data_8W79 # _entry.id 8W79 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 8W79 pdb_00008w79 10.2210/pdb8w79/pdb WWPDB D_1300040705 ? ? # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2024-06-12 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 8W79 _pdbx_database_status.recvd_initial_deposition_date 2023-08-30 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_database_related.db_name PDB _pdbx_database_related.details . _pdbx_database_related.db_id 8W6M _pdbx_database_related.content_type unspecified # _pdbx_contact_author.id 2 _pdbx_contact_author.email wangwm@sxu.edu.cn _pdbx_contact_author.name_first 'wen. ming' _pdbx_contact_author.name_last Wang _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-0903-3461 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Wang, W.M.' 1 0000-0002-0903-3461 'Xi, H.F.' 2 ? 'Gong, W.J.' 3 0000-0003-3914-7977 'Ma, D.Y.' 4 ? 'Wang, H.F.' 5 0000-0002-8162-9243 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev J.Am.Chem.Soc. _citation.journal_id_ASTM JACSAT _citation.journal_id_CSD ? _citation.journal_id_ISSN 1520-5126 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 146 _citation.language ? _citation.page_first 11657 _citation.page_last 11668 _citation.title 'Growth Process of Fe-O Nanoclusters with Different Sizes Biosynthesized by Protein Nanocages.' _citation.year 2024 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1021/jacs.3c13830 _citation.pdbx_database_id_PubMed 38641862 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Wang, W.' 1 0000-0002-0903-3461 primary 'Xi, H.' 2 ? primary 'Fu, D.' 3 ? primary 'Ma, D.' 4 ? primary 'Gong, W.' 5 ? primary 'Zhao, Y.' 6 ? primary 'Li, X.' 7 ? primary 'Wu, L.' 8 ? primary 'Guo, Y.' 9 0000-0002-8109-7515 primary 'Zhao, G.' 10 0000-0001-8587-9680 primary 'Wang, H.' 11 0000-0002-8162-9243 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man Ferritin 21254.996 1 ? ? ? WP_081847832.1 2 non-polymer syn 'FE (III) ION' 55.845 11 ? ? ? ? 3 water nat water 18.015 16 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MLYRERNNIMQKSNKINDALNQHYKLNVELGLVYAHYAHVADDEFDMPYLGKFIQHLSEDKLGVHKEYISDYFKRNGMKL KTDVSVAVKSIPSDAKALIQEVYARENEVRDHVKAIAKLALAEDDYESFYFIQWYVRDGLKDLTEVDDVVKLFNSSNDKL IIEETIKEMVEKEESEHEIWG ; _entity_poly.pdbx_seq_one_letter_code_can ;MLYRERNNIMQKSNKINDALNQHYKLNVELGLVYAHYAHVADDEFDMPYLGKFIQHLSEDKLGVHKEYISDYFKRNGMKL KTDVSVAVKSIPSDAKALIQEVYARENEVRDHVKAIAKLALAEDDYESFYFIQWYVRDGLKDLTEVDDVVKLFNSSNDKL IIEETIKEMVEKEESEHEIWG ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'FE (III) ION' FE 3 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 LEU n 1 3 TYR n 1 4 ARG n 1 5 GLU n 1 6 ARG n 1 7 ASN n 1 8 ASN n 1 9 ILE n 1 10 MET n 1 11 GLN n 1 12 LYS n 1 13 SER n 1 14 ASN n 1 15 LYS n 1 16 ILE n 1 17 ASN n 1 18 ASP n 1 19 ALA n 1 20 LEU n 1 21 ASN n 1 22 GLN n 1 23 HIS n 1 24 TYR n 1 25 LYS n 1 26 LEU n 1 27 ASN n 1 28 VAL n 1 29 GLU n 1 30 LEU n 1 31 GLY n 1 32 LEU n 1 33 VAL n 1 34 TYR n 1 35 ALA n 1 36 HIS n 1 37 TYR n 1 38 ALA n 1 39 HIS n 1 40 VAL n 1 41 ALA n 1 42 ASP n 1 43 ASP n 1 44 GLU n 1 45 PHE n 1 46 ASP n 1 47 MET n 1 48 PRO n 1 49 TYR n 1 50 LEU n 1 51 GLY n 1 52 LYS n 1 53 PHE n 1 54 ILE n 1 55 GLN n 1 56 HIS n 1 57 LEU n 1 58 SER n 1 59 GLU n 1 60 ASP n 1 61 LYS n 1 62 LEU n 1 63 GLY n 1 64 VAL n 1 65 HIS n 1 66 LYS n 1 67 GLU n 1 68 TYR n 1 69 ILE n 1 70 SER n 1 71 ASP n 1 72 TYR n 1 73 PHE n 1 74 LYS n 1 75 ARG n 1 76 ASN n 1 77 GLY n 1 78 MET n 1 79 LYS n 1 80 LEU n 1 81 LYS n 1 82 THR n 1 83 ASP n 1 84 VAL n 1 85 SER n 1 86 VAL n 1 87 ALA n 1 88 VAL n 1 89 LYS n 1 90 SER n 1 91 ILE n 1 92 PRO n 1 93 SER n 1 94 ASP n 1 95 ALA n 1 96 LYS n 1 97 ALA n 1 98 LEU n 1 99 ILE n 1 100 GLN n 1 101 GLU n 1 102 VAL n 1 103 TYR n 1 104 ALA n 1 105 ARG n 1 106 GLU n 1 107 ASN n 1 108 GLU n 1 109 VAL n 1 110 ARG n 1 111 ASP n 1 112 HIS n 1 113 VAL n 1 114 LYS n 1 115 ALA n 1 116 ILE n 1 117 ALA n 1 118 LYS n 1 119 LEU n 1 120 ALA n 1 121 LEU n 1 122 ALA n 1 123 GLU n 1 124 ASP n 1 125 ASP n 1 126 TYR n 1 127 GLU n 1 128 SER n 1 129 PHE n 1 130 TYR n 1 131 PHE n 1 132 ILE n 1 133 GLN n 1 134 TRP n 1 135 TYR n 1 136 VAL n 1 137 ARG n 1 138 ASP n 1 139 GLY n 1 140 LEU n 1 141 LYS n 1 142 ASP n 1 143 LEU n 1 144 THR n 1 145 GLU n 1 146 VAL n 1 147 ASP n 1 148 ASP n 1 149 VAL n 1 150 VAL n 1 151 LYS n 1 152 LEU n 1 153 PHE n 1 154 ASN n 1 155 SER n 1 156 SER n 1 157 ASN n 1 158 ASP n 1 159 LYS n 1 160 LEU n 1 161 ILE n 1 162 ILE n 1 163 GLU n 1 164 GLU n 1 165 THR n 1 166 ILE n 1 167 LYS n 1 168 GLU n 1 169 MET n 1 170 VAL n 1 171 GLU n 1 172 LYS n 1 173 GLU n 1 174 GLU n 1 175 SER n 1 176 GLU n 1 177 HIS n 1 178 GLU n 1 179 ILE n 1 180 TRP n 1 181 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 181 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene UDIV_5880 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Ureaplasma diversum' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 42094 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 FE non-polymer . 'FE (III) ION' ? 'Fe 3' 55.845 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 LEU 2 2 ? ? ? A . n A 1 3 TYR 3 3 ? ? ? A . n A 1 4 ARG 4 4 ? ? ? A . n A 1 5 GLU 5 5 ? ? ? A . n A 1 6 ARG 6 6 ? ? ? A . n A 1 7 ASN 7 7 ? ? ? A . n A 1 8 ASN 8 8 ? ? ? A . n A 1 9 ILE 9 9 ? ? ? A . n A 1 10 MET 10 10 10 MET MET A . n A 1 11 GLN 11 11 11 GLN GLN A . n A 1 12 LYS 12 12 12 LYS LYS A . n A 1 13 SER 13 13 13 SER SER A . n A 1 14 ASN 14 14 14 ASN ASN A . n A 1 15 LYS 15 15 15 LYS LYS A . n A 1 16 ILE 16 16 16 ILE ILE A . n A 1 17 ASN 17 17 17 ASN ASN A . n A 1 18 ASP 18 18 18 ASP ASP A . n A 1 19 ALA 19 19 19 ALA ALA A . n A 1 20 LEU 20 20 20 LEU LEU A . n A 1 21 ASN 21 21 21 ASN ASN A . n A 1 22 GLN 22 22 22 GLN GLN A . n A 1 23 HIS 23 23 23 HIS HIS A . n A 1 24 TYR 24 24 24 TYR TYR A . n A 1 25 LYS 25 25 25 LYS LYS A . n A 1 26 LEU 26 26 26 LEU LEU A . n A 1 27 ASN 27 27 27 ASN ASN A . n A 1 28 VAL 28 28 28 VAL VAL A . n A 1 29 GLU 29 29 29 GLU GLU A . n A 1 30 LEU 30 30 30 LEU LEU A . n A 1 31 GLY 31 31 31 GLY GLY A . n A 1 32 LEU 32 32 32 LEU LEU A . n A 1 33 VAL 33 33 33 VAL VAL A . n A 1 34 TYR 34 34 34 TYR TYR A . n A 1 35 ALA 35 35 35 ALA ALA A . n A 1 36 HIS 36 36 36 HIS HIS A . n A 1 37 TYR 37 37 37 TYR TYR A . n A 1 38 ALA 38 38 38 ALA ALA A . n A 1 39 HIS 39 39 39 HIS HIS A . n A 1 40 VAL 40 40 40 VAL VAL A . n A 1 41 ALA 41 41 41 ALA ALA A . n A 1 42 ASP 42 42 42 ASP ASP A . n A 1 43 ASP 43 43 43 ASP ASP A . n A 1 44 GLU 44 44 44 GLU GLU A . n A 1 45 PHE 45 45 45 PHE PHE A . n A 1 46 ASP 46 46 46 ASP ASP A . n A 1 47 MET 47 47 47 MET MET A . n A 1 48 PRO 48 48 48 PRO PRO A . n A 1 49 TYR 49 49 49 TYR TYR A . n A 1 50 LEU 50 50 50 LEU LEU A . n A 1 51 GLY 51 51 51 GLY GLY A . n A 1 52 LYS 52 52 52 LYS LYS A . n A 1 53 PHE 53 53 53 PHE PHE A . n A 1 54 ILE 54 54 54 ILE ILE A . n A 1 55 GLN 55 55 55 GLN GLN A . n A 1 56 HIS 56 56 56 HIS HIS A . n A 1 57 LEU 57 57 57 LEU LEU A . n A 1 58 SER 58 58 58 SER SER A . n A 1 59 GLU 59 59 59 GLU GLU A . n A 1 60 ASP 60 60 60 ASP ASP A . n A 1 61 LYS 61 61 61 LYS LYS A . n A 1 62 LEU 62 62 62 LEU LEU A . n A 1 63 GLY 63 63 63 GLY GLY A . n A 1 64 VAL 64 64 64 VAL VAL A . n A 1 65 HIS 65 65 65 HIS HIS A . n A 1 66 LYS 66 66 66 LYS LYS A . n A 1 67 GLU 67 67 67 GLU GLU A . n A 1 68 TYR 68 68 68 TYR TYR A . n A 1 69 ILE 69 69 69 ILE ILE A . n A 1 70 SER 70 70 70 SER SER A . n A 1 71 ASP 71 71 71 ASP ASP A . n A 1 72 TYR 72 72 72 TYR TYR A . n A 1 73 PHE 73 73 73 PHE PHE A . n A 1 74 LYS 74 74 74 LYS LYS A . n A 1 75 ARG 75 75 75 ARG ARG A . n A 1 76 ASN 76 76 76 ASN ASN A . n A 1 77 GLY 77 77 77 GLY GLY A . n A 1 78 MET 78 78 78 MET MET A . n A 1 79 LYS 79 79 79 LYS LYS A . n A 1 80 LEU 80 80 80 LEU LEU A . n A 1 81 LYS 81 81 81 LYS LYS A . n A 1 82 THR 82 82 82 THR THR A . n A 1 83 ASP 83 83 83 ASP ASP A . n A 1 84 VAL 84 84 84 VAL VAL A . n A 1 85 SER 85 85 85 SER SER A . n A 1 86 VAL 86 86 86 VAL VAL A . n A 1 87 ALA 87 87 87 ALA ALA A . n A 1 88 VAL 88 88 88 VAL VAL A . n A 1 89 LYS 89 89 89 LYS LYS A . n A 1 90 SER 90 90 90 SER SER A . n A 1 91 ILE 91 91 91 ILE ILE A . n A 1 92 PRO 92 92 92 PRO PRO A . n A 1 93 SER 93 93 93 SER SER A . n A 1 94 ASP 94 94 94 ASP ASP A . n A 1 95 ALA 95 95 95 ALA ALA A . n A 1 96 LYS 96 96 96 LYS LYS A . n A 1 97 ALA 97 97 97 ALA ALA A . n A 1 98 LEU 98 98 98 LEU LEU A . n A 1 99 ILE 99 99 99 ILE ILE A . n A 1 100 GLN 100 100 100 GLN GLN A . n A 1 101 GLU 101 101 101 GLU GLU A . n A 1 102 VAL 102 102 102 VAL VAL A . n A 1 103 TYR 103 103 103 TYR TYR A . n A 1 104 ALA 104 104 104 ALA ALA A . n A 1 105 ARG 105 105 105 ARG ARG A . n A 1 106 GLU 106 106 106 GLU GLU A . n A 1 107 ASN 107 107 107 ASN ASN A . n A 1 108 GLU 108 108 108 GLU GLU A . n A 1 109 VAL 109 109 109 VAL VAL A . n A 1 110 ARG 110 110 110 ARG ARG A . n A 1 111 ASP 111 111 111 ASP ASP A . n A 1 112 HIS 112 112 112 HIS HIS A . n A 1 113 VAL 113 113 113 VAL VAL A . n A 1 114 LYS 114 114 114 LYS LYS A . n A 1 115 ALA 115 115 115 ALA ALA A . n A 1 116 ILE 116 116 116 ILE ILE A . n A 1 117 ALA 117 117 117 ALA ALA A . n A 1 118 LYS 118 118 118 LYS LYS A . n A 1 119 LEU 119 119 119 LEU LEU A . n A 1 120 ALA 120 120 120 ALA ALA A . n A 1 121 LEU 121 121 121 LEU LEU A . n A 1 122 ALA 122 122 122 ALA ALA A . n A 1 123 GLU 123 123 123 GLU GLU A . n A 1 124 ASP 124 124 124 ASP ASP A . n A 1 125 ASP 125 125 125 ASP ASP A . n A 1 126 TYR 126 126 126 TYR TYR A . n A 1 127 GLU 127 127 127 GLU GLU A . n A 1 128 SER 128 128 128 SER SER A . n A 1 129 PHE 129 129 129 PHE PHE A . n A 1 130 TYR 130 130 130 TYR TYR A . n A 1 131 PHE 131 131 131 PHE PHE A . n A 1 132 ILE 132 132 132 ILE ILE A . n A 1 133 GLN 133 133 133 GLN GLN A . n A 1 134 TRP 134 134 134 TRP TRP A . n A 1 135 TYR 135 135 135 TYR TYR A . n A 1 136 VAL 136 136 136 VAL VAL A . n A 1 137 ARG 137 137 137 ARG ARG A . n A 1 138 ASP 138 138 138 ASP ASP A . n A 1 139 GLY 139 139 139 GLY GLY A . n A 1 140 LEU 140 140 140 LEU LEU A . n A 1 141 LYS 141 141 141 LYS LYS A . n A 1 142 ASP 142 142 142 ASP ASP A . n A 1 143 LEU 143 143 143 LEU LEU A . n A 1 144 THR 144 144 144 THR THR A . n A 1 145 GLU 145 145 145 GLU GLU A . n A 1 146 VAL 146 146 146 VAL VAL A . n A 1 147 ASP 147 147 147 ASP ASP A . n A 1 148 ASP 148 148 148 ASP ASP A . n A 1 149 VAL 149 149 149 VAL VAL A . n A 1 150 VAL 150 150 150 VAL VAL A . n A 1 151 LYS 151 151 151 LYS LYS A . n A 1 152 LEU 152 152 152 LEU LEU A . n A 1 153 PHE 153 153 153 PHE PHE A . n A 1 154 ASN 154 154 154 ASN ASN A . n A 1 155 SER 155 155 155 SER SER A . n A 1 156 SER 156 156 156 SER SER A . n A 1 157 ASN 157 157 157 ASN ASN A . n A 1 158 ASP 158 158 158 ASP ASP A . n A 1 159 LYS 159 159 159 LYS LYS A . n A 1 160 LEU 160 160 160 LEU LEU A . n A 1 161 ILE 161 161 161 ILE ILE A . n A 1 162 ILE 162 162 162 ILE ILE A . n A 1 163 GLU 163 163 163 GLU GLU A . n A 1 164 GLU 164 164 164 GLU GLU A . n A 1 165 THR 165 165 165 THR THR A . n A 1 166 ILE 166 166 166 ILE ILE A . n A 1 167 LYS 167 167 167 LYS LYS A . n A 1 168 GLU 168 168 168 GLU GLU A . n A 1 169 MET 169 169 169 MET MET A . n A 1 170 VAL 170 170 170 VAL VAL A . n A 1 171 GLU 171 171 171 GLU GLU A . n A 1 172 LYS 172 172 ? ? ? A . n A 1 173 GLU 173 173 ? ? ? A . n A 1 174 GLU 174 174 ? ? ? A . n A 1 175 SER 175 175 ? ? ? A . n A 1 176 GLU 176 176 ? ? ? A . n A 1 177 HIS 177 177 ? ? ? A . n A 1 178 GLU 178 178 ? ? ? A . n A 1 179 ILE 179 179 ? ? ? A . n A 1 180 TRP 180 180 ? ? ? A . n A 1 181 GLY 181 181 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 FE 1 201 1 FE FE A . C 2 FE 1 202 2 FE FE A . D 2 FE 1 203 3 FE FE A . E 2 FE 1 204 4 FE FE A . F 2 FE 1 205 5 FE FE A . G 2 FE 1 206 6 FE FE A . H 2 FE 1 207 7 FE FE A . I 2 FE 1 208 8 FE FE A . J 2 FE 1 209 9 FE FE A . K 2 FE 1 210 10 FE FE A . L 2 FE 1 211 11 FE FE A . M 3 HOH 1 301 17 HOH HOH A . M 3 HOH 2 302 18 HOH HOH A . M 3 HOH 3 303 11 HOH HOH A . M 3 HOH 4 304 12 HOH HOH A . M 3 HOH 5 305 20 HOH HOH A . M 3 HOH 6 306 6 HOH HOH A . M 3 HOH 7 307 13 HOH HOH A . M 3 HOH 8 308 8 HOH HOH A . M 3 HOH 9 309 10 HOH HOH A . M 3 HOH 10 310 19 HOH HOH A . M 3 HOH 11 311 7 HOH HOH A . M 3 HOH 12 312 21 HOH HOH A . M 3 HOH 13 313 16 HOH HOH A . M 3 HOH 14 314 9 HOH HOH A . M 3 HOH 15 315 15 HOH HOH A . M 3 HOH 16 316 14 HOH HOH A . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? '(1.15.2_3472: ???)' 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 2 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 8W79 _cell.details ? _cell.formula_units_Z ? _cell.length_a 180.406 _cell.length_a_esd ? _cell.length_b 180.406 _cell.length_b_esd ? _cell.length_c 180.406 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 96 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 8W79 _symmetry.cell_setting ? _symmetry.Int_Tables_number 209 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'F 4 3 2' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 8W79 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.88 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 57.26 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details 'Bicine, MgCl2' _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 297 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2023-05-29 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.55 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SSRF BEAMLINE BL18U1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.55 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL18U1 _diffrn_source.pdbx_synchrotron_site SSRF # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 8W79 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.697 _reflns.d_resolution_low 50.00 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 13119 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 100.0 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 72.0 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 2.2 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared 0.802 _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.303 _reflns.pdbx_Rpim_I_all 0.036 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.990 _reflns.pdbx_CC_star 0.997 _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs 0.301 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_CC_star _reflns_shell.pdbx_R_split _reflns_shell.percent_possible_all _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_percent_possible_ellipsoidal _reflns_shell.pdbx_percent_possible_spherical _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous _reflns_shell.pdbx_percent_possible_spherical_anomalous _reflns_shell.pdbx_redundancy_anomalous _reflns_shell.pdbx_CC_half_anomalous _reflns_shell.pdbx_absDiff_over_sigma_anomalous _reflns_shell.pdbx_percent_possible_anomalous 2.70 2.75 ? ? ? ? ? ? 360 ? ? ? ? ? ? ? ? ? ? ? 75.0 0.438 ? ? 2.606 0.300 ? 1 1 0.941 0.985 ? 100.0 ? 2.588 ? ? ? ? ? ? ? ? ? 2.75 2.80 ? ? ? ? ? ? 349 ? ? ? ? ? ? ? ? ? ? ? 75.1 0.457 ? ? 2.293 0.263 ? 2 1 0.869 0.964 ? 100.0 ? 2.277 ? ? ? ? ? ? ? ? ? 2.80 2.85 ? ? ? ? ? ? 359 ? ? ? ? ? ? ? ? ? ? ? 74.8 0.462 ? ? 1.958 0.225 ? 3 1 0.890 0.970 ? 100.0 ? 1.945 ? ? ? ? ? ? ? ? ? 2.85 2.91 ? ? ? ? ? ? 368 ? ? ? ? ? ? ? ? ? ? ? 74.8 0.477 ? ? 1.528 0.176 ? 4 1 0.905 0.975 ? 100.0 ? 1.517 ? ? ? ? ? ? ? ? ? 2.91 2.97 ? ? ? ? ? ? 354 ? ? ? ? ? ? ? ? ? ? ? 72.3 0.486 ? ? 1.337 0.156 ? 5 1 0.940 0.984 ? 100.0 ? 1.328 ? ? ? ? ? ? ? ? ? 2.97 3.04 ? ? ? ? ? ? 358 ? ? ? ? ? ? ? ? ? ? ? 70.6 0.493 ? ? 1.210 0.143 ? 6 1 0.937 0.983 ? 100.0 ? 1.201 ? ? ? ? ? ? ? ? ? 3.04 3.12 ? ? ? ? ? ? 365 ? ? ? ? ? ? ? ? ? ? ? 76.1 0.538 ? ? 0.907 0.103 ? 7 1 0.968 0.992 ? 100.0 ? 0.901 ? ? ? ? ? ? ? ? ? 3.12 3.20 ? ? ? ? ? ? 352 ? ? ? ? ? ? ? ? ? ? ? 75.5 0.555 ? ? 0.794 0.091 ? 8 1 0.979 0.995 ? 100.0 ? 0.788 ? ? ? ? ? ? ? ? ? 3.20 3.30 ? ? ? ? ? ? 358 ? ? ? ? ? ? ? ? ? ? ? 71.1 0.638 ? ? 0.643 0.076 ? 9 1 0.986 0.997 ? 100.0 ? 0.639 ? ? ? ? ? ? ? ? ? 3.30 3.40 ? ? ? ? ? ? 357 ? ? ? ? ? ? ? ? ? ? ? 74.0 0.653 ? ? 0.556 0.064 ? 10 1 0.986 0.996 ? 100.0 ? 0.552 ? ? ? ? ? ? ? ? ? 3.40 3.52 ? ? ? ? ? ? 365 ? ? ? ? ? ? ? ? ? ? ? 77.7 0.747 ? ? 0.441 0.050 ? 11 1 0.992 0.998 ? 100.0 ? 0.439 ? ? ? ? ? ? ? ? ? 3.52 3.66 ? ? ? ? ? ? 372 ? ? ? ? ? ? ? ? ? ? ? 75.7 0.875 ? ? 0.352 0.040 ? 12 1 0.993 0.998 ? 100.0 ? 0.349 ? ? ? ? ? ? ? ? ? 3.66 3.83 ? ? ? ? ? ? 362 ? ? ? ? ? ? ? ? ? ? ? 74.6 0.954 ? ? 0.314 0.036 ? 13 1 0.994 0.998 ? 100.0 ? 0.312 ? ? ? ? ? ? ? ? ? 3.83 4.03 ? ? ? ? ? ? 370 ? ? ? ? ? ? ? ? ? ? ? 72.4 1.062 ? ? 0.271 0.032 ? 14 1 0.996 0.999 ? 100.0 ? 0.269 ? ? ? ? ? ? ? ? ? 4.03 4.29 ? ? ? ? ? ? 375 ? ? ? ? ? ? ? ? ? ? ? 68.7 1.311 ? ? 0.220 0.026 ? 15 1 0.996 0.999 ? 100.0 ? 0.218 ? ? ? ? ? ? ? ? ? 4.29 4.62 ? ? ? ? ? ? 371 ? ? ? ? ? ? ? ? ? ? ? 72.7 1.414 ? ? 0.194 0.022 ? 16 1 0.998 0.999 ? 100.0 ? 0.192 ? ? ? ? ? ? ? ? ? 4.62 5.08 ? ? ? ? ? ? 377 ? ? ? ? ? ? ? ? ? ? ? 68.5 1.326 ? ? 0.167 0.020 ? 17 1 0.998 1.000 ? 100.0 ? 0.166 ? ? ? ? ? ? ? ? ? 5.08 5.81 ? ? ? ? ? ? 390 ? ? ? ? ? ? ? ? ? ? ? 73.0 0.998 ? ? 0.168 0.019 ? 18 1 0.998 1.000 ? 100.0 ? 0.166 ? ? ? ? ? ? ? ? ? 5.81 7.32 ? ? ? ? ? ? 394 ? ? ? ? ? ? ? ? ? ? ? 66.2 0.762 ? ? 0.131 0.016 ? 19 1 0.999 1.000 ? 100.0 ? 0.130 ? ? ? ? ? ? ? ? ? 7.32 50.00 ? ? ? ? ? ? 447 ? ? ? ? ? ? ? ? ? ? ? 56.3 1.420 ? ? 0.091 0.012 ? 20 1 0.996 0.999 ? 100.0 ? 0.090 ? ? ? ? ? ? ? ? ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean ? _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 8W79 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.697 _refine.ls_d_res_low 36.825 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 13119 _refine.ls_number_reflns_R_free 1293 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.92 _refine.ls_percent_reflns_R_free 9.86 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1990 _refine.ls_R_factor_R_free 0.2554 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1930 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.35 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 24.82 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.31 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1326 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 11 _refine_hist.number_atoms_solvent 16 _refine_hist.number_atoms_total 1353 _refine_hist.d_res_high 2.697 _refine_hist.d_res_low 36.825 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.010 ? 1369 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.948 ? 1849 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 7.792 ? 1157 ? f_dihedral_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.048 ? 202 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.006 ? 239 ? f_plane_restr ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free _refine_ls_shell.R_factor_R_free 'X-RAY DIFFRACTION' 2.697 2.8048 . . 143 1314 100.00 . . . . 0.2410 . . . . . . . . . . . 0.3179 'X-RAY DIFFRACTION' 2.8048 2.9324 . . 141 1306 100.00 . . . . 0.2241 . . . . . . . . . . . 0.2988 'X-RAY DIFFRACTION' 2.9324 3.0869 . . 149 1329 100.00 . . . . 0.2350 . . . . . . . . . . . 0.3113 'X-RAY DIFFRACTION' 3.0869 3.2802 . . 140 1310 100.00 . . . . 0.2164 . . . . . . . . . . . 0.3377 'X-RAY DIFFRACTION' 3.2802 3.5333 . . 144 1300 100.00 . . . . 0.1956 . . . . . . . . . . . 0.2367 'X-RAY DIFFRACTION' 3.5333 3.8885 . . 145 1316 100.00 . . . . 0.1823 . . . . . . . . . . . 0.2731 'X-RAY DIFFRACTION' 3.8885 4.4503 . . 142 1308 100.00 . . . . 0.1682 . . . . . . . . . . . 0.2197 'X-RAY DIFFRACTION' 4.4503 5.6038 . . 144 1316 100.00 . . . . 0.1779 . . . . . . . . . . . 0.2526 'X-RAY DIFFRACTION' 5.6038 36.825 . . 145 1327 99.00 . . . . 0.1929 . . . . . . . . . . . 0.2229 # _struct.entry_id 8W79 _struct.title 'Fe-O nanocluster of form-III in the 4-fold channel of Ureaplasma diversum ferritin' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 8W79 _struct_keywords.text 'Ferritin, Iron, Fe-O cluster, 4-fold channel cavity, METAL BINDING PROTEIN' _struct_keywords.pdbx_keywords 'METAL BINDING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 2 ? E N N 2 ? F N N 2 ? G N N 2 ? H N N 2 ? I N N 2 ? J N N 2 ? K N N 2 ? L N N 2 ? M N N 3 ? # _struct_ref.id 1 _struct_ref.db_name PDB _struct_ref.db_code 8W79 _struct_ref.pdbx_db_accession 8W79 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 8W79 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 181 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession 8W79 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 181 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 181 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details 24-meric _pdbx_struct_assembly.oligomeric_count 24 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 72610 ? 1 MORE -286 ? 1 'SSA (A^2)' 143430 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2,3,4,5,6,7,8,9,10,11,12,13,14,15,16,17,18,19,20,21,22,23,24 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F,G,H,I,J,K,L,M # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'electron microscopy' _pdbx_struct_assembly_auth_evidence.details ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 2_665 -x+1,-y+1,z -1.0000000000 0.0000000000 0.0000000000 180.4060000000 0.0000000000 -1.0000000000 0.0000000000 180.4060000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 3 'crystal symmetry operation' 3_656 -x+1,y,-z+1 -1.0000000000 0.0000000000 0.0000000000 180.4060000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 180.4060000000 4 'crystal symmetry operation' 4_566 x,-y+1,-z+1 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 180.4060000000 0.0000000000 0.0000000000 -1.0000000000 180.4060000000 5 'crystal symmetry operation' 5_555 z,x,y 0.0000000000 0.0000000000 1.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 6 'crystal symmetry operation' 6_566 z,-x+1,-y+1 0.0000000000 0.0000000000 1.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 180.4060000000 0.0000000000 -1.0000000000 0.0000000000 180.4060000000 7 'crystal symmetry operation' 7_665 -z+1,-x+1,y 0.0000000000 0.0000000000 -1.0000000000 180.4060000000 -1.0000000000 0.0000000000 0.0000000000 180.4060000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 8 'crystal symmetry operation' 8_656 -z+1,x,-y+1 0.0000000000 0.0000000000 -1.0000000000 180.4060000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 180.4060000000 9 'crystal symmetry operation' 9_555 y,z,x 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 10 'crystal symmetry operation' 10_656 -y+1,z,-x+1 0.0000000000 -1.0000000000 0.0000000000 180.4060000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 180.4060000000 11 'crystal symmetry operation' 11_566 y,-z+1,-x+1 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 180.4060000000 -1.0000000000 0.0000000000 0.0000000000 180.4060000000 12 'crystal symmetry operation' 12_665 -y+1,-z+1,x 0.0000000000 -1.0000000000 0.0000000000 180.4060000000 0.0000000000 0.0000000000 -1.0000000000 180.4060000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 13 'crystal symmetry operation' 13_556 y,x,-z+1 0.0000000000 1.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 180.4060000000 14 'crystal symmetry operation' 14_666 -y+1,-x+1,-z+1 0.0000000000 -1.0000000000 0.0000000000 180.4060000000 -1.0000000000 0.0000000000 0.0000000000 180.4060000000 0.0000000000 0.0000000000 -1.0000000000 180.4060000000 15 'crystal symmetry operation' 15_565 y,-x+1,z 0.0000000000 1.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 180.4060000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 16 'crystal symmetry operation' 16_655 -y+1,x,z 0.0000000000 -1.0000000000 0.0000000000 180.4060000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 17 'crystal symmetry operation' 17_556 x,z,-y+1 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 180.4060000000 18 'crystal symmetry operation' 18_655 -x+1,z,y -1.0000000000 0.0000000000 0.0000000000 180.4060000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 19 'crystal symmetry operation' 19_666 -x+1,-z+1,-y+1 -1.0000000000 0.0000000000 0.0000000000 180.4060000000 0.0000000000 0.0000000000 -1.0000000000 180.4060000000 0.0000000000 -1.0000000000 0.0000000000 180.4060000000 20 'crystal symmetry operation' 20_565 x,-z+1,y 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 180.4060000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 21 'crystal symmetry operation' 21_556 z,y,-x+1 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 180.4060000000 22 'crystal symmetry operation' 22_565 z,-y+1,x 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 180.4060000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 23 'crystal symmetry operation' 23_655 -z+1,y,x 0.0000000000 0.0000000000 -1.0000000000 180.4060000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 24 'crystal symmetry operation' 24_666 -z+1,-y+1,-x+1 0.0000000000 0.0000000000 -1.0000000000 180.4060000000 0.0000000000 -1.0000000000 0.0000000000 180.4060000000 -1.0000000000 0.0000000000 0.0000000000 180.4060000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 SER A 13 ? GLU A 44 ? SER A 13 GLU A 44 1 ? 32 HELX_P HELX_P2 AA2 MET A 47 ? LEU A 62 ? MET A 47 LEU A 62 1 ? 16 HELX_P HELX_P3 AA3 GLY A 63 ? GLY A 77 ? GLY A 63 GLY A 77 1 ? 15 HELX_P HELX_P4 AA4 ASP A 94 ? GLU A 123 ? ASP A 94 GLU A 123 1 ? 30 HELX_P HELX_P5 AA5 ASP A 125 ? SER A 156 ? ASP A 125 SER A 156 1 ? 32 HELX_P HELX_P6 AA6 ASP A 158 ? GLU A 171 ? ASP A 158 GLU A 171 1 ? 14 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A ASP 60 OD2 ? ? ? 1_555 B FE . FE ? ? A ASP 60 A FE 201 1_555 ? ? ? ? ? ? ? 2.148 ? ? metalc2 metalc ? ? A HIS 65 NE2 ? ? ? 1_555 B FE . FE ? ? A HIS 65 A FE 201 1_555 ? ? ? ? ? ? ? 2.375 ? ? metalc3 metalc ? ? A ASP 138 OD1 ? ? ? 1_555 B FE . FE ? ? A ASP 138 A FE 201 1_555 ? ? ? ? ? ? ? 1.845 ? ? metalc4 metalc ? ? A ASP 142 OD2 ? ? ? 1_555 B FE . FE ? ? A ASP 142 A FE 201 1_555 ? ? ? ? ? ? ? 2.042 ? ? metalc5 metalc ? ? A GLU 164 OE1 ? ? ? 1_555 C FE . FE ? ? A GLU 164 A FE 202 1_555 ? ? ? ? ? ? ? 2.173 ? ? metalc6 metalc ? ? A GLU 164 OE1 ? ? ? 1_555 C FE . FE ? ? A GLU 164 A FE 202 3_656 ? ? ? ? ? ? ? 2.173 ? ? metalc7 metalc ? ? A GLU 168 OE1 ? ? ? 1_555 D FE . FE ? ? A GLU 168 A FE 203 1_555 ? ? ? ? ? ? ? 2.639 ? ? metalc8 metalc ? ? C FE . FE ? ? ? 1_555 M HOH . O ? ? A FE 202 A HOH 306 1_555 ? ? ? ? ? ? ? 2.224 ? ? metalc9 metalc ? ? C FE . FE ? ? ? 1_555 M HOH . O ? ? A FE 202 A HOH 306 3_656 ? ? ? ? ? ? ? 2.224 ? ? metalc10 metalc ? ? D FE . FE ? ? ? 1_555 M HOH . O ? ? A FE 203 A HOH 307 1_555 ? ? ? ? ? ? ? 2.767 ? ? metalc11 metalc ? ? E FE . FE ? ? ? 1_555 M HOH . O ? ? A FE 204 A HOH 312 1_555 ? ? ? ? ? ? ? 2.499 ? ? metalc12 metalc ? ? E FE . FE ? ? ? 1_555 M HOH . O ? ? A FE 204 A HOH 312 3_656 ? ? ? ? ? ? ? 2.499 ? ? metalc13 metalc ? ? E FE . FE ? ? ? 1_555 M HOH . O ? ? A FE 204 A HOH 315 1_555 ? ? ? ? ? ? ? 2.623 ? ? metalc14 metalc ? ? E FE . FE ? ? ? 1_555 M HOH . O ? ? A FE 204 A HOH 315 3_656 ? ? ? ? ? ? ? 2.623 ? ? metalc15 metalc ? ? G FE . FE ? ? ? 1_555 M HOH . O ? ? A FE 206 A HOH 311 1_555 ? ? ? ? ? ? ? 2.326 ? ? metalc16 metalc ? ? J FE . FE ? ? ? 1_555 M HOH . O ? ? A FE 209 A HOH 316 1_555 ? ? ? ? ? ? ? 2.728 ? ? metalc17 metalc ? ? J FE . FE ? ? ? 1_555 M HOH . O ? ? A FE 209 A HOH 316 3_656 ? ? ? ? ? ? ? 2.728 ? ? metalc18 metalc ? ? K FE . FE ? ? ? 1_555 M HOH . O ? ? A FE 210 A HOH 301 23_655 ? ? ? ? ? ? ? 2.067 ? ? metalc19 metalc ? ? K FE . FE ? ? ? 1_555 M HOH . O ? ? A FE 210 A HOH 306 1_555 ? ? ? ? ? ? ? 2.717 ? ? metalc20 metalc ? ? K FE . FE ? ? ? 1_555 M HOH . O ? ? A FE 210 A HOH 306 23_655 ? ? ? ? ? ? ? 2.699 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OD2 ? A ASP 60 ? A ASP 60 ? 1_555 FE ? B FE . ? A FE 201 ? 1_555 NE2 ? A HIS 65 ? A HIS 65 ? 1_555 77.5 ? 2 OD2 ? A ASP 60 ? A ASP 60 ? 1_555 FE ? B FE . ? A FE 201 ? 1_555 OD1 ? A ASP 138 ? A ASP 138 ? 1_555 140.2 ? 3 NE2 ? A HIS 65 ? A HIS 65 ? 1_555 FE ? B FE . ? A FE 201 ? 1_555 OD1 ? A ASP 138 ? A ASP 138 ? 1_555 91.2 ? 4 OD2 ? A ASP 60 ? A ASP 60 ? 1_555 FE ? B FE . ? A FE 201 ? 1_555 OD2 ? A ASP 142 ? A ASP 142 ? 1_555 121.7 ? 5 NE2 ? A HIS 65 ? A HIS 65 ? 1_555 FE ? B FE . ? A FE 201 ? 1_555 OD2 ? A ASP 142 ? A ASP 142 ? 1_555 110.5 ? 6 OD1 ? A ASP 138 ? A ASP 138 ? 1_555 FE ? B FE . ? A FE 201 ? 1_555 OD2 ? A ASP 142 ? A ASP 142 ? 1_555 98.1 ? 7 OE1 ? A GLU 164 ? A GLU 164 ? 1_555 FE ? C FE . ? A FE 202 ? 1_555 OE1 ? A GLU 164 ? A GLU 164 ? 1_555 0.0 ? 8 OE1 ? A GLU 164 ? A GLU 164 ? 1_555 FE ? C FE . ? A FE 202 ? 1_555 O ? M HOH . ? A HOH 306 ? 1_555 98.2 ? 9 OE1 ? A GLU 164 ? A GLU 164 ? 1_555 FE ? C FE . ? A FE 202 ? 1_555 O ? M HOH . ? A HOH 306 ? 1_555 98.2 ? 10 OE1 ? A GLU 164 ? A GLU 164 ? 1_555 FE ? C FE . ? A FE 202 ? 1_555 O ? M HOH . ? A HOH 306 ? 3_656 99.6 ? 11 OE1 ? A GLU 164 ? A GLU 164 ? 1_555 FE ? C FE . ? A FE 202 ? 1_555 O ? M HOH . ? A HOH 306 ? 3_656 99.6 ? 12 O ? M HOH . ? A HOH 306 ? 1_555 FE ? C FE . ? A FE 202 ? 1_555 O ? M HOH . ? A HOH 306 ? 3_656 1.4 ? 13 OE1 ? A GLU 168 ? A GLU 168 ? 1_555 FE ? D FE . ? A FE 203 ? 1_555 O ? M HOH . ? A HOH 307 ? 1_555 76.8 ? 14 O ? M HOH . ? A HOH 312 ? 1_555 FE ? E FE . ? A FE 204 ? 1_555 O ? M HOH . ? A HOH 312 ? 3_656 0.0 ? 15 O ? M HOH . ? A HOH 312 ? 1_555 FE ? E FE . ? A FE 204 ? 1_555 O ? M HOH . ? A HOH 315 ? 1_555 62.9 ? 16 O ? M HOH . ? A HOH 312 ? 3_656 FE ? E FE . ? A FE 204 ? 1_555 O ? M HOH . ? A HOH 315 ? 1_555 62.9 ? 17 O ? M HOH . ? A HOH 312 ? 1_555 FE ? E FE . ? A FE 204 ? 1_555 O ? M HOH . ? A HOH 315 ? 3_656 62.9 ? 18 O ? M HOH . ? A HOH 312 ? 3_656 FE ? E FE . ? A FE 204 ? 1_555 O ? M HOH . ? A HOH 315 ? 3_656 62.9 ? 19 O ? M HOH . ? A HOH 315 ? 1_555 FE ? E FE . ? A FE 204 ? 1_555 O ? M HOH . ? A HOH 315 ? 3_656 0.0 ? 20 O ? M HOH . ? A HOH 316 ? 1_555 FE ? J FE . ? A FE 209 ? 1_555 O ? M HOH . ? A HOH 316 ? 3_656 171.8 ? 21 O ? M HOH . ? A HOH 301 ? 23_655 FE ? K FE . ? A FE 210 ? 1_555 O ? M HOH . ? A HOH 306 ? 1_555 69.9 ? 22 O ? M HOH . ? A HOH 301 ? 23_655 FE ? K FE . ? A FE 210 ? 1_555 O ? M HOH . ? A HOH 306 ? 23_655 69.9 ? 23 O ? M HOH . ? A HOH 306 ? 1_555 FE ? K FE . ? A FE 210 ? 1_555 O ? M HOH . ? A HOH 306 ? 23_655 0.7 ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLN A 11 ? ? -153.39 -124.44 2 1 LYS A 12 ? ? 180.00 106.64 # loop_ _pdbx_struct_special_symmetry.id _pdbx_struct_special_symmetry.PDB_model_num _pdbx_struct_special_symmetry.auth_asym_id _pdbx_struct_special_symmetry.auth_comp_id _pdbx_struct_special_symmetry.auth_seq_id _pdbx_struct_special_symmetry.PDB_ins_code _pdbx_struct_special_symmetry.label_asym_id _pdbx_struct_special_symmetry.label_comp_id _pdbx_struct_special_symmetry.label_seq_id 1 1 A FE 202 ? C FE . 2 1 A FE 205 ? F FE . 3 1 A FE 209 ? J FE . 4 1 A HOH 306 ? M HOH . 5 1 A HOH 312 ? M HOH . 6 1 A HOH 315 ? M HOH . # _pdbx_entry_details.entry_id 8W79 _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # loop_ _pdbx_distant_solvent_atoms.id _pdbx_distant_solvent_atoms.PDB_model_num _pdbx_distant_solvent_atoms.auth_atom_id _pdbx_distant_solvent_atoms.label_alt_id _pdbx_distant_solvent_atoms.auth_asym_id _pdbx_distant_solvent_atoms.auth_comp_id _pdbx_distant_solvent_atoms.auth_seq_id _pdbx_distant_solvent_atoms.PDB_ins_code _pdbx_distant_solvent_atoms.neighbor_macromolecule_distance _pdbx_distant_solvent_atoms.neighbor_ligand_distance 1 1 O ? A HOH 315 ? 5.86 . 2 1 O ? A HOH 316 ? 8.36 . # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A LEU 2 ? A LEU 2 3 1 Y 1 A TYR 3 ? A TYR 3 4 1 Y 1 A ARG 4 ? A ARG 4 5 1 Y 1 A GLU 5 ? A GLU 5 6 1 Y 1 A ARG 6 ? A ARG 6 7 1 Y 1 A ASN 7 ? A ASN 7 8 1 Y 1 A ASN 8 ? A ASN 8 9 1 Y 1 A ILE 9 ? A ILE 9 10 1 Y 1 A LYS 172 ? A LYS 172 11 1 Y 1 A GLU 173 ? A GLU 173 12 1 Y 1 A GLU 174 ? A GLU 174 13 1 Y 1 A SER 175 ? A SER 175 14 1 Y 1 A GLU 176 ? A GLU 176 15 1 Y 1 A HIS 177 ? A HIS 177 16 1 Y 1 A GLU 178 ? A GLU 178 17 1 Y 1 A ILE 179 ? A ILE 179 18 1 Y 1 A TRP 180 ? A TRP 180 19 1 Y 1 A GLY 181 ? A GLY 181 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 FE FE FE N N 74 GLN N N N N 75 GLN CA C N S 76 GLN C C N N 77 GLN O O N N 78 GLN CB C N N 79 GLN CG C N N 80 GLN CD C N N 81 GLN OE1 O N N 82 GLN NE2 N N N 83 GLN OXT O N N 84 GLN H H N N 85 GLN H2 H N N 86 GLN HA H N N 87 GLN HB2 H N N 88 GLN HB3 H N N 89 GLN HG2 H N N 90 GLN HG3 H N N 91 GLN HE21 H N N 92 GLN HE22 H N N 93 GLN HXT H N N 94 GLU N N N N 95 GLU CA C N S 96 GLU C C N N 97 GLU O O N N 98 GLU CB C N N 99 GLU CG C N N 100 GLU CD C N N 101 GLU OE1 O N N 102 GLU OE2 O N N 103 GLU OXT O N N 104 GLU H H N N 105 GLU H2 H N N 106 GLU HA H N N 107 GLU HB2 H N N 108 GLU HB3 H N N 109 GLU HG2 H N N 110 GLU HG3 H N N 111 GLU HE2 H N N 112 GLU HXT H N N 113 GLY N N N N 114 GLY CA C N N 115 GLY C C N N 116 GLY O O N N 117 GLY OXT O N N 118 GLY H H N N 119 GLY H2 H N N 120 GLY HA2 H N N 121 GLY HA3 H N N 122 GLY HXT H N N 123 HIS N N N N 124 HIS CA C N S 125 HIS C C N N 126 HIS O O N N 127 HIS CB C N N 128 HIS CG C Y N 129 HIS ND1 N Y N 130 HIS CD2 C Y N 131 HIS CE1 C Y N 132 HIS NE2 N Y N 133 HIS OXT O N N 134 HIS H H N N 135 HIS H2 H N N 136 HIS HA H N N 137 HIS HB2 H N N 138 HIS HB3 H N N 139 HIS HD1 H N N 140 HIS HD2 H N N 141 HIS HE1 H N N 142 HIS HE2 H N N 143 HIS HXT H N N 144 HOH O O N N 145 HOH H1 H N N 146 HOH H2 H N N 147 ILE N N N N 148 ILE CA C N S 149 ILE C C N N 150 ILE O O N N 151 ILE CB C N S 152 ILE CG1 C N N 153 ILE CG2 C N N 154 ILE CD1 C N N 155 ILE OXT O N N 156 ILE H H N N 157 ILE H2 H N N 158 ILE HA H N N 159 ILE HB H N N 160 ILE HG12 H N N 161 ILE HG13 H N N 162 ILE HG21 H N N 163 ILE HG22 H N N 164 ILE HG23 H N N 165 ILE HD11 H N N 166 ILE HD12 H N N 167 ILE HD13 H N N 168 ILE HXT H N N 169 LEU N N N N 170 LEU CA C N S 171 LEU C C N N 172 LEU O O N N 173 LEU CB C N N 174 LEU CG C N N 175 LEU CD1 C N N 176 LEU CD2 C N N 177 LEU OXT O N N 178 LEU H H N N 179 LEU H2 H N N 180 LEU HA H N N 181 LEU HB2 H N N 182 LEU HB3 H N N 183 LEU HG H N N 184 LEU HD11 H N N 185 LEU HD12 H N N 186 LEU HD13 H N N 187 LEU HD21 H N N 188 LEU HD22 H N N 189 LEU HD23 H N N 190 LEU HXT H N N 191 LYS N N N N 192 LYS CA C N S 193 LYS C C N N 194 LYS O O N N 195 LYS CB C N N 196 LYS CG C N N 197 LYS CD C N N 198 LYS CE C N N 199 LYS NZ N N N 200 LYS OXT O N N 201 LYS H H N N 202 LYS H2 H N N 203 LYS HA H N N 204 LYS HB2 H N N 205 LYS HB3 H N N 206 LYS HG2 H N N 207 LYS HG3 H N N 208 LYS HD2 H N N 209 LYS HD3 H N N 210 LYS HE2 H N N 211 LYS HE3 H N N 212 LYS HZ1 H N N 213 LYS HZ2 H N N 214 LYS HZ3 H N N 215 LYS HXT H N N 216 MET N N N N 217 MET CA C N S 218 MET C C N N 219 MET O O N N 220 MET CB C N N 221 MET CG C N N 222 MET SD S N N 223 MET CE C N N 224 MET OXT O N N 225 MET H H N N 226 MET H2 H N N 227 MET HA H N N 228 MET HB2 H N N 229 MET HB3 H N N 230 MET HG2 H N N 231 MET HG3 H N N 232 MET HE1 H N N 233 MET HE2 H N N 234 MET HE3 H N N 235 MET HXT H N N 236 PHE N N N N 237 PHE CA C N S 238 PHE C C N N 239 PHE O O N N 240 PHE CB C N N 241 PHE CG C Y N 242 PHE CD1 C Y N 243 PHE CD2 C Y N 244 PHE CE1 C Y N 245 PHE CE2 C Y N 246 PHE CZ C Y N 247 PHE OXT O N N 248 PHE H H N N 249 PHE H2 H N N 250 PHE HA H N N 251 PHE HB2 H N N 252 PHE HB3 H N N 253 PHE HD1 H N N 254 PHE HD2 H N N 255 PHE HE1 H N N 256 PHE HE2 H N N 257 PHE HZ H N N 258 PHE HXT H N N 259 PRO N N N N 260 PRO CA C N S 261 PRO C C N N 262 PRO O O N N 263 PRO CB C N N 264 PRO CG C N N 265 PRO CD C N N 266 PRO OXT O N N 267 PRO H H N N 268 PRO HA H N N 269 PRO HB2 H N N 270 PRO HB3 H N N 271 PRO HG2 H N N 272 PRO HG3 H N N 273 PRO HD2 H N N 274 PRO HD3 H N N 275 PRO HXT H N N 276 SER N N N N 277 SER CA C N S 278 SER C C N N 279 SER O O N N 280 SER CB C N N 281 SER OG O N N 282 SER OXT O N N 283 SER H H N N 284 SER H2 H N N 285 SER HA H N N 286 SER HB2 H N N 287 SER HB3 H N N 288 SER HG H N N 289 SER HXT H N N 290 THR N N N N 291 THR CA C N S 292 THR C C N N 293 THR O O N N 294 THR CB C N R 295 THR OG1 O N N 296 THR CG2 C N N 297 THR OXT O N N 298 THR H H N N 299 THR H2 H N N 300 THR HA H N N 301 THR HB H N N 302 THR HG1 H N N 303 THR HG21 H N N 304 THR HG22 H N N 305 THR HG23 H N N 306 THR HXT H N N 307 TRP N N N N 308 TRP CA C N S 309 TRP C C N N 310 TRP O O N N 311 TRP CB C N N 312 TRP CG C Y N 313 TRP CD1 C Y N 314 TRP CD2 C Y N 315 TRP NE1 N Y N 316 TRP CE2 C Y N 317 TRP CE3 C Y N 318 TRP CZ2 C Y N 319 TRP CZ3 C Y N 320 TRP CH2 C Y N 321 TRP OXT O N N 322 TRP H H N N 323 TRP H2 H N N 324 TRP HA H N N 325 TRP HB2 H N N 326 TRP HB3 H N N 327 TRP HD1 H N N 328 TRP HE1 H N N 329 TRP HE3 H N N 330 TRP HZ2 H N N 331 TRP HZ3 H N N 332 TRP HH2 H N N 333 TRP HXT H N N 334 TYR N N N N 335 TYR CA C N S 336 TYR C C N N 337 TYR O O N N 338 TYR CB C N N 339 TYR CG C Y N 340 TYR CD1 C Y N 341 TYR CD2 C Y N 342 TYR CE1 C Y N 343 TYR CE2 C Y N 344 TYR CZ C Y N 345 TYR OH O N N 346 TYR OXT O N N 347 TYR H H N N 348 TYR H2 H N N 349 TYR HA H N N 350 TYR HB2 H N N 351 TYR HB3 H N N 352 TYR HD1 H N N 353 TYR HD2 H N N 354 TYR HE1 H N N 355 TYR HE2 H N N 356 TYR HH H N N 357 TYR HXT H N N 358 VAL N N N N 359 VAL CA C N S 360 VAL C C N N 361 VAL O O N N 362 VAL CB C N N 363 VAL CG1 C N N 364 VAL CG2 C N N 365 VAL OXT O N N 366 VAL H H N N 367 VAL H2 H N N 368 VAL HA H N N 369 VAL HB H N N 370 VAL HG11 H N N 371 VAL HG12 H N N 372 VAL HG13 H N N 373 VAL HG21 H N N 374 VAL HG22 H N N 375 VAL HG23 H N N 376 VAL HXT H N N 377 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 HIS N CA sing N N 116 HIS N H sing N N 117 HIS N H2 sing N N 118 HIS CA C sing N N 119 HIS CA CB sing N N 120 HIS CA HA sing N N 121 HIS C O doub N N 122 HIS C OXT sing N N 123 HIS CB CG sing N N 124 HIS CB HB2 sing N N 125 HIS CB HB3 sing N N 126 HIS CG ND1 sing Y N 127 HIS CG CD2 doub Y N 128 HIS ND1 CE1 doub Y N 129 HIS ND1 HD1 sing N N 130 HIS CD2 NE2 sing Y N 131 HIS CD2 HD2 sing N N 132 HIS CE1 NE2 sing Y N 133 HIS CE1 HE1 sing N N 134 HIS NE2 HE2 sing N N 135 HIS OXT HXT sing N N 136 HOH O H1 sing N N 137 HOH O H2 sing N N 138 ILE N CA sing N N 139 ILE N H sing N N 140 ILE N H2 sing N N 141 ILE CA C sing N N 142 ILE CA CB sing N N 143 ILE CA HA sing N N 144 ILE C O doub N N 145 ILE C OXT sing N N 146 ILE CB CG1 sing N N 147 ILE CB CG2 sing N N 148 ILE CB HB sing N N 149 ILE CG1 CD1 sing N N 150 ILE CG1 HG12 sing N N 151 ILE CG1 HG13 sing N N 152 ILE CG2 HG21 sing N N 153 ILE CG2 HG22 sing N N 154 ILE CG2 HG23 sing N N 155 ILE CD1 HD11 sing N N 156 ILE CD1 HD12 sing N N 157 ILE CD1 HD13 sing N N 158 ILE OXT HXT sing N N 159 LEU N CA sing N N 160 LEU N H sing N N 161 LEU N H2 sing N N 162 LEU CA C sing N N 163 LEU CA CB sing N N 164 LEU CA HA sing N N 165 LEU C O doub N N 166 LEU C OXT sing N N 167 LEU CB CG sing N N 168 LEU CB HB2 sing N N 169 LEU CB HB3 sing N N 170 LEU CG CD1 sing N N 171 LEU CG CD2 sing N N 172 LEU CG HG sing N N 173 LEU CD1 HD11 sing N N 174 LEU CD1 HD12 sing N N 175 LEU CD1 HD13 sing N N 176 LEU CD2 HD21 sing N N 177 LEU CD2 HD22 sing N N 178 LEU CD2 HD23 sing N N 179 LEU OXT HXT sing N N 180 LYS N CA sing N N 181 LYS N H sing N N 182 LYS N H2 sing N N 183 LYS CA C sing N N 184 LYS CA CB sing N N 185 LYS CA HA sing N N 186 LYS C O doub N N 187 LYS C OXT sing N N 188 LYS CB CG sing N N 189 LYS CB HB2 sing N N 190 LYS CB HB3 sing N N 191 LYS CG CD sing N N 192 LYS CG HG2 sing N N 193 LYS CG HG3 sing N N 194 LYS CD CE sing N N 195 LYS CD HD2 sing N N 196 LYS CD HD3 sing N N 197 LYS CE NZ sing N N 198 LYS CE HE2 sing N N 199 LYS CE HE3 sing N N 200 LYS NZ HZ1 sing N N 201 LYS NZ HZ2 sing N N 202 LYS NZ HZ3 sing N N 203 LYS OXT HXT sing N N 204 MET N CA sing N N 205 MET N H sing N N 206 MET N H2 sing N N 207 MET CA C sing N N 208 MET CA CB sing N N 209 MET CA HA sing N N 210 MET C O doub N N 211 MET C OXT sing N N 212 MET CB CG sing N N 213 MET CB HB2 sing N N 214 MET CB HB3 sing N N 215 MET CG SD sing N N 216 MET CG HG2 sing N N 217 MET CG HG3 sing N N 218 MET SD CE sing N N 219 MET CE HE1 sing N N 220 MET CE HE2 sing N N 221 MET CE HE3 sing N N 222 MET OXT HXT sing N N 223 PHE N CA sing N N 224 PHE N H sing N N 225 PHE N H2 sing N N 226 PHE CA C sing N N 227 PHE CA CB sing N N 228 PHE CA HA sing N N 229 PHE C O doub N N 230 PHE C OXT sing N N 231 PHE CB CG sing N N 232 PHE CB HB2 sing N N 233 PHE CB HB3 sing N N 234 PHE CG CD1 doub Y N 235 PHE CG CD2 sing Y N 236 PHE CD1 CE1 sing Y N 237 PHE CD1 HD1 sing N N 238 PHE CD2 CE2 doub Y N 239 PHE CD2 HD2 sing N N 240 PHE CE1 CZ doub Y N 241 PHE CE1 HE1 sing N N 242 PHE CE2 CZ sing Y N 243 PHE CE2 HE2 sing N N 244 PHE CZ HZ sing N N 245 PHE OXT HXT sing N N 246 PRO N CA sing N N 247 PRO N CD sing N N 248 PRO N H sing N N 249 PRO CA C sing N N 250 PRO CA CB sing N N 251 PRO CA HA sing N N 252 PRO C O doub N N 253 PRO C OXT sing N N 254 PRO CB CG sing N N 255 PRO CB HB2 sing N N 256 PRO CB HB3 sing N N 257 PRO CG CD sing N N 258 PRO CG HG2 sing N N 259 PRO CG HG3 sing N N 260 PRO CD HD2 sing N N 261 PRO CD HD3 sing N N 262 PRO OXT HXT sing N N 263 SER N CA sing N N 264 SER N H sing N N 265 SER N H2 sing N N 266 SER CA C sing N N 267 SER CA CB sing N N 268 SER CA HA sing N N 269 SER C O doub N N 270 SER C OXT sing N N 271 SER CB OG sing N N 272 SER CB HB2 sing N N 273 SER CB HB3 sing N N 274 SER OG HG sing N N 275 SER OXT HXT sing N N 276 THR N CA sing N N 277 THR N H sing N N 278 THR N H2 sing N N 279 THR CA C sing N N 280 THR CA CB sing N N 281 THR CA HA sing N N 282 THR C O doub N N 283 THR C OXT sing N N 284 THR CB OG1 sing N N 285 THR CB CG2 sing N N 286 THR CB HB sing N N 287 THR OG1 HG1 sing N N 288 THR CG2 HG21 sing N N 289 THR CG2 HG22 sing N N 290 THR CG2 HG23 sing N N 291 THR OXT HXT sing N N 292 TRP N CA sing N N 293 TRP N H sing N N 294 TRP N H2 sing N N 295 TRP CA C sing N N 296 TRP CA CB sing N N 297 TRP CA HA sing N N 298 TRP C O doub N N 299 TRP C OXT sing N N 300 TRP CB CG sing N N 301 TRP CB HB2 sing N N 302 TRP CB HB3 sing N N 303 TRP CG CD1 doub Y N 304 TRP CG CD2 sing Y N 305 TRP CD1 NE1 sing Y N 306 TRP CD1 HD1 sing N N 307 TRP CD2 CE2 doub Y N 308 TRP CD2 CE3 sing Y N 309 TRP NE1 CE2 sing Y N 310 TRP NE1 HE1 sing N N 311 TRP CE2 CZ2 sing Y N 312 TRP CE3 CZ3 doub Y N 313 TRP CE3 HE3 sing N N 314 TRP CZ2 CH2 doub Y N 315 TRP CZ2 HZ2 sing N N 316 TRP CZ3 CH2 sing Y N 317 TRP CZ3 HZ3 sing N N 318 TRP CH2 HH2 sing N N 319 TRP OXT HXT sing N N 320 TYR N CA sing N N 321 TYR N H sing N N 322 TYR N H2 sing N N 323 TYR CA C sing N N 324 TYR CA CB sing N N 325 TYR CA HA sing N N 326 TYR C O doub N N 327 TYR C OXT sing N N 328 TYR CB CG sing N N 329 TYR CB HB2 sing N N 330 TYR CB HB3 sing N N 331 TYR CG CD1 doub Y N 332 TYR CG CD2 sing Y N 333 TYR CD1 CE1 sing Y N 334 TYR CD1 HD1 sing N N 335 TYR CD2 CE2 doub Y N 336 TYR CD2 HD2 sing N N 337 TYR CE1 CZ doub Y N 338 TYR CE1 HE1 sing N N 339 TYR CE2 CZ sing Y N 340 TYR CE2 HE2 sing N N 341 TYR CZ OH sing N N 342 TYR OH HH sing N N 343 TYR OXT HXT sing N N 344 VAL N CA sing N N 345 VAL N H sing N N 346 VAL N H2 sing N N 347 VAL CA C sing N N 348 VAL CA CB sing N N 349 VAL CA HA sing N N 350 VAL C O doub N N 351 VAL C OXT sing N N 352 VAL CB CG1 sing N N 353 VAL CB CG2 sing N N 354 VAL CB HB sing N N 355 VAL CG1 HG11 sing N N 356 VAL CG1 HG12 sing N N 357 VAL CG1 HG13 sing N N 358 VAL CG2 HG21 sing N N 359 VAL CG2 HG22 sing N N 360 VAL CG2 HG23 sing N N 361 VAL OXT HXT sing N N 362 # _pdbx_audit_support.funding_organization 'National Natural Science Foundation of China (NSFC)' _pdbx_audit_support.country China _pdbx_audit_support.grant_number '62075118, 21601112' _pdbx_audit_support.ordinal 1 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id FE _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id FE _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list 1 _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 8W6M _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 8W79 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 0.005543 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.005543 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.005543 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C FE N O S # loop_