data_8VUK # _entry.id 8VUK # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.404 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 8VUK pdb_00008vuk 10.2210/pdb8vuk/pdb WWPDB D_1000281222 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date _pdbx_audit_revision_history.part_number 1 'Structure model' 1 0 2025-01-22 ? 2 'Structure model' 1 1 2025-08-06 ? # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_audit_revision_group.ordinal 1 _pdbx_audit_revision_group.revision_ordinal 2 _pdbx_audit_revision_group.data_content_type 'Structure model' _pdbx_audit_revision_group.group 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_CSD' 4 2 'Structure model' '_citation.journal_id_ISSN' 5 2 'Structure model' '_citation.journal_volume' 6 2 'Structure model' '_citation.page_first' 7 2 'Structure model' '_citation.page_last' 8 2 'Structure model' '_citation.pdbx_database_id_DOI' 9 2 'Structure model' '_citation.pdbx_database_id_PubMed' 10 2 'Structure model' '_citation.title' 11 2 'Structure model' '_citation.year' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 8VUK _pdbx_database_status.recvd_initial_deposition_date 2024-01-29 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_contact_author.id 2 _pdbx_contact_author.email garciab@ksu.edu _pdbx_contact_author.name_first Brandon _pdbx_contact_author.name_last Garcia _pdbx_contact_author.name_mi L _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-6724-8700 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Roy, S.' 1 0000-0001-5354-3824 'Garcia, B.L.' 2 0000-0002-6724-8700 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Acs Omega' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2470-1343 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 10 _citation.language ? _citation.page_first 12653 _citation.page_last 12670 _citation.title 'In Vitro Structural and Functional Studies of a Novel Cupredoxin, FtrB, from Brucella abortus 2308.' _citation.year 2025 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1021/acsomega.5c00690 _citation.pdbx_database_id_PubMed 40191301 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Kerkan, A.' 1 ? primary 'Hart, K.' 2 ? primary 'Martin, D.W.' 3 ? primary 'Pajski, J.' 4 ? primary 'Aidoo, B.' 5 ? primary 'Garcia, B.L.' 6 ? primary 'Roy, S.' 7 ? primary 'Dasgupta, S.' 8 ? primary 'Hematian, S.' 9 0000-0002-0788-7615 primary 'Santisteban-Veiga, A.' 10 0009-0004-1099-873X primary 'Schaaf, N.J.' 11 ? primary 'Banerjee, S.' 12 0000-0002-4810-9561 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'EfeO-type cupredoxin-like domain-containing protein' 10204.577 1 ? ? ? ? 2 non-polymer syn 'MANGANESE (II) ION' 54.938 2 ? ? ? ? 3 water nat water 18.015 129 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name FtrB # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;WAEEPTFRLEFKDGVITPDRLEVPANTRFRIELVNTGSMPAEFESLELRKEKVIAAQSETVMVIRTLDPGEYPFFDDFHP GGTPAILIAK ; _entity_poly.pdbx_seq_one_letter_code_can ;WAEEPTFRLEFKDGVITPDRLEVPANTRFRIELVNTGSMPAEFESLELRKEKVIAAQSETVMVIRTLDPGEYPFFDDFHP GGTPAILIAK ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'MANGANESE (II) ION' MN 3 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 TRP n 1 2 ALA n 1 3 GLU n 1 4 GLU n 1 5 PRO n 1 6 THR n 1 7 PHE n 1 8 ARG n 1 9 LEU n 1 10 GLU n 1 11 PHE n 1 12 LYS n 1 13 ASP n 1 14 GLY n 1 15 VAL n 1 16 ILE n 1 17 THR n 1 18 PRO n 1 19 ASP n 1 20 ARG n 1 21 LEU n 1 22 GLU n 1 23 VAL n 1 24 PRO n 1 25 ALA n 1 26 ASN n 1 27 THR n 1 28 ARG n 1 29 PHE n 1 30 ARG n 1 31 ILE n 1 32 GLU n 1 33 LEU n 1 34 VAL n 1 35 ASN n 1 36 THR n 1 37 GLY n 1 38 SER n 1 39 MET n 1 40 PRO n 1 41 ALA n 1 42 GLU n 1 43 PHE n 1 44 GLU n 1 45 SER n 1 46 LEU n 1 47 GLU n 1 48 LEU n 1 49 ARG n 1 50 LYS n 1 51 GLU n 1 52 LYS n 1 53 VAL n 1 54 ILE n 1 55 ALA n 1 56 ALA n 1 57 GLN n 1 58 SER n 1 59 GLU n 1 60 THR n 1 61 VAL n 1 62 MET n 1 63 VAL n 1 64 ILE n 1 65 ARG n 1 66 THR n 1 67 LEU n 1 68 ASP n 1 69 PRO n 1 70 GLY n 1 71 GLU n 1 72 TYR n 1 73 PRO n 1 74 PHE n 1 75 PHE n 1 76 ASP n 1 77 ASP n 1 78 PHE n 1 79 HIS n 1 80 PRO n 1 81 GLY n 1 82 GLY n 1 83 THR n 1 84 PRO n 1 85 ALA n 1 86 ILE n 1 87 LEU n 1 88 ILE n 1 89 ALA n 1 90 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 90 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene BAbS19_II07770 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Brucella abortus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 235 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MN non-polymer . 'MANGANESE (II) ION' ? 'Mn 2' 54.938 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 TRP 1 43 ? ? ? A . n A 1 2 ALA 2 44 44 ALA ALA A . n A 1 3 GLU 3 45 45 GLU GLU A . n A 1 4 GLU 4 46 46 GLU GLU A . n A 1 5 PRO 5 47 47 PRO PRO A . n A 1 6 THR 6 48 48 THR THR A . n A 1 7 PHE 7 49 49 PHE PHE A . n A 1 8 ARG 8 50 50 ARG ARG A . n A 1 9 LEU 9 51 51 LEU LEU A . n A 1 10 GLU 10 52 52 GLU GLU A . n A 1 11 PHE 11 53 53 PHE PHE A . n A 1 12 LYS 12 54 54 LYS LYS A . n A 1 13 ASP 13 55 55 ASP ASP A . n A 1 14 GLY 14 56 56 GLY GLY A . n A 1 15 VAL 15 57 57 VAL VAL A . n A 1 16 ILE 16 58 58 ILE ILE A . n A 1 17 THR 17 59 59 THR THR A . n A 1 18 PRO 18 60 60 PRO PRO A . n A 1 19 ASP 19 61 61 ASP ASP A . n A 1 20 ARG 20 62 62 ARG ARG A . n A 1 21 LEU 21 63 63 LEU LEU A . n A 1 22 GLU 22 64 64 GLU GLU A . n A 1 23 VAL 23 65 65 VAL VAL A . n A 1 24 PRO 24 66 66 PRO PRO A . n A 1 25 ALA 25 67 67 ALA ALA A . n A 1 26 ASN 26 68 68 ASN ASN A . n A 1 27 THR 27 69 69 THR THR A . n A 1 28 ARG 28 70 70 ARG ARG A . n A 1 29 PHE 29 71 71 PHE PHE A . n A 1 30 ARG 30 72 72 ARG ARG A . n A 1 31 ILE 31 73 73 ILE ILE A . n A 1 32 GLU 32 74 74 GLU GLU A . n A 1 33 LEU 33 75 75 LEU LEU A . n A 1 34 VAL 34 76 76 VAL VAL A . n A 1 35 ASN 35 77 77 ASN ASN A . n A 1 36 THR 36 78 78 THR THR A . n A 1 37 GLY 37 79 79 GLY GLY A . n A 1 38 SER 38 80 80 SER SER A . n A 1 39 MET 39 81 81 MET MET A . n A 1 40 PRO 40 82 82 PRO PRO A . n A 1 41 ALA 41 83 83 ALA ALA A . n A 1 42 GLU 42 84 84 GLU GLU A . n A 1 43 PHE 43 85 85 PHE PHE A . n A 1 44 GLU 44 86 86 GLU GLU A . n A 1 45 SER 45 87 87 SER SER A . n A 1 46 LEU 46 88 88 LEU LEU A . n A 1 47 GLU 47 89 89 GLU GLU A . n A 1 48 LEU 48 90 90 LEU LEU A . n A 1 49 ARG 49 91 91 ARG ARG A . n A 1 50 LYS 50 92 92 LYS LYS A . n A 1 51 GLU 51 93 93 GLU GLU A . n A 1 52 LYS 52 94 94 LYS LYS A . n A 1 53 VAL 53 95 95 VAL VAL A . n A 1 54 ILE 54 96 96 ILE ILE A . n A 1 55 ALA 55 97 97 ALA ALA A . n A 1 56 ALA 56 98 98 ALA ALA A . n A 1 57 GLN 57 99 99 GLN GLN A . n A 1 58 SER 58 100 100 SER SER A . n A 1 59 GLU 59 101 101 GLU GLU A . n A 1 60 THR 60 102 102 THR THR A . n A 1 61 VAL 61 103 103 VAL VAL A . n A 1 62 MET 62 104 104 MET MET A . n A 1 63 VAL 63 105 105 VAL VAL A . n A 1 64 ILE 64 106 106 ILE ILE A . n A 1 65 ARG 65 107 107 ARG ARG A . n A 1 66 THR 66 108 108 THR THR A . n A 1 67 LEU 67 109 109 LEU LEU A . n A 1 68 ASP 68 110 110 ASP ASP A . n A 1 69 PRO 69 111 111 PRO PRO A . n A 1 70 GLY 70 112 112 GLY GLY A . n A 1 71 GLU 71 113 113 GLU GLU A . n A 1 72 TYR 72 114 114 TYR TYR A . n A 1 73 PRO 73 115 115 PRO PRO A . n A 1 74 PHE 74 116 116 PHE PHE A . n A 1 75 PHE 75 117 117 PHE PHE A . n A 1 76 ASP 76 118 118 ASP ASP A . n A 1 77 ASP 77 119 119 ASP ASP A . n A 1 78 PHE 78 120 120 PHE PHE A . n A 1 79 HIS 79 121 121 HIS HIS A . n A 1 80 PRO 80 122 122 PRO PRO A . n A 1 81 GLY 81 123 123 GLY GLY A . n A 1 82 GLY 82 124 124 GLY GLY A . n A 1 83 THR 83 125 125 THR THR A . n A 1 84 PRO 84 126 126 PRO PRO A . n A 1 85 ALA 85 127 127 ALA ALA A . n A 1 86 ILE 86 128 128 ILE ILE A . n A 1 87 LEU 87 129 129 LEU LEU A . n A 1 88 ILE 88 130 130 ILE ILE A . n A 1 89 ALA 89 131 131 ALA ALA A . n A 1 90 LYS 90 132 132 LYS LYS A . n # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id MN _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id MN _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 MN 1 201 1 MN MN A . C 2 MN 1 202 2 MN MN A . D 3 HOH 1 301 82 HOH HOH A . D 3 HOH 2 302 25 HOH HOH A . D 3 HOH 3 303 42 HOH HOH A . D 3 HOH 4 304 78 HOH HOH A . D 3 HOH 5 305 124 HOH HOH A . D 3 HOH 6 306 105 HOH HOH A . D 3 HOH 7 307 46 HOH HOH A . D 3 HOH 8 308 48 HOH HOH A . D 3 HOH 9 309 107 HOH HOH A . D 3 HOH 10 310 56 HOH HOH A . D 3 HOH 11 311 118 HOH HOH A . D 3 HOH 12 312 97 HOH HOH A . D 3 HOH 13 313 98 HOH HOH A . D 3 HOH 14 314 119 HOH HOH A . D 3 HOH 15 315 102 HOH HOH A . D 3 HOH 16 316 76 HOH HOH A . D 3 HOH 17 317 64 HOH HOH A . D 3 HOH 18 318 125 HOH HOH A . D 3 HOH 19 319 79 HOH HOH A . D 3 HOH 20 320 30 HOH HOH A . D 3 HOH 21 321 50 HOH HOH A . D 3 HOH 22 322 2 HOH HOH A . D 3 HOH 23 323 34 HOH HOH A . D 3 HOH 24 324 33 HOH HOH A . D 3 HOH 25 325 36 HOH HOH A . D 3 HOH 26 326 45 HOH HOH A . D 3 HOH 27 327 3 HOH HOH A . D 3 HOH 28 328 17 HOH HOH A . D 3 HOH 29 329 26 HOH HOH A . D 3 HOH 30 330 8 HOH HOH A . D 3 HOH 31 331 57 HOH HOH A . D 3 HOH 32 332 22 HOH HOH A . D 3 HOH 33 333 65 HOH HOH A . D 3 HOH 34 334 83 HOH HOH A . D 3 HOH 35 335 108 HOH HOH A . D 3 HOH 36 336 9 HOH HOH A . D 3 HOH 37 337 39 HOH HOH A . D 3 HOH 38 338 5 HOH HOH A . D 3 HOH 39 339 15 HOH HOH A . D 3 HOH 40 340 92 HOH HOH A . D 3 HOH 41 341 13 HOH HOH A . D 3 HOH 42 342 110 HOH HOH A . D 3 HOH 43 343 10 HOH HOH A . D 3 HOH 44 344 18 HOH HOH A . D 3 HOH 45 345 7 HOH HOH A . D 3 HOH 46 346 58 HOH HOH A . D 3 HOH 47 347 88 HOH HOH A . D 3 HOH 48 348 12 HOH HOH A . D 3 HOH 49 349 81 HOH HOH A . D 3 HOH 50 350 127 HOH HOH A . D 3 HOH 51 351 41 HOH HOH A . D 3 HOH 52 352 6 HOH HOH A . D 3 HOH 53 353 62 HOH HOH A . D 3 HOH 54 354 69 HOH HOH A . D 3 HOH 55 355 54 HOH HOH A . D 3 HOH 56 356 84 HOH HOH A . D 3 HOH 57 357 68 HOH HOH A . D 3 HOH 58 358 14 HOH HOH A . D 3 HOH 59 359 51 HOH HOH A . D 3 HOH 60 360 66 HOH HOH A . D 3 HOH 61 361 20 HOH HOH A . D 3 HOH 62 362 73 HOH HOH A . D 3 HOH 63 363 80 HOH HOH A . D 3 HOH 64 364 74 HOH HOH A . D 3 HOH 65 365 11 HOH HOH A . D 3 HOH 66 366 31 HOH HOH A . D 3 HOH 67 367 38 HOH HOH A . D 3 HOH 68 368 113 HOH HOH A . D 3 HOH 69 369 40 HOH HOH A . D 3 HOH 70 370 21 HOH HOH A . D 3 HOH 71 371 72 HOH HOH A . D 3 HOH 72 372 47 HOH HOH A . D 3 HOH 73 373 27 HOH HOH A . D 3 HOH 74 374 28 HOH HOH A . D 3 HOH 75 375 35 HOH HOH A . D 3 HOH 76 376 49 HOH HOH A . D 3 HOH 77 377 19 HOH HOH A . D 3 HOH 78 378 129 HOH HOH A . D 3 HOH 79 379 4 HOH HOH A . D 3 HOH 80 380 63 HOH HOH A . D 3 HOH 81 381 29 HOH HOH A . D 3 HOH 82 382 44 HOH HOH A . D 3 HOH 83 383 100 HOH HOH A . D 3 HOH 84 384 32 HOH HOH A . D 3 HOH 85 385 75 HOH HOH A . D 3 HOH 86 386 1 HOH HOH A . D 3 HOH 87 387 77 HOH HOH A . D 3 HOH 88 388 94 HOH HOH A . D 3 HOH 89 389 70 HOH HOH A . D 3 HOH 90 390 116 HOH HOH A . D 3 HOH 91 391 121 HOH HOH A . D 3 HOH 92 392 37 HOH HOH A . D 3 HOH 93 393 103 HOH HOH A . D 3 HOH 94 394 60 HOH HOH A . D 3 HOH 95 395 135 HOH HOH A . D 3 HOH 96 396 109 HOH HOH A . D 3 HOH 97 397 112 HOH HOH A . D 3 HOH 98 398 67 HOH HOH A . D 3 HOH 99 399 101 HOH HOH A . D 3 HOH 100 400 93 HOH HOH A . D 3 HOH 101 401 52 HOH HOH A . D 3 HOH 102 402 106 HOH HOH A . D 3 HOH 103 403 16 HOH HOH A . D 3 HOH 104 404 71 HOH HOH A . D 3 HOH 105 405 99 HOH HOH A . D 3 HOH 106 406 55 HOH HOH A . D 3 HOH 107 407 117 HOH HOH A . D 3 HOH 108 408 96 HOH HOH A . D 3 HOH 109 409 59 HOH HOH A . D 3 HOH 110 410 85 HOH HOH A . D 3 HOH 111 411 111 HOH HOH A . D 3 HOH 112 412 87 HOH HOH A . D 3 HOH 113 413 128 HOH HOH A . D 3 HOH 114 414 91 HOH HOH A . D 3 HOH 115 415 95 HOH HOH A . D 3 HOH 116 416 61 HOH HOH A . D 3 HOH 117 417 90 HOH HOH A . D 3 HOH 118 418 86 HOH HOH A . D 3 HOH 119 419 43 HOH HOH A . D 3 HOH 120 420 114 HOH HOH A . D 3 HOH 121 421 89 HOH HOH A . D 3 HOH 122 422 24 HOH HOH A . D 3 HOH 123 423 120 HOH HOH A . D 3 HOH 124 424 115 HOH HOH A . D 3 HOH 125 425 134 HOH HOH A . D 3 HOH 126 426 53 HOH HOH A . D 3 HOH 127 427 23 HOH HOH A . D 3 HOH 128 428 132 HOH HOH A . D 3 HOH 129 429 123 HOH HOH A . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.20.1_4487 1 ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.20.1_4487 2 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 3 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 5 # _cell.angle_alpha 83.410 _cell.angle_alpha_esd ? _cell.angle_beta 69.640 _cell.angle_beta_esd ? _cell.angle_gamma 71.810 _cell.angle_gamma_esd ? _cell.entry_id 8VUK _cell.details ? _cell.formula_units_Z ? _cell.length_a 25.811 _cell.length_a_esd ? _cell.length_b 27.033 _cell.length_b_esd ? _cell.length_c 30.821 _cell.length_c_esd ? _cell.volume 19153.762 _cell.volume_esd ? _cell.Z_PDB 1 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 8VUK _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 _symmetry.space_group_name_Hall 'P 1' _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 8VUK _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 1.88 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 34.47 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 4.6 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.1 M sodium acetate, pH 4.6, 20% v/v PEG3350, supplemented with 20 mM manganese chloride, 20 mM copper(II) sulfate' _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 293 # _diffrn.ambient_environment ? _diffrn.ambient_temp 93 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'MARMOSAIC 300 mm CCD' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2021-10-21 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.0 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'APS BEAMLINE 22-BM' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.0 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 22-BM _diffrn_source.pdbx_synchrotron_site APS # _reflns.B_iso_Wilson_estimate 13.23 _reflns.entry_id 8VUK _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.30 _reflns.d_resolution_low 28.89 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 17306 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 94.9 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 3.7 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 10.9 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.115 _reflns.pdbx_Rpim_I_all 0.060 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.962 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_CC_star _reflns_shell.pdbx_R_split _reflns_shell.percent_possible_all _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_percent_possible_ellipsoidal _reflns_shell.pdbx_percent_possible_spherical _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous _reflns_shell.pdbx_percent_possible_spherical_anomalous _reflns_shell.pdbx_redundancy_anomalous _reflns_shell.pdbx_CC_half_anomalous _reflns_shell.pdbx_absDiff_over_sigma_anomalous _reflns_shell.pdbx_percent_possible_anomalous 2.80 28.89 ? 10.5 ? ? ? ? 1727 ? ? ? ? ? ? ? ? ? ? ? 3.7 ? ? ? 0.110 0.058 ? 1 1 0.962 ? ? 95.4 ? ? ? ? ? ? ? ? ? ? ? 2.22 2.80 ? ? ? ? ? ? 1815 ? ? ? ? ? ? ? ? ? ? ? 4.0 ? ? ? 0.110 0.055 ? 2 1 0.985 ? ? 98.2 ? ? ? ? ? ? ? ? ? ? ? 1.94 2.22 ? ? ? ? ? ? 1728 ? ? ? ? ? ? ? ? ? ? ? 3.9 ? ? ? 0.112 0.056 ? 3 1 0.987 ? ? 96.8 ? ? ? ? ? ? ? ? ? ? ? 1.76 1.94 ? ? ? ? ? ? 1800 ? ? ? ? ? ? ? ? ? ? ? 3.9 ? ? ? 0.121 0.061 ? 4 1 0.983 ? ? 96.5 ? ? ? ? ? ? ? ? ? ? ? 1.64 1.76 ? ? ? ? ? ? 1722 ? ? ? ? ? ? ? ? ? ? ? 3.9 ? ? ? 0.133 0.067 ? 5 1 0.982 ? ? 94.9 ? ? ? ? ? ? ? ? ? ? ? 1.54 1.64 ? ? ? ? ? ? 1731 ? ? ? ? ? ? ? ? ? ? ? 4.0 ? ? ? 0.146 0.073 ? 6 1 0.981 ? ? 94.9 ? ? ? ? ? ? ? ? ? ? ? 1.46 1.54 ? ? ? ? ? ? 1743 ? ? ? ? ? ? ? ? ? ? ? 3.9 ? ? ? 0.178 0.089 ? 7 1 0.978 ? ? 94.5 ? ? ? ? ? ? ? ? ? ? ? 1.40 1.46 ? ? ? ? ? ? 1675 ? ? ? ? ? ? ? ? ? ? ? 3.7 ? ? ? 0.210 0.107 ? 8 1 0.973 ? ? 93.6 ? ? ? ? ? ? ? ? ? ? ? 1.35 1.40 ? ? ? ? ? ? 1692 ? ? ? ? ? ? ? ? ? ? ? 3.3 ? ? ? 0.241 0.127 ? 9 1 0.956 ? ? 93.0 ? ? ? ? ? ? ? ? ? ? ? 1.30 1.35 ? ? ? ? ? ? 1673 ? ? ? ? ? ? ? ? ? ? ? 2.5 ? ? ? 0.277 0.159 ? 10 1 0.937 ? ? 90.9 ? ? ? ? ? ? ? ? ? ? ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 18.66 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 8VUK _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.30 _refine.ls_d_res_low 28.89 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 17291 _refine.ls_number_reflns_R_free 1726 _refine.ls_number_reflns_R_work 15565 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 94.67 _refine.ls_percent_reflns_R_free 9.98 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1812 _refine.ls_R_factor_R_free 0.1975 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1795 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 2.05 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values 'GeoStd + Monomer Library + CDL v1.2' _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1000 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 22.3751 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.1100 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 1.30 _refine_hist.d_res_low 28.89 _refine_hist.number_atoms_solvent 129 _refine_hist.number_atoms_total 837 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 706 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 2 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.0159 ? 728 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 1.4450 ? 989 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.1113 ? 111 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.0120 ? 132 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 14.0962 ? 281 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free _refine_ls_shell.R_factor_R_free 'X-RAY DIFFRACTION' 1.30 1.34 . . 135 1198 87.99 . . . . 0.2326 . . . . . . . . . . . 0.2602 'X-RAY DIFFRACTION' 1.34 1.38 . . 130 1273 92.67 . . . . 0.2106 . . . . . . . . . . . 0.2437 'X-RAY DIFFRACTION' 1.38 1.43 . . 148 1303 93.67 . . . . 0.2102 . . . . . . . . . . . 0.2628 'X-RAY DIFFRACTION' 1.43 1.49 . . 151 1282 93.78 . . . . 0.1918 . . . . . . . . . . . 0.2385 'X-RAY DIFFRACTION' 1.49 1.56 . . 141 1287 94.63 . . . . 0.1863 . . . . . . . . . . . 0.2168 'X-RAY DIFFRACTION' 1.56 1.64 . . 154 1284 95.04 . . . . 0.1762 . . . . . . . . . . . 0.2007 'X-RAY DIFFRACTION' 1.64 1.74 . . 139 1307 95.38 . . . . 0.1701 . . . . . . . . . . . 0.1593 'X-RAY DIFFRACTION' 1.74 1.87 . . 145 1328 96.27 . . . . 0.1723 . . . . . . . . . . . 0.2199 'X-RAY DIFFRACTION' 1.87 2.06 . . 147 1332 96.41 . . . . 0.1606 . . . . . . . . . . . 0.1934 'X-RAY DIFFRACTION' 2.06 2.36 . . 145 1328 97.55 . . . . 0.1691 . . . . . . . . . . . 0.1828 'X-RAY DIFFRACTION' 2.36 2.97 . . 150 1350 98.30 . . . . 0.1768 . . . . . . . . . . . 0.1862 'X-RAY DIFFRACTION' 2.98 28.89 . . 141 1293 94.47 . . . . 0.1845 . . . . . . . . . . . 0.1910 # _struct.entry_id 8VUK _struct.title 'The crystal structure of Brucella abortus FtrB at 1.3 Angstrom resolution' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 8VUK _struct_keywords.text 'Brucella abortus, iron transport, FtrABCD, METAL BINDING PROTEIN' _struct_keywords.pdbx_keywords 'METAL BINDING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 3 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code A0A0F6AV93_BRUA1 _struct_ref.pdbx_db_accession A0A0F6AV93 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;WAEEPTFRLEFKDGVITPDRLEVPANTRFRIELVNTGSMPAEFESLELRKEKVIAAQSETVMVIRTLDPGEYPFFDDFHP GGTPAILIAK ; _struct_ref.pdbx_align_begin 43 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 8VUK _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 90 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession A0A0F6AV93 _struct_ref_seq.db_align_beg 43 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 132 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 43 _struct_ref_seq.pdbx_auth_seq_align_end 132 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 220 ? 1 MORE -8 ? 1 'SSA (A^2)' 5180 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A GLU 42 OE1 ? ? ? 1_555 B MN . MN ? ? A GLU 84 A MN 201 1_555 ? ? ? ? ? ? ? 2.151 ? ? metalc2 metalc ? ? A GLU 44 OE1 ? ? ? 1_555 B MN . MN ? ? A GLU 86 A MN 201 1_555 ? ? ? ? ? ? ? 2.177 ? ? metalc3 metalc ? ? A ASP 77 OD2 ? ? ? 1_555 B MN . MN ? ? A ASP 119 A MN 201 1_555 ? ? ? ? ? ? ? 2.021 ? ? metalc4 metalc ? ? A ASP 77 OD1 ? ? ? 1_555 C MN . MN ? ? A ASP 119 A MN 202 1_555 ? ? ? ? ? ? ? 2.138 ? ? metalc5 metalc ? ? B MN . MN ? ? ? 1_555 D HOH . O ? ? A MN 201 A HOH 304 1_555 ? ? ? ? ? ? ? 2.116 ? ? metalc6 metalc ? ? B MN . MN ? ? ? 1_555 D HOH . O ? ? A MN 201 A HOH 339 1_556 ? ? ? ? ? ? ? 2.195 ? ? metalc7 metalc ? ? B MN . MN ? ? ? 1_555 D HOH . O ? ? A MN 201 A HOH 363 1_555 ? ? ? ? ? ? ? 2.158 ? ? metalc8 metalc ? ? C MN . MN ? ? ? 1_555 D HOH . O ? ? A MN 202 A HOH 319 1_556 ? ? ? ? ? ? ? 1.993 ? ? metalc9 metalc ? ? C MN . MN ? ? ? 1_555 D HOH . O ? ? A MN 202 A HOH 334 1_556 ? ? ? ? ? ? ? 2.230 ? ? metalc10 metalc ? ? C MN . MN ? ? ? 1_555 D HOH . O ? ? A MN 202 A HOH 343 1_556 ? ? ? ? ? ? ? 2.190 ? ? metalc11 metalc ? ? C MN . MN ? ? ? 1_555 D HOH . O ? ? A MN 202 A HOH 370 1_555 ? ? ? ? ? ? ? 2.206 ? ? metalc12 metalc ? ? C MN . MN ? ? ? 1_555 D HOH . O ? ? A MN 202 A HOH 406 1_556 ? ? ? ? ? ? ? 2.289 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OE1 ? A GLU 42 ? A GLU 84 ? 1_555 MN ? B MN . ? A MN 201 ? 1_555 OE1 ? A GLU 44 ? A GLU 86 ? 1_555 84.5 ? 2 OE1 ? A GLU 42 ? A GLU 84 ? 1_555 MN ? B MN . ? A MN 201 ? 1_555 OD2 ? A ASP 77 ? A ASP 119 ? 1_555 96.9 ? 3 OE1 ? A GLU 44 ? A GLU 86 ? 1_555 MN ? B MN . ? A MN 201 ? 1_555 OD2 ? A ASP 77 ? A ASP 119 ? 1_555 85.7 ? 4 OE1 ? A GLU 42 ? A GLU 84 ? 1_555 MN ? B MN . ? A MN 201 ? 1_555 O ? D HOH . ? A HOH 304 ? 1_555 93.8 ? 5 OE1 ? A GLU 44 ? A GLU 86 ? 1_555 MN ? B MN . ? A MN 201 ? 1_555 O ? D HOH . ? A HOH 304 ? 1_555 93.5 ? 6 OD2 ? A ASP 77 ? A ASP 119 ? 1_555 MN ? B MN . ? A MN 201 ? 1_555 O ? D HOH . ? A HOH 304 ? 1_555 169.1 ? 7 OE1 ? A GLU 42 ? A GLU 84 ? 1_555 MN ? B MN . ? A MN 201 ? 1_555 O ? D HOH . ? A HOH 339 ? 1_556 95.9 ? 8 OE1 ? A GLU 44 ? A GLU 86 ? 1_555 MN ? B MN . ? A MN 201 ? 1_555 O ? D HOH . ? A HOH 339 ? 1_556 175.5 ? 9 OD2 ? A ASP 77 ? A ASP 119 ? 1_555 MN ? B MN . ? A MN 201 ? 1_555 O ? D HOH . ? A HOH 339 ? 1_556 89.8 ? 10 O ? D HOH . ? A HOH 304 ? 1_555 MN ? B MN . ? A MN 201 ? 1_555 O ? D HOH . ? A HOH 339 ? 1_556 90.9 ? 11 OE1 ? A GLU 42 ? A GLU 84 ? 1_555 MN ? B MN . ? A MN 201 ? 1_555 O ? D HOH . ? A HOH 363 ? 1_555 170.5 ? 12 OE1 ? A GLU 44 ? A GLU 86 ? 1_555 MN ? B MN . ? A MN 201 ? 1_555 O ? D HOH . ? A HOH 363 ? 1_555 87.6 ? 13 OD2 ? A ASP 77 ? A ASP 119 ? 1_555 MN ? B MN . ? A MN 201 ? 1_555 O ? D HOH . ? A HOH 363 ? 1_555 87.8 ? 14 O ? D HOH . ? A HOH 304 ? 1_555 MN ? B MN . ? A MN 201 ? 1_555 O ? D HOH . ? A HOH 363 ? 1_555 81.3 ? 15 O ? D HOH . ? A HOH 339 ? 1_556 MN ? B MN . ? A MN 201 ? 1_555 O ? D HOH . ? A HOH 363 ? 1_555 92.4 ? 16 OD1 ? A ASP 77 ? A ASP 119 ? 1_555 MN ? C MN . ? A MN 202 ? 1_555 O ? D HOH . ? A HOH 319 ? 1_556 86.5 ? 17 OD1 ? A ASP 77 ? A ASP 119 ? 1_555 MN ? C MN . ? A MN 202 ? 1_555 O ? D HOH . ? A HOH 334 ? 1_556 100.2 ? 18 O ? D HOH . ? A HOH 319 ? 1_556 MN ? C MN . ? A MN 202 ? 1_555 O ? D HOH . ? A HOH 334 ? 1_556 75.5 ? 19 OD1 ? A ASP 77 ? A ASP 119 ? 1_555 MN ? C MN . ? A MN 202 ? 1_555 O ? D HOH . ? A HOH 343 ? 1_556 89.8 ? 20 O ? D HOH . ? A HOH 319 ? 1_556 MN ? C MN . ? A MN 202 ? 1_555 O ? D HOH . ? A HOH 343 ? 1_556 94.0 ? 21 O ? D HOH . ? A HOH 334 ? 1_556 MN ? C MN . ? A MN 202 ? 1_555 O ? D HOH . ? A HOH 343 ? 1_556 164.9 ? 22 OD1 ? A ASP 77 ? A ASP 119 ? 1_555 MN ? C MN . ? A MN 202 ? 1_555 O ? D HOH . ? A HOH 370 ? 1_555 85.9 ? 23 O ? D HOH . ? A HOH 319 ? 1_556 MN ? C MN . ? A MN 202 ? 1_555 O ? D HOH . ? A HOH 370 ? 1_555 167.5 ? 24 O ? D HOH . ? A HOH 334 ? 1_556 MN ? C MN . ? A MN 202 ? 1_555 O ? D HOH . ? A HOH 370 ? 1_555 96.1 ? 25 O ? D HOH . ? A HOH 343 ? 1_556 MN ? C MN . ? A MN 202 ? 1_555 O ? D HOH . ? A HOH 370 ? 1_555 95.9 ? 26 OD1 ? A ASP 77 ? A ASP 119 ? 1_555 MN ? C MN . ? A MN 202 ? 1_555 O ? D HOH . ? A HOH 406 ? 1_556 169.5 ? 27 O ? D HOH . ? A HOH 319 ? 1_556 MN ? C MN . ? A MN 202 ? 1_555 O ? D HOH . ? A HOH 406 ? 1_556 94.1 ? 28 O ? D HOH . ? A HOH 334 ? 1_556 MN ? C MN . ? A MN 202 ? 1_555 O ? D HOH . ? A HOH 406 ? 1_556 90.1 ? 29 O ? D HOH . ? A HOH 343 ? 1_556 MN ? C MN . ? A MN 202 ? 1_555 O ? D HOH . ? A HOH 406 ? 1_556 79.7 ? 30 O ? D HOH . ? A HOH 370 ? 1_555 MN ? C MN . ? A MN 202 ? 1_555 O ? D HOH . ? A HOH 406 ? 1_556 95.2 ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id THR _struct_mon_prot_cis.label_seq_id 17 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id THR _struct_mon_prot_cis.auth_seq_id 59 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 18 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 60 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle -9.26 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 4 ? AA2 ? 5 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? parallel AA1 3 4 ? anti-parallel AA2 1 2 ? parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel AA2 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 VAL A 15 ? THR A 17 ? VAL A 57 THR A 59 AA1 2 THR A 6 ? LYS A 12 ? THR A 48 LYS A 54 AA1 3 PHE A 29 ? ASN A 35 ? PHE A 71 ASN A 77 AA1 4 SER A 58 ? ILE A 64 ? SER A 100 ILE A 106 AA2 1 ARG A 20 ? PRO A 24 ? ARG A 62 PRO A 66 AA2 2 ALA A 85 ? LYS A 90 ? ALA A 127 LYS A 132 AA2 3 GLY A 70 ? ASP A 76 ? GLY A 112 ASP A 118 AA2 4 ALA A 41 ? SER A 45 ? ALA A 83 SER A 87 AA2 5 LYS A 50 ? ILE A 54 ? LYS A 92 ILE A 96 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O THR A 17 ? O THR A 59 N GLU A 10 ? N GLU A 52 AA1 2 3 N PHE A 7 ? N PHE A 49 O GLU A 32 ? O GLU A 74 AA1 3 4 N LEU A 33 ? N LEU A 75 O THR A 60 ? O THR A 102 AA2 1 2 N LEU A 21 ? N LEU A 63 O ILE A 88 ? O ILE A 130 AA2 2 3 O ALA A 89 ? O ALA A 131 N GLY A 70 ? N GLY A 112 AA2 3 4 O PHE A 75 ? O PHE A 117 N GLU A 44 ? N GLU A 86 AA2 4 5 N ALA A 41 ? N ALA A 83 O ILE A 54 ? O ILE A 96 # _pdbx_entry_details.entry_id 8VUK _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_protein_modification N # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A HOH 306 ? ? O A HOH 409 ? ? 1.57 2 1 O A HOH 303 ? ? O A HOH 392 ? ? 1.87 3 1 OE1 A GLU 113 ? ? O A HOH 301 ? ? 1.90 4 1 OD1 A ASP 55 ? ? O A HOH 302 ? ? 1.93 5 1 O A HOH 311 ? ? O A HOH 398 ? ? 1.93 6 1 O A HOH 354 ? ? O A HOH 389 ? ? 2.06 7 1 O A HOH 301 ? ? O A HOH 404 ? ? 2.07 8 1 O A HOH 355 ? ? O A HOH 389 ? ? 2.08 # loop_ _pdbx_validate_symm_contact.id _pdbx_validate_symm_contact.PDB_model_num _pdbx_validate_symm_contact.auth_atom_id_1 _pdbx_validate_symm_contact.auth_asym_id_1 _pdbx_validate_symm_contact.auth_comp_id_1 _pdbx_validate_symm_contact.auth_seq_id_1 _pdbx_validate_symm_contact.PDB_ins_code_1 _pdbx_validate_symm_contact.label_alt_id_1 _pdbx_validate_symm_contact.site_symmetry_1 _pdbx_validate_symm_contact.auth_atom_id_2 _pdbx_validate_symm_contact.auth_asym_id_2 _pdbx_validate_symm_contact.auth_comp_id_2 _pdbx_validate_symm_contact.auth_seq_id_2 _pdbx_validate_symm_contact.PDB_ins_code_2 _pdbx_validate_symm_contact.label_alt_id_2 _pdbx_validate_symm_contact.site_symmetry_2 _pdbx_validate_symm_contact.dist 1 1 O A HOH 393 ? ? 1_555 O A HOH 402 ? ? 1_545 1.83 2 1 O A HOH 367 ? ? 1_555 O A HOH 382 ? ? 1_545 2.07 # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id THR _pdbx_validate_torsion.auth_asym_id A _pdbx_validate_torsion.auth_seq_id 108 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi -176.60 _pdbx_validate_torsion.psi 148.89 # _space_group_symop.id 1 _space_group_symop.operation_xyz x,y,z # _pdbx_distant_solvent_atoms.id 1 _pdbx_distant_solvent_atoms.PDB_model_num 1 _pdbx_distant_solvent_atoms.auth_atom_id O _pdbx_distant_solvent_atoms.label_alt_id ? _pdbx_distant_solvent_atoms.auth_asym_id A _pdbx_distant_solvent_atoms.auth_comp_id HOH _pdbx_distant_solvent_atoms.auth_seq_id 429 _pdbx_distant_solvent_atoms.PDB_ins_code ? _pdbx_distant_solvent_atoms.neighbor_macromolecule_distance 6.88 _pdbx_distant_solvent_atoms.neighbor_ligand_distance . # _pdbx_unobs_or_zero_occ_residues.id 1 _pdbx_unobs_or_zero_occ_residues.PDB_model_num 1 _pdbx_unobs_or_zero_occ_residues.polymer_flag Y _pdbx_unobs_or_zero_occ_residues.occupancy_flag 1 _pdbx_unobs_or_zero_occ_residues.auth_asym_id A _pdbx_unobs_or_zero_occ_residues.auth_comp_id TRP _pdbx_unobs_or_zero_occ_residues.auth_seq_id 43 _pdbx_unobs_or_zero_occ_residues.PDB_ins_code ? _pdbx_unobs_or_zero_occ_residues.label_asym_id A _pdbx_unobs_or_zero_occ_residues.label_comp_id TRP _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 GLU N N N N 94 GLU CA C N S 95 GLU C C N N 96 GLU O O N N 97 GLU CB C N N 98 GLU CG C N N 99 GLU CD C N N 100 GLU OE1 O N N 101 GLU OE2 O N N 102 GLU OXT O N N 103 GLU H H N N 104 GLU H2 H N N 105 GLU HA H N N 106 GLU HB2 H N N 107 GLU HB3 H N N 108 GLU HG2 H N N 109 GLU HG3 H N N 110 GLU HE2 H N N 111 GLU HXT H N N 112 GLY N N N N 113 GLY CA C N N 114 GLY C C N N 115 GLY O O N N 116 GLY OXT O N N 117 GLY H H N N 118 GLY H2 H N N 119 GLY HA2 H N N 120 GLY HA3 H N N 121 GLY HXT H N N 122 HIS N N N N 123 HIS CA C N S 124 HIS C C N N 125 HIS O O N N 126 HIS CB C N N 127 HIS CG C Y N 128 HIS ND1 N Y N 129 HIS CD2 C Y N 130 HIS CE1 C Y N 131 HIS NE2 N Y N 132 HIS OXT O N N 133 HIS H H N N 134 HIS H2 H N N 135 HIS HA H N N 136 HIS HB2 H N N 137 HIS HB3 H N N 138 HIS HD1 H N N 139 HIS HD2 H N N 140 HIS HE1 H N N 141 HIS HE2 H N N 142 HIS HXT H N N 143 HOH O O N N 144 HOH H1 H N N 145 HOH H2 H N N 146 ILE N N N N 147 ILE CA C N S 148 ILE C C N N 149 ILE O O N N 150 ILE CB C N S 151 ILE CG1 C N N 152 ILE CG2 C N N 153 ILE CD1 C N N 154 ILE OXT O N N 155 ILE H H N N 156 ILE H2 H N N 157 ILE HA H N N 158 ILE HB H N N 159 ILE HG12 H N N 160 ILE HG13 H N N 161 ILE HG21 H N N 162 ILE HG22 H N N 163 ILE HG23 H N N 164 ILE HD11 H N N 165 ILE HD12 H N N 166 ILE HD13 H N N 167 ILE HXT H N N 168 LEU N N N N 169 LEU CA C N S 170 LEU C C N N 171 LEU O O N N 172 LEU CB C N N 173 LEU CG C N N 174 LEU CD1 C N N 175 LEU CD2 C N N 176 LEU OXT O N N 177 LEU H H N N 178 LEU H2 H N N 179 LEU HA H N N 180 LEU HB2 H N N 181 LEU HB3 H N N 182 LEU HG H N N 183 LEU HD11 H N N 184 LEU HD12 H N N 185 LEU HD13 H N N 186 LEU HD21 H N N 187 LEU HD22 H N N 188 LEU HD23 H N N 189 LEU HXT H N N 190 LYS N N N N 191 LYS CA C N S 192 LYS C C N N 193 LYS O O N N 194 LYS CB C N N 195 LYS CG C N N 196 LYS CD C N N 197 LYS CE C N N 198 LYS NZ N N N 199 LYS OXT O N N 200 LYS H H N N 201 LYS H2 H N N 202 LYS HA H N N 203 LYS HB2 H N N 204 LYS HB3 H N N 205 LYS HG2 H N N 206 LYS HG3 H N N 207 LYS HD2 H N N 208 LYS HD3 H N N 209 LYS HE2 H N N 210 LYS HE3 H N N 211 LYS HZ1 H N N 212 LYS HZ2 H N N 213 LYS HZ3 H N N 214 LYS HXT H N N 215 MET N N N N 216 MET CA C N S 217 MET C C N N 218 MET O O N N 219 MET CB C N N 220 MET CG C N N 221 MET SD S N N 222 MET CE C N N 223 MET OXT O N N 224 MET H H N N 225 MET H2 H N N 226 MET HA H N N 227 MET HB2 H N N 228 MET HB3 H N N 229 MET HG2 H N N 230 MET HG3 H N N 231 MET HE1 H N N 232 MET HE2 H N N 233 MET HE3 H N N 234 MET HXT H N N 235 MN MN MN N N 236 PHE N N N N 237 PHE CA C N S 238 PHE C C N N 239 PHE O O N N 240 PHE CB C N N 241 PHE CG C Y N 242 PHE CD1 C Y N 243 PHE CD2 C Y N 244 PHE CE1 C Y N 245 PHE CE2 C Y N 246 PHE CZ C Y N 247 PHE OXT O N N 248 PHE H H N N 249 PHE H2 H N N 250 PHE HA H N N 251 PHE HB2 H N N 252 PHE HB3 H N N 253 PHE HD1 H N N 254 PHE HD2 H N N 255 PHE HE1 H N N 256 PHE HE2 H N N 257 PHE HZ H N N 258 PHE HXT H N N 259 PRO N N N N 260 PRO CA C N S 261 PRO C C N N 262 PRO O O N N 263 PRO CB C N N 264 PRO CG C N N 265 PRO CD C N N 266 PRO OXT O N N 267 PRO H H N N 268 PRO HA H N N 269 PRO HB2 H N N 270 PRO HB3 H N N 271 PRO HG2 H N N 272 PRO HG3 H N N 273 PRO HD2 H N N 274 PRO HD3 H N N 275 PRO HXT H N N 276 SER N N N N 277 SER CA C N S 278 SER C C N N 279 SER O O N N 280 SER CB C N N 281 SER OG O N N 282 SER OXT O N N 283 SER H H N N 284 SER H2 H N N 285 SER HA H N N 286 SER HB2 H N N 287 SER HB3 H N N 288 SER HG H N N 289 SER HXT H N N 290 THR N N N N 291 THR CA C N S 292 THR C C N N 293 THR O O N N 294 THR CB C N R 295 THR OG1 O N N 296 THR CG2 C N N 297 THR OXT O N N 298 THR H H N N 299 THR H2 H N N 300 THR HA H N N 301 THR HB H N N 302 THR HG1 H N N 303 THR HG21 H N N 304 THR HG22 H N N 305 THR HG23 H N N 306 THR HXT H N N 307 TRP N N N N 308 TRP CA C N S 309 TRP C C N N 310 TRP O O N N 311 TRP CB C N N 312 TRP CG C Y N 313 TRP CD1 C Y N 314 TRP CD2 C Y N 315 TRP NE1 N Y N 316 TRP CE2 C Y N 317 TRP CE3 C Y N 318 TRP CZ2 C Y N 319 TRP CZ3 C Y N 320 TRP CH2 C Y N 321 TRP OXT O N N 322 TRP H H N N 323 TRP H2 H N N 324 TRP HA H N N 325 TRP HB2 H N N 326 TRP HB3 H N N 327 TRP HD1 H N N 328 TRP HE1 H N N 329 TRP HE3 H N N 330 TRP HZ2 H N N 331 TRP HZ3 H N N 332 TRP HH2 H N N 333 TRP HXT H N N 334 TYR N N N N 335 TYR CA C N S 336 TYR C C N N 337 TYR O O N N 338 TYR CB C N N 339 TYR CG C Y N 340 TYR CD1 C Y N 341 TYR CD2 C Y N 342 TYR CE1 C Y N 343 TYR CE2 C Y N 344 TYR CZ C Y N 345 TYR OH O N N 346 TYR OXT O N N 347 TYR H H N N 348 TYR H2 H N N 349 TYR HA H N N 350 TYR HB2 H N N 351 TYR HB3 H N N 352 TYR HD1 H N N 353 TYR HD2 H N N 354 TYR HE1 H N N 355 TYR HE2 H N N 356 TYR HH H N N 357 TYR HXT H N N 358 VAL N N N N 359 VAL CA C N S 360 VAL C C N N 361 VAL O O N N 362 VAL CB C N N 363 VAL CG1 C N N 364 VAL CG2 C N N 365 VAL OXT O N N 366 VAL H H N N 367 VAL H2 H N N 368 VAL HA H N N 369 VAL HB H N N 370 VAL HG11 H N N 371 VAL HG12 H N N 372 VAL HG13 H N N 373 VAL HG21 H N N 374 VAL HG22 H N N 375 VAL HG23 H N N 376 VAL HXT H N N 377 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 HIS N CA sing N N 116 HIS N H sing N N 117 HIS N H2 sing N N 118 HIS CA C sing N N 119 HIS CA CB sing N N 120 HIS CA HA sing N N 121 HIS C O doub N N 122 HIS C OXT sing N N 123 HIS CB CG sing N N 124 HIS CB HB2 sing N N 125 HIS CB HB3 sing N N 126 HIS CG ND1 sing Y N 127 HIS CG CD2 doub Y N 128 HIS ND1 CE1 doub Y N 129 HIS ND1 HD1 sing N N 130 HIS CD2 NE2 sing Y N 131 HIS CD2 HD2 sing N N 132 HIS CE1 NE2 sing Y N 133 HIS CE1 HE1 sing N N 134 HIS NE2 HE2 sing N N 135 HIS OXT HXT sing N N 136 HOH O H1 sing N N 137 HOH O H2 sing N N 138 ILE N CA sing N N 139 ILE N H sing N N 140 ILE N H2 sing N N 141 ILE CA C sing N N 142 ILE CA CB sing N N 143 ILE CA HA sing N N 144 ILE C O doub N N 145 ILE C OXT sing N N 146 ILE CB CG1 sing N N 147 ILE CB CG2 sing N N 148 ILE CB HB sing N N 149 ILE CG1 CD1 sing N N 150 ILE CG1 HG12 sing N N 151 ILE CG1 HG13 sing N N 152 ILE CG2 HG21 sing N N 153 ILE CG2 HG22 sing N N 154 ILE CG2 HG23 sing N N 155 ILE CD1 HD11 sing N N 156 ILE CD1 HD12 sing N N 157 ILE CD1 HD13 sing N N 158 ILE OXT HXT sing N N 159 LEU N CA sing N N 160 LEU N H sing N N 161 LEU N H2 sing N N 162 LEU CA C sing N N 163 LEU CA CB sing N N 164 LEU CA HA sing N N 165 LEU C O doub N N 166 LEU C OXT sing N N 167 LEU CB CG sing N N 168 LEU CB HB2 sing N N 169 LEU CB HB3 sing N N 170 LEU CG CD1 sing N N 171 LEU CG CD2 sing N N 172 LEU CG HG sing N N 173 LEU CD1 HD11 sing N N 174 LEU CD1 HD12 sing N N 175 LEU CD1 HD13 sing N N 176 LEU CD2 HD21 sing N N 177 LEU CD2 HD22 sing N N 178 LEU CD2 HD23 sing N N 179 LEU OXT HXT sing N N 180 LYS N CA sing N N 181 LYS N H sing N N 182 LYS N H2 sing N N 183 LYS CA C sing N N 184 LYS CA CB sing N N 185 LYS CA HA sing N N 186 LYS C O doub N N 187 LYS C OXT sing N N 188 LYS CB CG sing N N 189 LYS CB HB2 sing N N 190 LYS CB HB3 sing N N 191 LYS CG CD sing N N 192 LYS CG HG2 sing N N 193 LYS CG HG3 sing N N 194 LYS CD CE sing N N 195 LYS CD HD2 sing N N 196 LYS CD HD3 sing N N 197 LYS CE NZ sing N N 198 LYS CE HE2 sing N N 199 LYS CE HE3 sing N N 200 LYS NZ HZ1 sing N N 201 LYS NZ HZ2 sing N N 202 LYS NZ HZ3 sing N N 203 LYS OXT HXT sing N N 204 MET N CA sing N N 205 MET N H sing N N 206 MET N H2 sing N N 207 MET CA C sing N N 208 MET CA CB sing N N 209 MET CA HA sing N N 210 MET C O doub N N 211 MET C OXT sing N N 212 MET CB CG sing N N 213 MET CB HB2 sing N N 214 MET CB HB3 sing N N 215 MET CG SD sing N N 216 MET CG HG2 sing N N 217 MET CG HG3 sing N N 218 MET SD CE sing N N 219 MET CE HE1 sing N N 220 MET CE HE2 sing N N 221 MET CE HE3 sing N N 222 MET OXT HXT sing N N 223 PHE N CA sing N N 224 PHE N H sing N N 225 PHE N H2 sing N N 226 PHE CA C sing N N 227 PHE CA CB sing N N 228 PHE CA HA sing N N 229 PHE C O doub N N 230 PHE C OXT sing N N 231 PHE CB CG sing N N 232 PHE CB HB2 sing N N 233 PHE CB HB3 sing N N 234 PHE CG CD1 doub Y N 235 PHE CG CD2 sing Y N 236 PHE CD1 CE1 sing Y N 237 PHE CD1 HD1 sing N N 238 PHE CD2 CE2 doub Y N 239 PHE CD2 HD2 sing N N 240 PHE CE1 CZ doub Y N 241 PHE CE1 HE1 sing N N 242 PHE CE2 CZ sing Y N 243 PHE CE2 HE2 sing N N 244 PHE CZ HZ sing N N 245 PHE OXT HXT sing N N 246 PRO N CA sing N N 247 PRO N CD sing N N 248 PRO N H sing N N 249 PRO CA C sing N N 250 PRO CA CB sing N N 251 PRO CA HA sing N N 252 PRO C O doub N N 253 PRO C OXT sing N N 254 PRO CB CG sing N N 255 PRO CB HB2 sing N N 256 PRO CB HB3 sing N N 257 PRO CG CD sing N N 258 PRO CG HG2 sing N N 259 PRO CG HG3 sing N N 260 PRO CD HD2 sing N N 261 PRO CD HD3 sing N N 262 PRO OXT HXT sing N N 263 SER N CA sing N N 264 SER N H sing N N 265 SER N H2 sing N N 266 SER CA C sing N N 267 SER CA CB sing N N 268 SER CA HA sing N N 269 SER C O doub N N 270 SER C OXT sing N N 271 SER CB OG sing N N 272 SER CB HB2 sing N N 273 SER CB HB3 sing N N 274 SER OG HG sing N N 275 SER OXT HXT sing N N 276 THR N CA sing N N 277 THR N H sing N N 278 THR N H2 sing N N 279 THR CA C sing N N 280 THR CA CB sing N N 281 THR CA HA sing N N 282 THR C O doub N N 283 THR C OXT sing N N 284 THR CB OG1 sing N N 285 THR CB CG2 sing N N 286 THR CB HB sing N N 287 THR OG1 HG1 sing N N 288 THR CG2 HG21 sing N N 289 THR CG2 HG22 sing N N 290 THR CG2 HG23 sing N N 291 THR OXT HXT sing N N 292 TRP N CA sing N N 293 TRP N H sing N N 294 TRP N H2 sing N N 295 TRP CA C sing N N 296 TRP CA CB sing N N 297 TRP CA HA sing N N 298 TRP C O doub N N 299 TRP C OXT sing N N 300 TRP CB CG sing N N 301 TRP CB HB2 sing N N 302 TRP CB HB3 sing N N 303 TRP CG CD1 doub Y N 304 TRP CG CD2 sing Y N 305 TRP CD1 NE1 sing Y N 306 TRP CD1 HD1 sing N N 307 TRP CD2 CE2 doub Y N 308 TRP CD2 CE3 sing Y N 309 TRP NE1 CE2 sing Y N 310 TRP NE1 HE1 sing N N 311 TRP CE2 CZ2 sing Y N 312 TRP CE3 CZ3 doub Y N 313 TRP CE3 HE3 sing N N 314 TRP CZ2 CH2 doub Y N 315 TRP CZ2 HZ2 sing N N 316 TRP CZ3 CH2 sing Y N 317 TRP CZ3 HZ3 sing N N 318 TRP CH2 HH2 sing N N 319 TRP OXT HXT sing N N 320 TYR N CA sing N N 321 TYR N H sing N N 322 TYR N H2 sing N N 323 TYR CA C sing N N 324 TYR CA CB sing N N 325 TYR CA HA sing N N 326 TYR C O doub N N 327 TYR C OXT sing N N 328 TYR CB CG sing N N 329 TYR CB HB2 sing N N 330 TYR CB HB3 sing N N 331 TYR CG CD1 doub Y N 332 TYR CG CD2 sing Y N 333 TYR CD1 CE1 sing Y N 334 TYR CD1 HD1 sing N N 335 TYR CD2 CE2 doub Y N 336 TYR CD2 HD2 sing N N 337 TYR CE1 CZ doub Y N 338 TYR CE1 HE1 sing N N 339 TYR CE2 CZ sing Y N 340 TYR CE2 HE2 sing N N 341 TYR CZ OH sing N N 342 TYR OH HH sing N N 343 TYR OXT HXT sing N N 344 VAL N CA sing N N 345 VAL N H sing N N 346 VAL N H2 sing N N 347 VAL CA C sing N N 348 VAL CA CB sing N N 349 VAL CA HA sing N N 350 VAL C O doub N N 351 VAL C OXT sing N N 352 VAL CB CG1 sing N N 353 VAL CB CG2 sing N N 354 VAL CB HB sing N N 355 VAL CG1 HG11 sing N N 356 VAL CG1 HG12 sing N N 357 VAL CG1 HG13 sing N N 358 VAL CG2 HG21 sing N N 359 VAL CG2 HG22 sing N N 360 VAL CG2 HG23 sing N N 361 VAL OXT HXT sing N N 362 # _pdbx_audit_support.funding_organization 'Not funded' _pdbx_audit_support.country ? _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'in silico model' _pdbx_initial_refinement_model.source_name AlphaFold _pdbx_initial_refinement_model.accession_code ? _pdbx_initial_refinement_model.details ? # _space_group.name_H-M_alt 'P 1' _space_group.name_Hall 'P 1' _space_group.IT_number 1 _space_group.crystal_system triclinic _space_group.id 1 # _atom_sites.entry_id 8VUK _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 0.038743 _atom_sites.fract_transf_matrix[1][2] -0.012731 _atom_sites.fract_transf_matrix[1][3] -0.014290 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.038938 _atom_sites.fract_transf_matrix[2][3] -0.000269 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.034608 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.scat_dispersion_real _atom_type.scat_dispersion_imag _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c _atom_type.scat_source _atom_type.scat_dispersion_source C ? ? 3.54356 2.42580 ? ? 25.62398 1.50364 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? H ? ? 0.51345 0.48472 ? ? 24.73122 6.32584 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? MN ? ? 20.23591 4.67902 ? ? 2.76514 44.01191 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? N ? ? 4.01032 2.96436 ? ? 19.97189 1.75589 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O ? ? 4.49882 3.47563 ? ? 15.80542 1.70748 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? S ? ? 9.55732 6.39887 ? ? 1.23737 29.19336 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? # loop_ #