51 LYS n 1 52 ARG n 1 53 ALA n 1 54 GLY n 1 55 SER n 1 56 ARG n 1 57 LEU n 1 58 LEU n 1 59 LEU n 1 60 LEU n 1 61 TYR n 1 62 ALA n 1 63 GLY n 1 64 ARG n 1 65 VAL n 1 66 ILE n 1 67 GLU n 1 68 LYS n 1 69 GLU n 1 70 GLY n 1 71 MET n 1 72 SER n 1 73 ARG n 1 74 GLU n 1 75 GLU n 1 76 VAL n 1 77 GLU n 1 78 ALA n 1 79 ILE n 1 80 LYS n 1 81 GLN n 1 82 LEU n 1 83 ILE n 1 84 SER n 1 85 ALA n 1 86 GLY n 1 87 ALA n 1 88 THR n 1 89 VAL n 1 90 GLU n 1 91 GLU n 1 92 ILE n 1 93 GLU n 1 94 ALA n 1 95 ILE n 1 96 ILE n 1 97 LYS n 1 98 ARG n 1 99 ILE n 1 100 GLU n 1 101 ALA n 1 102 ARG n 1 103 GLY n 1 104 SER n 1 105 HIS n 1 106 HIS n 1 107 TRP n 1 108 GLY n 1 109 SER n 1 110 HIS n 1 111 HIS n 1 112 HIS n 1 113 HIS n 1 114 HIS n 1 115 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 115 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'synthetic construct' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 32630 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 LEU 2 2 2 LEU LEU A . n A 1 3 LEU 3 3 3 LEU LEU A . n A 1 4 THR 4 4 4 THR THR A . n A 1 5 ARG 5 5 5 ARG ARG A . n A 1 6 GLU 6 6 6 GLU GLU A . n A 1 7 GLU 7 7 7 GLU GLU A . n A 1 8 ILE 8 8 8 ILE ILE A . n A 1 9 GLU 9 9 9 GLU GLU A . n A 1 10 ALA 10 10 10 ALA ALA A . n A 1 11 ALA 11 11 11 ALA ALA A . n A 1 12 LEU 12 12 12 LEU LEU A . n A 1 13 LYS 13 13 13 LYS LYS A . n A 1 14 GLU 14 14 14 GLU GLU A . n A 1 15 ALA 15 15 15 ALA ALA A . n A 1 16 GLY 16 16 16 GLY GLY A . n A 1 17 PHE 17 17 17 PHE PHE A . n A 1 18 THR 18 18 18 THR THR A . n A 1 19 GLU 19 19 19 GLU GLU A . n A 1 20 GLU 20 20 20 GLU GLU A . n A 1 21 GLU 21 21 21 GLU GLU A . n A 1 22 ILE 22 22 22 ILE ILE A . n A 1 23 ARG 23 23 23 ARG ARG A . n A 1 24 LYS 24 24 24 LYS LYS A . n A 1 25 VAL 25 25 25 VAL VAL A . n A 1 26 LEU 26 26 26 LEU LEU A . n A 1 27 ALA 27 27 27 ALA ALA A . n A 1 28 TRP 28 28 28 TRP TRP A . n A 1 29 LEU 29 29 29 LEU LEU A . n A 1 30 GLU 30 30 30 GLU GLU A . n A 1 31 ARG 31 31 31 ARG ARG A . n A 1 32 VAL 32 32 32 VAL VAL A . n A 1 33 GLY 33 33 33 GLY GLY A . n A 1 34 GLY 34 34 34 GLY GLY A . n A 1 35 GLU 35 35 35 GLU GLU A . n A 1 36 ARG 36 36 36 ARG ARG A . n A 1 37 LYS 37 37 37 LYS LYS A . n A 1 38 VAL 38 38 38 VAL VAL A . n A 1 39 LEU 39 39 39 LEU LEU A . n A 1 40 LYS 40 40 40 LYS LYS A . n A 1 41 VAL 41 41 41 VAL VAL A . n A 1 42 ALA 42 42 42 ALA ALA A . n A 1 43 GLY 43 43 43 GLY GLY A . n A 1 44 LYS 44 44 44 LYS LYS A . n A 1 45 ILE 45 45 45 ILE ILE A . n A 1 46 LEU 46 46 46 LEU LEU A . n A 1 47 ILE 47 47 47 ILE ILE A . n A 1 48 ILE 48 48 48 ILE ILE A . n A 1 49 VAL 49 49 49 VAL VAL A . n A 1 50 GLU 50 50 50 GLU GLU A . n A 1 51 LYS 51 51 51 LYS LYS A . n A 1 52 ARG 52 52 52 ARG ARG A . n A 1 53 ALA 53 53 53 ALA ALA A . n A 1 54 GLY 54 54 54 GLY GLY A . n A 1 55 SER 55 55 55 SER SER A . n A 1 56 ARG 56 56 56 ARG ARG A . n A 1 57 LEU 57 57 57 LEU LEU A . n A 1 58 LEU 58 58 58 LEU LEU A . n A 1 59 LEU 59 59 59 LEU LEU A . n A 1 60 LEU 60 60 60 LEU LEU A . n A 1 61 TYR 61 61 61 TYR TYR A . n A 1 62 ALA 62 62 62 ALA ALA A . n A 1 63 GLY 63 63 63 GLY GLY A . n A 1 64 ARG 64 64 64 ARG ARG A . n A 1 65 VAL 65 65 65 VAL VAL A . n A 1 66 ILE 66 66 66 ILE ILE A . n A 1 67 GLU 67 67 67 GLU GLU A . n A 1 68 LYS 68 68 68 LYS LYS A . n A 1 69 GLU 69 69 69 GLU GLU A . n A 1 70 GLY 70 70 70 GLY GLY A . n A 1 71 MET 71 71 71 MET MET A . n A 1 72 SER 72 72 72 SER SER A . n A 1 73 ARG 73 73 73 ARG ARG A . n A 1 74 GLU 74 74 74 GLU GLU A . n A 1 75 GLU 75 75 75 GLU GLU A . n A 1 76 VAL 76 76 76 VAL VAL A . n A 1 77 GLU 77 77 77 GLU GLU A . n A 1 78 ALA 78 78 78 ALA ALA A . n A 1 79 ILE 79 79 79 ILE ILE A . n A 1 80 LYS 80 80 80 LYS LYS A . n A 1 81 GLN 81 81 81 GLN GLN A . n A 1 82 LEU 82 82 82 LEU LEU A . n A 1 83 ILE 83 83 83 ILE ILE A . n A 1 84 SER 84 84 84 SER SER A . n A 1 85 ALA 85 85 85 ALA ALA A . n A 1 86 GLY 86 86 86 GLY GLY A . n A 1 87 ALA 87 87 87 ALA ALA A . n A 1 88 THR 88 88 88 THR THR A . n A 1 89 VAL 89 89 89 VAL VAL A . n A 1 90 GLU 90 90 90 GLU GLU A . n A 1 91 GLU 91 91 91 GLU GLU A . n A 1 92 ILE 92 92 92 ILE ILE A . n A 1 93 GLU 93 93 93 GLU GLU A . n A 1 94 ALA 94 94 94 ALA ALA A . n A 1 95 ILE 95 95 95 ILE ILE A . n A 1 96 ILE 96 96 96 ILE ILE A . n A 1 97 LYS 97 97 97 LYS LYS A . n A 1 98 ARG 98 98 98 ARG ARG A . n A 1 99 ILE 99 99 99 ILE ILE A . n A 1 100 GLU 100 100 100 GLU GLU A . n A 1 101 ALA 101 101 101 ALA ALA A . n A 1 102 ARG 102 102 102 ARG ARG A . n A 1 103 GLY 103 103 ? ? ? A . n A 1 104 SER 104 104 ? ? ? A . n A 1 105 HIS 105 105 ? ? ? A . n A 1 106 HIS 106 106 ? ? ? A . n A 1 107 TRP 107 107 ? ? ? A . n A 1 108 GLY 108 108 ? ? ? A . n A 1 109 SER 109 109 ? ? ? A . n A 1 110 HIS 110 110 ? ? ? A . n A 1 111 HIS 111 111 ? ? ? A . n A 1 112 HIS 112 112 ? ? ? A . n A 1 113 HIS 113 113 ? ? ? A . n A 1 114 HIS 114 114 ? ? ? A . n A 1 115 HIS 115 115 ? ? ? A . n # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 8VL4 _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 8VL4 _struct.title 'Solution NMR Structure of de novo design protein 312 parent' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 8VL4 _struct_keywords.text 'De Novo design, Machine Learning, Fold-Switching, DE NOVO PROTEIN' _struct_keywords.pdbx_keywords 'DE NOVO PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name PDB _struct_ref.db_code 8VL4 _struct_ref.pdbx_db_accession 8VL4 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 8VL4 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 115 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession 8VL4 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 115 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 115 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details 'not applicable' # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0 _pdbx_struct_oper_list.matrix[1][2] 0.0 _pdbx_struct_oper_list.matrix[1][3] 0.0 _pdbx_struct_oper_list.vector[1] 0.0 _pdbx_struct_oper_list.matrix[2][1] 0.0 _pdbx_struct_oper_list.matrix[2][2] 1.0 _pdbx_struct_oper_list.matrix[2][3] 0.0 _pdbx_struct_oper_list.vector[2] 0.0 _pdbx_struct_oper_list.matrix[3][1] 0.0 _pdbx_struct_oper_list.matrix[3][2] 0.0 _pdbx_struct_oper_list.matrix[3][3] 1.0 _pdbx_struct_oper_list.vector[3] 0.0 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 THR A 4 ? GLY A 16 ? THR A 4 GLY A 16 1 ? 13 HELX_P HELX_P2 AA2 THR A 18 ? GLY A 33 ? THR A 18 GLY A 33 1 ? 16 HELX_P HELX_P3 AA3 SER A 72 ? ALA A 85 ? SER A 72 ALA A 85 1 ? 14 HELX_P HELX_P4 AA4 THR A 88 ? ALA A 101 ? THR A 88 ALA A 101 1 ? 14 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 4 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 GLU A 35 ? VAL A 41 ? GLU A 35 VAL A 41 AA1 2 LYS A 44 ? GLU A 50 ? LYS A 44 GLU A 50 AA1 3 SER A 55 ? TYR A 61 ? SER A 55 TYR A 61 AA1 4 ARG A 64 ? MET A 71 ? ARG A 64 MET A 71 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N LEU A 39 ? N LEU A 39 O LEU A 46 ? O LEU A 46 AA1 2 3 N VAL A 49 ? N VAL A 49 O ARG A 56 ? O ARG A 56 AA1 3 4 N SER A 55 ? N SER A 55 O MET A 71 ? O MET A 71 # _pdbx_entry_details.entry_id 8VL4 _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 TYR A 61 ? ? -171.17 129.14 2 2 TYR A 61 ? ? -171.65 128.88 3 4 TYR A 61 ? ? -172.13 129.11 4 5 TYR A 61 ? ? -171.07 128.93 5 6 VAL A 41 ? ? -95.20 -68.28 6 7 TYR A 61 ? ? -171.76 129.49 7 8 TYR A 61 ? ? -170.24 131.96 8 10 TYR A 61 ? ? -179.05 144.71 # _pdbx_nmr_ensemble.entry_id 8VL4 _pdbx_nmr_ensemble.conformers_calculated_total_number 30000 _pdbx_nmr_ensemble.conformers_submitted_total_number 10 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 8VL4 _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '205 uM [U-13C; U-15N] 312 Parent, 100mM NaCl, 20mM Sodium Phosphate, 90% H2O/10% D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' _pdbx_nmr_sample_details.label 15N13C_sample _pdbx_nmr_sample_details.type solution _pdbx_nmr_sample_details.details ;100mM NaCl 20mM Sodium Phosphate pH 6.5 ; # loop_ _pdbx_nmr_exptl_sample.solution_id _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling 1 '312 Parent' 205 ? uM '[U-13C; U-15N]' 2 NaCl 100 ? mM 'natural abundance' 3 'Sodium Phosphate' 20 ? mM 'natural abundance' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 310.15 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 6.5 _pdbx_nmr_exptl_sample_conditions.ionic_strength 100 _pdbx_nmr_exptl_sample_conditions.details ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_err ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units mM _pdbx_nmr_exptl_sample_conditions.label conditions_1 _pdbx_nmr_exptl_sample_conditions.pH_err ? _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 '2D HSQC' 1 isotropic 2 1 1 '3D HNCA' 1 isotropic 3 1 1 '3D HNCACB' 1 isotropic 4 1 1 '3D HNCO' 1 isotropic 5 1 1 '3D CBCA(CO)NH' 1 isotropic 6 1 1 '3D 1H-15N NOESY' 1 isotropic # _pdbx_nmr_refine.entry_id 8VL4 _pdbx_nmr_refine.method na _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 3 # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 processing NMRPipe ? 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' 2 'chemical shift assignment' Sparky ? Goddard 3 refinement CS-ROSETTA ? 'Shen, Vernon, Baker and Bax' 4 'structure calculation' TALOS-N ? Bax 5 'structure calculation' CS-ROSETTA ? 'Shen, Vernon, Baker and Bax' # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 103 ? A GLY 103 2 1 Y 1 A SER 104 ? A SER 104 3 1 Y 1 A HIS 105 ? A HIS 105 4 1 Y 1 A HIS 106 ? A HIS 106 5 1 Y 1 A TRP 107 ? A TRP 107 6 1 Y 1 A GLY 108 ? A GLY 108 7 1 Y 1 A SER 109 ? A SER 109 8 1 Y 1 A HIS 110 ? A HIS 110 9 1 Y 1 A HIS 111 ? A HIS 111 10 1 Y 1 A HIS 112 ? A HIS 112 11 1 Y 1 A HIS 113 ? A HIS 113 12 1 Y 1 A HIS 114 ? A HIS 114 13 1 Y 1 A HIS 115 ? A HIS 115 14 2 Y 1 A GLY 103 ? A GLY 103 15 2 Y 1 A SER 104 ? A SER 104 16 2 Y 1 A HIS 105 ? A HIS 105 17 2 Y 1 A HIS 106 ? A HIS 106 18 2 Y 1 A TRP 107 ? A TRP 107 19 2 Y 1 A GLY 108 ? A GLY 108 20 2 Y 1 A SER 109 ? A SER 109 21 2 Y 1 A HIS 110 ? A HIS 110 22 2 Y 1 A HIS 111 ? A HIS 111 23 2 Y 1 A HIS 112 ? A HIS 112 24 2 Y 1 A HIS 113 ? A HIS 113 25 2 Y 1 A HIS 114 ? A HIS 114 26 2 Y 1 A HIS 115 ? A HIS 115 27 3 Y 1 A GLY 103 ? A GLY 103 28 3 Y 1 A SER 104 ? A SER 104 29 3 Y 1 A HIS 105 ? A HIS 105 30 3 Y 1 A HIS 106 ? A HIS 106 31 3 Y 1 A TRP 107 ? A TRP 107 32 3 Y 1 A GLY 108 ? A GLY 108 33 3 Y 1 A SER 109 ? A SER 109 34 3 Y 1 A HIS 110 ? A HIS 110 35 3 Y 1 A HIS 111 ? A HIS 111 36 3 Y 1 A HIS 112 ? A HIS 112 37 3 Y 1 A HIS 113 ? A HIS 113 38 3 Y 1 A HIS 114 ? A HIS 114 39 3 Y 1 A HIS 115 ? A HIS 115 40 4 Y 1 A GLY 103 ? A GLY 103 41 4 Y 1 A SER 104 ? A SER 104 42 4 Y 1 A HIS 105 ? A HIS 105 43 4 Y 1 A HIS 106 ? A HIS 106 44 4 Y 1 A TRP 107 ? A TRP 107 45 4 Y 1 A GLY 108 ? A GLY 108 46 4 Y 1 A SER 109 ? A SER 109 47 4 Y 1 A HIS 110 ? A HIS 110 48 4 Y 1 A HIS 111 ? A HIS 111 49 4 Y 1 A HIS 112 ? A HIS 112 50 4 Y 1 A HIS 113 ? A HIS 113 51 4 Y 1 A HIS 114 ? A HIS 114 52 4 Y 1 A HIS 115 ? A HIS 115 53 5 Y 1 A GLY 103 ? A GLY 103 54 5 Y 1 A SER 104 ? A SER 104 55 5 Y 1 A HIS 105 ? A HIS 105 56 5 Y 1 A HIS 106 ? A HIS 106 57 5 Y 1 A TRP 107 ? A TRP 107 58 5 Y 1 A GLY 108 ? A GLY 108 59 5 Y 1 A SER 109 ? A SER 109 60 5 Y 1 A HIS 110 ? A HIS 110 61 5 Y 1 A HIS 111 ? A HIS 111 62 5 Y 1 A HIS 112 ? A HIS 112 63 5 Y 1 A HIS 113 ? A HIS 113 64 5 Y 1 A HIS 114 ? A HIS 114 65 5 Y 1 A HIS 115 ? A HIS 115 66 6 Y 1 A GLY 103 ? A GLY 103 67 6 Y 1 A SER 104 ? A SER 104 68 6 Y 1 A HIS 105 ? A HIS 105 69 6 Y 1 A HIS 106 ? A HIS 106 70 6 Y 1 A TRP 107 ? A TRP 107 71 6 Y 1 A GLY 108 ? A GLY 108 72 6 Y 1 A SER 109 ? A SER 109 73 6 Y 1 A HIS 110 ? A HIS 110 74 6 Y 1 A HIS 111 ? A HIS 111 75 6 Y 1 A HIS 112 ? A HIS 112 76 6 Y 1 A HIS 113 ? A HIS 113 77 6 Y 1 A HIS 114 ? A HIS 114 78 6 Y 1 A HIS 115 ? A HIS 115 79 7 Y 1 A GLY 103 ? A GLY 103 80 7 Y 1 A SER 104 ? A SER 104 81 7 Y 1 A HIS 105 ? A HIS 105 82 7 Y 1 A HIS 106 ? A HIS 106 83 7 Y 1 A TRP 107 ? A TRP 107 84 7 Y 1 A GLY 108 ? A GLY 108 85 7 Y 1 A SER 109 ? A SER 109 86 7 Y 1 A HIS 110 ? A HIS 110 87 7 Y 1 A HIS 111 ? A HIS 111 88 7 Y 1 A HIS 112 ? A HIS 112 89 7 Y 1 A HIS 113 ? A HIS 113 90 7 Y 1 A HIS 114 ? A HIS 114 91 7 Y 1 A HIS 115 ? A HIS 115 92 8 Y 1 A GLY 103 ? A GLY 103 93 8 Y 1 A SER 104 ? A SER 104 94 8 Y 1 A HIS 105 ? A HIS 105 95 8 Y 1 A HIS 106 ? A HIS 106 96 8 Y 1 A TRP 107 ? A TRP 107 97 8 Y 1 A GLY 108 ? A GLY 108 98 8 Y 1 A SER 109 ? A SER 109 99 8 Y 1 A HIS 110 ? A HIS 110 100 8 Y 1 A HIS 111 ? A HIS 111 101 8 Y 1 A HIS 112 ? A HIS 112 102 8 Y 1 A HIS 113 ? A HIS 113 103 8 Y 1 A HIS 114 ? A HIS 114 104 8 Y 1 A HIS 115 ? A HIS 115 105 9 Y 1 A GLY 103 ? A GLY 103 106 9 Y 1 A SER 104 ? A SER 104 107 9 Y 1 A HIS 105 ? A HIS 105 108 9 Y 1 A HIS 106 ? A HIS 106 109 9 Y 1 A TRP 107 ? A TRP 107 110 9 Y 1 A GLY 108 ? A GLY 108 111 9 Y 1 A SER 109 ? A SER 109 112 9 Y 1 A HIS 110 ? A HIS 110 113 9 Y 1 A HIS 111 ? A HIS 111 114 9 Y 1 A HIS 112 ? A HIS 112 115 9 Y 1 A HIS 113 ? A HIS 113 116 9 Y 1 A HIS 114 ? A HIS 114 117 9 Y 1 A HIS 115 ? A HIS 115 118 10 Y 1 A GLY 103 ? A GLY 103 119 10 Y 1 A SER 104 ? A SER 104 120 10 Y 1 A HIS 105 ? A HIS 105 121 10 Y 1 A HIS 106 ? A HIS 106 122 10 Y 1 A TRP 107 ? A TRP 107 123 10 Y 1 A GLY 108 ? A GLY 108 124 10 Y 1 A SER 109 ? A SER 109 125 10 Y 1 A HIS 110 ? A HIS 110 126 10 Y 1 A HIS 111 ? A HIS 111 127 10 Y 1 A HIS 112 ? A HIS 112 128 10 Y 1 A HIS 113 ? A HIS 113 129 10 Y 1 A HIS 114 ? A HIS 114 130 10 Y 1 A HIS 115 ? A HIS 115 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 GLN N N N N 41 GLN CA C N S 42 GLN C C N N 43 GLN O O N N 44 GLN CB C N N 45 GLN CG C N N 46 GLN CD C N N 47 GLN OE1 O N N 48 GLN NE2 N N N 49 GLN OXT O N N 50 GLN H H N N 51 GLN H2 H N N 52 GLN HA H N N 53 GLN HB2 H N N 54 GLN HB3 H N N 55 GLN HG2 H N N 56 GLN HG3 H N N 57 GLN HE21 H N N 58 GLN HE22 H N N 59 GLN HXT H N N 60 GLU N N N N 61 GLU CA C N S 62 GLU C C N N 63 GLU O O N N 64 GLU CB C N N 65 GLU CG C N N 66 GLU CD C N N 67 GLU OE1 O N N 68 GLU OE2 O N N 69 GLU OXT O N N 70 GLU H H N N 71 GLU H2 H N N 72 GLU HA H N N 73 GLU HB2 H N N 74 GLU HB3 H N N 75 GLU HG2 H N N 76 GLU HG3 H N N 77 GLU HE2 H N N 78 GLU HXT H N N 79 GLY N N N N 80 GLY CA C N N 81 GLY C C N N 82 GLY O O N N 83 GLY OXT O N N 84 GLY H H N N 85 GLY H2 H N N 86 GLY HA2 H N N 87 GLY HA3 H N N 88 GLY HXT H N N 89 HIS N N N N 90 HIS CA C N S 91 HIS C C N N 92 HIS O O N N 93 HIS CB C N N 94 HIS CG C Y N 95 HIS ND1 N Y N 96 HIS CD2 C Y N 97 HIS CE1 C Y N 98 HIS NE2 N Y N 99 HIS OXT O N N 100 HIS H H N N 101 HIS H2 H N N 102 HIS HA H N N 103 HIS HB2 H N N 104 HIS HB3 H N N 105 HIS HD1 H N N 106 HIS HD2 H N N 107 HIS HE1 H N N 108 HIS HE2 H N N 109 HIS HXT H N N 110 ILE N N N N 111 ILE CA C N S 112 ILE C C N N 113 ILE O O N N 114 ILE CB C N S 115 ILE CG1 C N N 116 ILE CG2 C N N 117 ILE CD1 C N N 118 ILE OXT O N N 119 ILE H H N N 120 ILE H2 H N N 121 ILE HA H N N 122 ILE HB H N N 123 ILE HG12 H N N 124 ILE HG13 H N N 125 ILE HG21 H N N 126 ILE HG22 H N N 127 ILE HG23 H N N 128 ILE HD11 H N N 129 ILE HD12 H N N 130 ILE HD13 H N N 131 ILE HXT H N N 132 LEU N N N N 133 LEU CA C N S 134 LEU C C N N 135 LEU O O N N 136 LEU CB C N N 137 LEU CG C N N 138 LEU CD1 C N N 139 LEU CD2 C N N 140 LEU OXT O N N 141 LEU H H N N 142 LEU H2 H N N 143 LEU HA H N N 144 LEU HB2 H N N 145 LEU HB3 H N N 146 LEU HG H N N 147 LEU HD11 H N N 148 LEU HD12 H N N 149 LEU HD13 H N N 150 LEU HD21 H N N 151 LEU HD22 H N N 152 LEU HD23 H N N 153 LEU HXT H N N 154 LYS N N N N 155 LYS CA C N S 156 LYS C C N N 157 LYS O O N N 158 LYS CB C N N 159 LYS CG C N N 160 LYS CD C N N 161 LYS CE C N N 162 LYS NZ N N N 163 LYS OXT O N N 164 LYS H H N N 165 LYS H2 H N N 166 LYS HA H N N 167 LYS HB2 H N N 168 LYS HB3 H N N 169 LYS HG2 H N N 170 LYS HG3 H N N 171 LYS HD2 H N N 172 LYS HD3 H N N 173 LYS HE2 H N N 174 LYS HE3 H N N 175 LYS HZ1 H N N 176 LYS HZ2 H N N 177 LYS HZ3 H N N 178 LYS HXT H N N 179 MET N N N N 180 MET CA C N S 181 MET C C N N 182 MET O O N N 183 MET CB C N N 184 MET CG C N N 185 MET SD S N N 186 MET CE C N N 187 MET OXT O N N 188 MET H H N N 189 MET H2 H N N 190 MET HA H N N 191 MET HB2 H N N 192 MET HB3 H N N 193 MET HG2 H N N 194 MET HG3 H N N 195 MET HE1 H N N 196 MET HE2 H N N 197 MET HE3 H N N 198 MET HXT H N N 199 PHE N N N N 200 PHE CA C N S 201 PHE C C N N 202 PHE O O N N 203 PHE CB C N N 204 PHE CG C Y N 205 PHE CD1 C Y N 206 PHE CD2 C Y N 207 PHE CE1 C Y N 208 PHE CE2 C Y N 209 PHE CZ C Y N 210 PHE OXT O N N 211 PHE H H N N 212 PHE H2 H N N 213 PHE HA H N N 214 PHE HB2 H N N 215 PHE HB3 H N N 216 PHE HD1 H N N 217 PHE HD2 H N N 218 PHE HE1 H N N 219 PHE HE2 H N N 220 PHE HZ H N N 221 PHE HXT H N N 222 SER N N N N 223 SER CA C N S 224 SER C C N N 225 SER O O N N 226 SER CB C N N 227 SER OG O N N 228 SER OXT O N N 229 SER H H N N 230 SER H2 H N N 231 SER HA H N N 232 SER HB2 H N N 233 SER HB3 H N N 234 SER HG H N N 235 SER HXT H N N 236 THR N N N N 237 THR CA C N S 238 THR C C N N 239 THR O O N N 240 THR CB C N R 241 THR OG1 O N N 242 THR CG2 C N N 243 THR OXT O N N 244 THR H H N N 245 THR H2 H N N 246 THR HA H N N 247 THR HB H N N 248 THR HG1 H N N 249 THR HG21 H N N 250 THR HG22 H N N 251 THR HG23 H N N 252 THR HXT H N N 253 TRP N N N N 254 TRP CA C N S 255 TRP C C N N 256 TRP O O N N 257 TRP CB C N N 258 TRP CG C Y N 259 TRP CD1 C Y N 260 TRP CD2 C Y N 261 TRP NE1 N Y N 262 TRP CE2 C Y N 263 TRP CE3 C Y N 264 TRP CZ2 C Y N 265 TRP CZ3 C Y N 266 TRP CH2 C Y N 267 TRP OXT O N N 268 TRP H H N N 269 TRP H2 H N N 270 TRP HA H N N 271 TRP HB2 H N N 272 TRP HB3 H N N 273 TRP HD1 H N N 274 TRP HE1 H N N 275 TRP HE3 H N N 276 TRP HZ2 H N N 277 TRP HZ3 H N N 278 TRP HH2 H N N 279 TRP HXT H N N 280 TYR N N N N 281 TYR CA C N S 282 TYR C C N N 283 TYR O O N N 284 TYR CB C N N 285 TYR CG C Y N 286 TYR CD1 C Y N 287 TYR CD2 C Y N 288 TYR CE1 C Y N 289 TYR CE2 C Y N 290 TYR CZ C Y N 291 TYR OH O N N 292 TYR OXT O N N 293 TYR H H N N 294 TYR H2 H N N 295 TYR HA H N N 296 TYR HB2 H N N 297 TYR HB3 H N N 298 TYR HD1 H N N 299 TYR HD2 H N N 300 TYR HE1 H N N 301 TYR HE2 H N N 302 TYR HH H N N 303 TYR HXT H N N 304 VAL N N N N 305 VAL CA C N S 306 VAL C C N N 307 VAL O O N N 308 VAL CB C N N 309 VAL CG1 C N N 310 VAL CG2 C N N 311 VAL OXT O N N 312 VAL H H N N 313 VAL H2 H N N 314 VAL HA H N N 315 VAL HB H N N 316 VAL HG11 H N N 317 VAL HG12 H N N 318 VAL HG13 H N N 319 VAL HG21 H N N 320 VAL HG22 H N N 321 VAL HG23 H N N 322 VAL HXT H N N 323 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 GLN N CA sing N N 39 GLN N H sing N N 40 GLN N H2 sing N N 41 GLN CA C sing N N 42 GLN CA CB sing N N 43 GLN CA HA sing N N 44 GLN C O doub N N 45 GLN C OXT sing N N 46 GLN CB CG sing N N 47 GLN CB HB2 sing N N 48 GLN CB HB3 sing N N 49 GLN CG CD sing N N 50 GLN CG HG2 sing N N 51 GLN CG HG3 sing N N 52 GLN CD OE1 doub N N 53 GLN CD NE2 sing N N 54 GLN NE2 HE21 sing N N 55 GLN NE2 HE22 sing N N 56 GLN OXT HXT sing N N 57 GLU N CA sing N N 58 GLU N H sing N N 59 GLU N H2 sing N N 60 GLU CA C sing N N 61 GLU CA CB sing N N 62 GLU CA HA sing N N 63 GLU C O doub N N 64 GLU C OXT sing N N 65 GLU CB CG sing N N 66 GLU CB HB2 sing N N 67 GLU CB HB3 sing N N 68 GLU CG CD sing N N 69 GLU CG HG2 sing N N 70 GLU CG HG3 sing N N 71 GLU CD OE1 doub N N 72 GLU CD OE2 sing N N 73 GLU OE2 HE2 sing N N 74 GLU OXT HXT sing N N 75 GLY N CA sing N N 76 GLY N H sing N N 77 GLY N H2 sing N N 78 GLY CA C sing N N 79 GLY CA HA2 sing N N 80 GLY CA HA3 sing N N 81 GLY C O doub N N 82 GLY C OXT sing N N 83 GLY OXT HXT sing N N 84 HIS N CA sing N N 85 HIS N H sing N N 86 HIS N H2 sing N N 87 HIS CA C sing N N 88 HIS CA CB sing N N 89 HIS CA HA sing N N 90 HIS C O doub N N 91 HIS C OXT sing N N 92 HIS CB CG sing N N 93 HIS CB HB2 sing N N 94 HIS CB HB3 sing N N 95 HIS CG ND1 sing Y N 96 HIS CG CD2 doub Y N 97 HIS ND1 CE1 doub Y N 98 HIS ND1 HD1 sing N N 99 HIS CD2 NE2 sing Y N 100 HIS CD2 HD2 sing N N 101 HIS CE1 NE2 sing Y N 102 HIS CE1 HE1 sing N N 103 HIS NE2 HE2 sing N N 104 HIS OXT HXT sing N N 105 ILE N CA sing N N 106 ILE N H sing N N 107 ILE N H2 sing N N 108 ILE CA C sing N N 109 ILE CA CB sing N N 110 ILE CA HA sing N N 111 ILE C O doub N N 112 ILE C OXT sing N N 113 ILE CB CG1 sing N N 114 ILE CB CG2 sing N N 115 ILE CB HB sing N N 116 ILE CG1 CD1 sing N N 117 ILE CG1 HG12 sing N N 118 ILE CG1 HG13 sing N N 119 ILE CG2 HG21 sing N N 120 ILE CG2 HG22 sing N N 121 ILE CG2 HG23 sing N N 122 ILE CD1 HD11 sing N N 123 ILE CD1 HD12 sing N N 124 ILE CD1 HD13 sing N N 125 ILE OXT HXT sing N N 126 LEU N CA sing N N 127 LEU N H sing N N 128 LEU N H2 sing N N 129 LEU CA C sing N N 130 LEU CA CB sing N N 131 LEU CA HA sing N N 132 LEU C O doub N N 133 LEU C OXT sing N N 134 LEU CB CG sing N N 135 LEU CB HB2 sing N N 136 LEU CB HB3 sing N N 137 LEU CG CD1 sing N N 138 LEU CG CD2 sing N N 139 LEU CG HG sing N N 140 LEU CD1 HD11 sing N N 141 LEU CD1 HD12 sing N N 142 LEU CD1 HD13 sing N N 143 LEU CD2 HD21 sing N N 144 LEU CD2 HD22 sing N N 145 LEU CD2 HD23 sing N N 146 LEU OXT HXT sing N N 147 LYS N CA sing N N 148 LYS N H sing N N 149 LYS N H2 sing N N 150 LYS CA C sing N N 151 LYS CA CB sing N N 152 LYS CA HA sing N N 153 LYS C O doub N N 154 LYS C OXT sing N N 155 LYS CB CG sing N N 156 LYS CB HB2 sing N N 157 LYS CB HB3 sing N N 158 LYS CG CD sing N N 159 LYS CG HG2 sing N N 160 LYS CG HG3 sing N N 161 LYS CD CE sing N N 162 LYS CD HD2 sing N N 163 LYS CD HD3 sing N N 164 LYS CE NZ sing N N 165 LYS CE HE2 sing N N 166 LYS CE HE3 sing N N 167 LYS NZ HZ1 sing N N 168 LYS NZ HZ2 sing N N 169 LYS NZ HZ3 sing N N 170 LYS OXT HXT sing N N 171 MET N CA sing N N 172 MET N H sing N N 173 MET N H2 sing N N 174 MET CA C sing N N 175 MET CA CB sing N N 176 MET CA HA sing N N 177 MET C O doub N N 178 MET C OXT sing N N 179 MET CB CG sing N N 180 MET CB HB2 sing N N 181 MET CB HB3 sing N N 182 MET CG SD sing N N 183 MET CG HG2 sing N N 184 MET CG HG3 sing N N 185 MET SD CE sing N N 186 MET CE HE1 sing N N 187 MET CE HE2 sing N N 188 MET CE HE3 sing N N 189 MET OXT HXT sing N N 190 PHE N CA sing N N 191 PHE N H sing N N 192 PHE N H2 sing N N 193 PHE CA C sing N N 194 PHE CA CB sing N N 195 PHE CA HA sing N N 196 PHE C O doub N N 197 PHE C OXT sing N N 198 PHE CB CG sing N N 199 PHE CB HB2 sing N N 200 PHE CB HB3 sing N N 201 PHE CG CD1 doub Y N 202 PHE CG CD2 sing Y N 203 PHE CD1 CE1 sing Y N 204 PHE CD1 HD1 sing N N 205 PHE CD2 CE2 doub Y N 206 PHE CD2 HD2 sing N N 207 PHE CE1 CZ doub Y N 208 PHE CE1 HE1 sing N N 209 PHE CE2 CZ sing Y N 210 PHE CE2 HE2 sing N N 211 PHE CZ HZ sing N N 212 PHE OXT HXT sing N N 213 SER N CA sing N N 214 SER N H sing N N 215 SER N H2 sing N N 216 SER CA C sing N N 217 SER CA CB sing N N 218 SER CA HA sing N N 219 SER C O doub N N 220 SER C OXT sing N N 221 SER CB OG sing N N 222 SER CB HB2 sing N N 223 SER CB HB3 sing N N 224 SER OG HG sing N N 225 SER OXT HXT sing N N 226 THR N CA sing N N 227 THR N H sing N N 228 THR N H2 sing N N 229 THR CA C sing N N 230 THR CA CB sing N N 231 THR CA HA sing N N 232 THR C O doub N N 233 THR C OXT sing N N 234 THR CB OG1 sing N N 235 THR CB CG2 sing N N 236 THR CB HB sing N N 237 THR OG1 HG1 sing N N 238 THR CG2 HG21 sing N N 239 THR CG2 HG22 sing N N 240 THR CG2 HG23 sing N N 241 THR OXT HXT sing N N 242 TRP N CA sing N N 243 TRP N H sing N N 244 TRP N H2 sing N N 245 TRP CA C sing N N 246 TRP CA CB sing N N 247 TRP CA HA sing N N 248 TRP C O doub N N 249 TRP C OXT sing N N 250 TRP CB CG sing N N 251 TRP CB HB2 sing N N 252 TRP CB HB3 sing N N 253 TRP CG CD1 doub Y N 254 TRP CG CD2 sing Y N 255 TRP CD1 NE1 sing Y N 256 TRP CD1 HD1 sing N N 257 TRP CD2 CE2 doub Y N 258 TRP CD2 CE3 sing Y N 259 TRP NE1 CE2 sing Y N 260 TRP NE1 HE1 sing N N 261 TRP CE2 CZ2 sing Y N 262 TRP CE3 CZ3 doub Y N 263 TRP CE3 HE3 sing N N 264 TRP CZ2 CH2 doub Y N 265 TRP CZ2 HZ2 sing N N 266 TRP CZ3 CH2 sing Y N 267 TRP CZ3 HZ3 sing N N 268 TRP CH2 HH2 sing N N 269 TRP OXT HXT sing N N 270 TYR N CA sing N N 271 TYR N H sing N N 272 TYR N H2 sing N N 273 TYR CA C sing N N 274 TYR CA CB sing N N 275 TYR CA HA sing N N 276 TYR C O doub N N 277 TYR C OXT sing N N 278 TYR CB CG sing N N 279 TYR CB HB2 sing N N 280 TYR CB HB3 sing N N 281 TYR CG CD1 doub Y N 282 TYR CG CD2 sing Y N 283 TYR CD1 CE1 sing Y N 284 TYR CD1 HD1 sing N N 285 TYR CD2 CE2 doub Y N 286 TYR CD2 HD2 sing N N 287 TYR CE1 CZ doub Y N 288 TYR CE1 HE1 sing N N 289 TYR CE2 CZ sing Y N 290 TYR CE2 HE2 sing N N 291 TYR CZ OH sing N N 292 TYR OH HH sing N N 293 TYR OXT HXT sing N N 294 VAL N CA sing N N 295 VAL N H sing N N 296 VAL N H2 sing N N 297 VAL CA C sing N N 298 VAL CA CB sing N N 299 VAL CA HA sing N N 300 VAL C O doub N N 301 VAL C OXT sing N N 302 VAL CB CG1 sing N N 303 VAL CB CG2 sing N N 304 VAL CB HB sing N N 305 VAL CG1 HG11 sing N N 306 VAL CG1 HG12 sing N N 307 VAL CG1 HG13 sing N N 308 VAL CG2 HG21 sing N N 309 VAL CG2 HG22 sing N N 310 VAL CG2 HG23 sing N N 311 VAL OXT HXT sing N N 312 # _pdbx_audit_support.funding_organization 'Not funded' _pdbx_audit_support.country ? _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model 'AVANCE III HD' _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 800 _pdbx_nmr_spectrometer.details '3 mm probe' # _atom_sites.entry_id 8VL4 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C H N O S # loop_ #