data_8WRG # _entry.id 8WRG # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.403 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 8WRG pdb_00008wrg 10.2210/pdb8wrg/pdb WWPDB D_1300040862 ? ? BMRB 51948 ? 10.13018/BMR51948 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date _pdbx_audit_revision_history.part_number 1 'Structure model' 1 0 2024-10-16 ? 2 'Structure model' 1 1 2025-05-28 ? # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_audit_revision_group.ordinal 1 _pdbx_audit_revision_group.revision_ordinal 2 _pdbx_audit_revision_group.data_content_type 'Structure model' _pdbx_audit_revision_group.group 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_CSD' 4 2 'Structure model' '_citation.journal_id_ISSN' 5 2 'Structure model' '_citation.journal_volume' 6 2 'Structure model' '_citation.page_first' 7 2 'Structure model' '_citation.page_last' 8 2 'Structure model' '_citation.pdbx_database_id_DOI' 9 2 'Structure model' '_citation.pdbx_database_id_PubMed' 10 2 'Structure model' '_citation.title' 11 2 'Structure model' '_citation.year' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr . _pdbx_database_status.entry_id 8WRG _pdbx_database_status.recvd_initial_deposition_date 2023-10-14 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs . _pdbx_database_status.status_code_nmr_data REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_database_related.db_name BMRB _pdbx_database_related.details . _pdbx_database_related.db_id 51948 _pdbx_database_related.content_type unspecified # _pdbx_contact_author.id 2 _pdbx_contact_author.email yanli@hust.edu.cn _pdbx_contact_author.name_first Yan _pdbx_contact_author.name_last Li _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0003-1963-839X # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Zhang, H.' 1 0000-0002-4104-7062 'Li, Y.' 2 0000-0003-1963-839X # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Nat Commun' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2041-1723 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 16 _citation.language ? _citation.page_first 3855 _citation.page_last 3855 _citation.title 'The mechanism of YAP/TAZ transactivation and dual targeting for cancer therapy.' _citation.year 2025 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1038/s41467-025-59309-w _citation.pdbx_database_id_PubMed 40274828 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Yu, M.' 1 ? primary 'Wang, J.' 2 0009-0008-6659-0652 primary 'Zhang, X.' 3 ? primary 'Zhang, H.' 4 ? primary 'Li, C.' 5 ? primary 'Li, J.' 6 ? primary 'Lin, J.' 7 ? primary 'Zheng, J.' 8 0000-0001-7932-5753 primary 'Huang, L.' 9 ? primary 'Li, Y.' 10 0000-0003-1963-839X primary 'Sun, S.' 11 0009-0005-7956-8487 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Transcriptional coactivator YAP1' _entity.formula_weight 7048.788 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code MHHHHHHGSGTNVDLGTLEGDGMNIEGEELMPSLQEALSSDILNDMESVLAATKLDKESFLTWL _entity_poly.pdbx_seq_one_letter_code_can MHHHHHHGSGTNVDLGTLEGDGMNIEGEELMPSLQEALSSDILNDMESVLAATKLDKESFLTWL _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 HIS n 1 3 HIS n 1 4 HIS n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 GLY n 1 9 SER n 1 10 GLY n 1 11 THR n 1 12 ASN n 1 13 VAL n 1 14 ASP n 1 15 LEU n 1 16 GLY n 1 17 THR n 1 18 LEU n 1 19 GLU n 1 20 GLY n 1 21 ASP n 1 22 GLY n 1 23 MET n 1 24 ASN n 1 25 ILE n 1 26 GLU n 1 27 GLY n 1 28 GLU n 1 29 GLU n 1 30 LEU n 1 31 MET n 1 32 PRO n 1 33 SER n 1 34 LEU n 1 35 GLN n 1 36 GLU n 1 37 ALA n 1 38 LEU n 1 39 SER n 1 40 SER n 1 41 ASP n 1 42 ILE n 1 43 LEU n 1 44 ASN n 1 45 ASP n 1 46 MET n 1 47 GLU n 1 48 SER n 1 49 VAL n 1 50 LEU n 1 51 ALA n 1 52 ALA n 1 53 THR n 1 54 LYS n 1 55 LEU n 1 56 ASP n 1 57 LYS n 1 58 GLU n 1 59 SER n 1 60 PHE n 1 61 LEU n 1 62 THR n 1 63 TRP n 1 64 LEU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 64 _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene YAP1 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant YAP1-2gamma _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 -4 ? ? ? A . n A 1 2 HIS 2 -3 ? ? ? A . n A 1 3 HIS 3 -2 ? ? ? A . n A 1 4 HIS 4 -1 ? ? ? A . n A 1 5 HIS 5 0 ? ? ? A . n A 1 6 HIS 6 1 1 HIS HIS A . n A 1 7 HIS 7 2 2 HIS HIS A . n A 1 8 GLY 8 3 3 GLY GLY A . n A 1 9 SER 9 4 4 SER SER A . n A 1 10 GLY 10 5 5 GLY GLY A . n A 1 11 THR 11 6 6 THR THR A . n A 1 12 ASN 12 7 7 ASN ASN A . n A 1 13 VAL 13 8 8 VAL VAL A . n A 1 14 ASP 14 9 9 ASP ASP A . n A 1 15 LEU 15 10 10 LEU LEU A . n A 1 16 GLY 16 11 11 GLY GLY A . n A 1 17 THR 17 12 12 THR THR A . n A 1 18 LEU 18 13 13 LEU LEU A . n A 1 19 GLU 19 14 14 GLU GLU A . n A 1 20 GLY 20 15 15 GLY GLY A . n A 1 21 ASP 21 16 16 ASP ASP A . n A 1 22 GLY 22 17 17 GLY GLY A . n A 1 23 MET 23 18 18 MET MET A . n A 1 24 ASN 24 19 19 ASN ASN A . n A 1 25 ILE 25 20 20 ILE ILE A . n A 1 26 GLU 26 21 21 GLU GLU A . n A 1 27 GLY 27 22 22 GLY GLY A . n A 1 28 GLU 28 23 23 GLU GLU A . n A 1 29 GLU 29 24 24 GLU GLU A . n A 1 30 LEU 30 25 25 LEU LEU A . n A 1 31 MET 31 26 26 MET MET A . n A 1 32 PRO 32 27 27 PRO PRO A . n A 1 33 SER 33 28 28 SER SER A . n A 1 34 LEU 34 29 29 LEU LEU A . n A 1 35 GLN 35 30 30 GLN GLN A . n A 1 36 GLU 36 31 31 GLU GLU A . n A 1 37 ALA 37 32 32 ALA ALA A . n A 1 38 LEU 38 33 33 LEU LEU A . n A 1 39 SER 39 34 34 SER SER A . n A 1 40 SER 40 35 35 SER SER A . n A 1 41 ASP 41 36 36 ASP ASP A . n A 1 42 ILE 42 37 37 ILE ILE A . n A 1 43 LEU 43 38 38 LEU LEU A . n A 1 44 ASN 44 39 39 ASN ASN A . n A 1 45 ASP 45 40 40 ASP ASP A . n A 1 46 MET 46 41 41 MET MET A . n A 1 47 GLU 47 42 42 GLU GLU A . n A 1 48 SER 48 43 43 SER SER A . n A 1 49 VAL 49 44 44 VAL VAL A . n A 1 50 LEU 50 45 45 LEU LEU A . n A 1 51 ALA 51 46 46 ALA ALA A . n A 1 52 ALA 52 47 47 ALA ALA A . n A 1 53 THR 53 48 48 THR THR A . n A 1 54 LYS 54 49 49 LYS LYS A . n A 1 55 LEU 55 50 50 LEU LEU A . n A 1 56 ASP 56 51 51 ASP ASP A . n A 1 57 LYS 57 52 52 LYS LYS A . n A 1 58 GLU 58 53 53 GLU GLU A . n A 1 59 SER 59 54 54 SER SER A . n A 1 60 PHE 60 55 55 PHE PHE A . n A 1 61 LEU 61 56 56 LEU LEU A . n A 1 62 THR 62 57 57 THR THR A . n A 1 63 TRP 63 58 58 TRP TRP A . n A 1 64 LEU 64 59 59 LEU LEU A . n # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 8WRG _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 8WRG _struct.title 'Solution structure of the TAD domain (450-504) of human transcriptional coactivator YAP1' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 8WRG _struct_keywords.text 'transcriptional coactivator, transcription factor complex, TRANSCRIPTION' _struct_keywords.pdbx_keywords TRANSCRIPTION # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code YAP1_HUMAN _struct_ref.pdbx_db_accession P46937 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code GTNVDLGTLEGDGMNIEGEELMPSLQEALSSDILNDMESVLAATKLDKESFLTWL _struct_ref.pdbx_align_begin 450 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 8WRG _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 10 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 64 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P46937 _struct_ref_seq.db_align_beg 450 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 504 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 5 _struct_ref_seq.pdbx_auth_seq_align_end 59 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 8WRG MET A 1 ? UNP P46937 ? ? 'initiating methionine' -4 1 1 8WRG HIS A 2 ? UNP P46937 ? ? 'expression tag' -3 2 1 8WRG HIS A 3 ? UNP P46937 ? ? 'expression tag' -2 3 1 8WRG HIS A 4 ? UNP P46937 ? ? 'expression tag' -1 4 1 8WRG HIS A 5 ? UNP P46937 ? ? 'expression tag' 0 5 1 8WRG HIS A 6 ? UNP P46937 ? ? 'expression tag' 1 6 1 8WRG HIS A 7 ? UNP P46937 ? ? 'expression tag' 2 7 1 8WRG GLY A 8 ? UNP P46937 ? ? 'expression tag' 3 8 1 8WRG SER A 9 ? UNP P46937 ? ? 'expression tag' 4 9 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'NMR Distance Restraints' _pdbx_struct_assembly_auth_evidence.details 'not applicable' # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id AA1 _struct_conf.beg_label_comp_id ASP _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 45 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id LEU _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 50 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id ASP _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 40 _struct_conf.end_auth_comp_id LEU _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 45 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _pdbx_entry_details.entry_id 8WRG _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLU A 23 ? ? -109.67 -67.40 2 1 SER A 28 ? ? 57.25 78.85 3 1 GLN A 30 ? ? -138.11 -64.07 4 1 GLU A 31 ? ? 57.55 87.29 5 1 THR A 48 ? ? 60.27 91.96 6 1 LYS A 49 ? ? -149.72 -32.82 7 2 VAL A 8 ? ? -144.11 -35.17 8 2 THR A 12 ? ? -137.89 -57.98 9 2 LEU A 13 ? ? 56.80 91.64 10 2 ASN A 19 ? ? 60.75 -86.76 11 2 ILE A 20 ? ? -141.63 26.44 12 2 GLU A 23 ? ? -95.63 31.89 13 2 ALA A 32 ? ? -155.52 -73.84 14 2 SER A 34 ? ? -160.35 85.66 15 2 SER A 35 ? ? -147.51 -37.17 16 2 LEU A 38 ? ? -140.30 -28.55 17 2 THR A 48 ? ? -163.80 -17.85 18 2 SER A 54 ? ? -149.90 18.08 19 2 TRP A 58 ? ? -66.22 95.24 20 3 ASN A 7 ? ? 56.62 90.34 21 3 VAL A 8 ? ? -79.55 -70.72 22 3 LEU A 10 ? ? -158.35 -57.45 23 3 MET A 18 ? ? 56.50 82.87 24 3 SER A 28 ? ? -149.32 -20.75 25 3 ALA A 32 ? ? -147.09 -18.17 26 3 SER A 35 ? ? 59.96 96.39 27 3 ILE A 37 ? ? -123.22 -66.08 28 3 LEU A 38 ? ? 58.25 90.06 29 3 LYS A 49 ? ? -167.24 -61.09 30 3 LEU A 50 ? ? 57.60 93.60 31 3 GLU A 53 ? ? 54.99 76.78 32 4 SER A 4 ? ? 57.03 70.62 33 4 LEU A 29 ? ? -100.18 75.76 34 4 ASP A 36 ? ? 57.40 92.49 35 4 ALA A 46 ? ? 58.36 19.70 36 4 LYS A 49 ? ? 57.47 -172.02 37 4 LEU A 50 ? ? -164.49 95.87 38 4 LEU A 56 ? ? -94.24 45.52 39 5 SER A 4 ? ? 57.70 86.62 40 5 ASP A 9 ? ? 54.52 83.88 41 5 LEU A 10 ? ? -103.37 -60.57 42 5 THR A 12 ? ? -132.32 -46.27 43 5 LEU A 13 ? ? -146.75 -34.80 44 5 GLU A 14 ? ? 52.44 82.17 45 5 ASN A 19 ? ? -125.34 -52.60 46 5 SER A 35 ? ? -152.38 -54.09 47 5 ALA A 47 ? ? -94.17 51.81 48 5 SER A 54 ? ? -144.48 -15.06 49 5 LEU A 56 ? ? 59.71 96.75 50 6 ASP A 9 ? ? -159.58 63.45 51 6 LEU A 10 ? ? 59.12 91.24 52 6 ASN A 19 ? ? -153.87 -9.97 53 6 GLU A 21 ? ? 60.56 -169.02 54 6 ALA A 32 ? ? 57.27 79.07 55 6 SER A 34 ? ? 58.27 85.60 56 6 ASP A 36 ? ? 59.94 96.31 57 6 ASN A 39 ? ? -110.60 73.77 58 6 THR A 48 ? ? -161.40 -6.85 59 6 ASP A 51 ? ? -139.97 -70.88 60 6 LYS A 52 ? ? -155.04 -34.52 61 6 SER A 54 ? ? 59.22 78.22 62 6 PHE A 55 ? ? -171.13 91.19 63 6 LEU A 56 ? ? -107.15 -79.03 64 6 THR A 57 ? ? -141.73 -19.59 65 7 HIS A 2 ? ? 56.19 87.13 66 7 THR A 12 ? ? -154.51 -45.70 67 7 MET A 18 ? ? 57.68 98.18 68 7 GLU A 23 ? ? 55.13 84.16 69 7 SER A 28 ? ? 59.51 -171.36 70 7 LEU A 29 ? ? 56.12 71.89 71 7 ALA A 32 ? ? -154.06 -34.45 72 7 SER A 34 ? ? -152.16 -29.48 73 7 LEU A 50 ? ? 56.48 77.14 74 7 SER A 54 ? ? 61.06 174.16 75 8 LEU A 13 ? ? -148.67 27.98 76 8 ASN A 19 ? ? -134.57 -39.99 77 8 SER A 35 ? ? -163.09 105.47 78 8 LEU A 38 ? ? -163.04 77.24 79 8 ASN A 39 ? ? -157.02 -21.08 80 8 ALA A 46 ? ? 58.70 15.76 81 8 THR A 48 ? ? 59.83 98.06 82 8 LYS A 52 ? ? -141.90 -60.84 83 8 LEU A 56 ? ? 58.19 88.36 84 9 THR A 6 ? ? -130.31 -66.40 85 9 ASN A 7 ? ? -151.49 -57.48 86 9 LEU A 13 ? ? 56.57 79.55 87 9 LEU A 29 ? ? -69.31 -83.88 88 9 GLN A 30 ? ? -141.36 -73.31 89 9 SER A 34 ? ? -98.06 36.61 90 9 ASN A 39 ? ? 53.66 74.22 91 9 LEU A 50 ? ? 56.57 90.89 92 9 LEU A 56 ? ? -155.13 -44.08 93 10 SER A 4 ? ? -140.75 27.40 94 10 THR A 6 ? ? -106.31 41.11 95 10 ASN A 7 ? ? 56.97 86.67 96 10 ASP A 9 ? ? 55.46 83.54 97 10 LEU A 10 ? ? -142.87 -33.09 98 10 THR A 12 ? ? -97.40 55.66 99 10 MET A 18 ? ? -114.27 78.69 100 10 PRO A 27 ? ? -57.78 97.26 101 10 ALA A 32 ? ? -154.28 -36.10 102 10 LEU A 33 ? ? -154.16 88.47 103 10 LEU A 38 ? ? 61.05 -179.46 104 10 ALA A 47 ? ? -65.97 97.14 105 10 LEU A 50 ? ? 59.38 102.55 106 10 LYS A 52 ? ? -141.64 -24.95 107 10 SER A 54 ? ? -153.22 -36.31 108 10 LEU A 56 ? ? -112.17 71.25 109 11 ASN A 7 ? ? -69.56 90.85 110 11 LEU A 13 ? ? 55.31 81.93 111 11 GLU A 14 ? ? -101.60 -60.42 112 11 GLU A 24 ? ? -157.21 20.99 113 11 GLN A 30 ? ? 59.79 93.94 114 11 ASP A 36 ? ? 56.94 81.89 115 11 LYS A 49 ? ? -162.12 -54.70 116 11 ASP A 51 ? ? -156.72 -17.05 117 12 THR A 6 ? ? 57.65 86.61 118 12 ASN A 7 ? ? -155.13 30.15 119 12 LEU A 25 ? ? -142.52 -13.84 120 12 LEU A 29 ? ? 57.80 -172.87 121 12 GLN A 30 ? ? 55.91 85.04 122 12 SER A 34 ? ? 58.41 -172.72 123 12 SER A 35 ? ? -156.29 81.29 124 12 ASN A 39 ? ? -144.07 -18.40 125 12 ALA A 46 ? ? 59.46 14.93 126 12 THR A 48 ? ? -146.49 -56.17 127 12 LEU A 50 ? ? 57.83 91.97 128 12 SER A 54 ? ? 57.31 -171.24 129 13 SER A 4 ? ? 57.37 88.08 130 13 ASN A 7 ? ? -164.13 -33.54 131 13 ASP A 9 ? ? -168.69 90.56 132 13 THR A 12 ? ? -150.48 -43.66 133 13 ASP A 16 ? ? -132.86 -48.71 134 13 GLU A 21 ? ? 52.17 72.28 135 13 GLN A 30 ? ? -150.42 5.55 136 13 LEU A 38 ? ? -154.84 -23.68 137 13 ALA A 46 ? ? 59.68 14.69 138 13 LEU A 50 ? ? 60.87 171.03 139 13 ASP A 51 ? ? -155.04 82.70 140 13 SER A 54 ? ? -161.60 85.46 141 13 THR A 57 ? ? -139.09 -41.86 142 14 THR A 12 ? ? -151.95 -60.65 143 14 LEU A 13 ? ? 58.66 95.55 144 14 ASN A 19 ? ? -154.51 15.22 145 14 ILE A 20 ? ? -141.14 -25.63 146 14 GLU A 21 ? ? -88.36 30.03 147 14 GLU A 24 ? ? 55.41 -164.32 148 14 ALA A 32 ? ? -74.83 -166.46 149 14 LEU A 33 ? ? 58.36 86.92 150 14 SER A 35 ? ? 58.05 95.38 151 14 ASP A 36 ? ? 58.36 -173.28 152 14 THR A 48 ? ? 54.92 76.03 153 15 ASP A 9 ? ? 56.63 93.19 154 15 THR A 12 ? ? -132.34 -52.06 155 15 LEU A 13 ? ? -120.22 -70.52 156 15 ASN A 19 ? ? -160.66 -0.90 157 15 ILE A 20 ? ? -145.07 -31.42 158 15 GLU A 23 ? ? -163.21 15.49 159 15 GLN A 30 ? ? -108.13 -167.58 160 15 LEU A 38 ? ? -165.51 118.00 161 15 ALA A 47 ? ? -152.55 20.74 162 15 THR A 48 ? ? -133.12 -38.73 163 15 LYS A 49 ? ? -99.49 -61.96 164 15 LEU A 50 ? ? 58.77 97.44 165 15 LYS A 52 ? ? -158.97 -21.06 166 16 ASN A 7 ? ? -168.81 114.41 167 16 ASP A 9 ? ? -164.63 -28.12 168 16 LEU A 13 ? ? 56.68 89.18 169 16 PRO A 27 ? ? -63.60 97.91 170 16 LEU A 50 ? ? -140.55 -75.08 171 16 SER A 54 ? ? -146.56 -17.79 172 17 HIS A 2 ? ? 56.54 84.37 173 17 THR A 6 ? ? -143.72 -23.17 174 17 VAL A 8 ? ? 57.09 89.81 175 17 ASP A 9 ? ? -139.37 -65.13 176 17 LEU A 10 ? ? -155.99 -70.08 177 17 LEU A 13 ? ? 56.55 81.39 178 17 ASN A 19 ? ? -134.58 -68.92 179 17 GLN A 30 ? ? -99.72 -60.67 180 17 GLU A 31 ? ? -166.18 -28.42 181 17 SER A 34 ? ? -159.80 -20.54 182 17 ASN A 39 ? ? -65.93 89.85 183 17 ALA A 47 ? ? 61.93 168.30 184 17 LEU A 50 ? ? -160.65 115.54 185 17 ASP A 51 ? ? -146.30 -1.50 186 17 SER A 54 ? ? -151.63 38.87 187 17 LEU A 56 ? ? 57.82 88.75 188 18 HIS A 2 ? ? -162.14 -62.65 189 18 THR A 6 ? ? 60.92 -86.99 190 18 THR A 12 ? ? -151.98 -70.89 191 18 MET A 18 ? ? -75.46 -77.57 192 18 ILE A 20 ? ? -165.24 -38.10 193 18 PRO A 27 ? ? -81.75 38.97 194 18 SER A 28 ? ? -83.92 -75.22 195 18 GLN A 30 ? ? -164.19 117.87 196 18 ALA A 32 ? ? -157.39 -49.34 197 18 LEU A 38 ? ? -86.56 36.18 198 19 SER A 4 ? ? -96.64 -68.87 199 19 ASN A 7 ? ? -65.71 99.50 200 19 LEU A 10 ? ? -164.53 -0.87 201 19 MET A 18 ? ? 56.21 83.33 202 19 ASN A 19 ? ? -145.60 -24.29 203 19 GLU A 21 ? ? 57.55 -171.89 204 19 LEU A 29 ? ? 63.88 157.15 205 19 GLN A 30 ? ? 59.12 179.63 206 19 ALA A 46 ? ? 59.60 14.41 207 19 LYS A 52 ? ? -140.72 -39.91 208 19 TRP A 58 ? ? -133.70 -31.49 209 20 ASN A 7 ? ? -152.07 29.00 210 20 LEU A 10 ? ? -157.21 -24.63 211 20 THR A 12 ? ? 65.40 82.45 212 20 ASN A 19 ? ? -150.84 18.75 213 20 ILE A 20 ? ? -144.28 -23.86 214 20 SER A 28 ? ? -102.12 78.82 215 20 GLN A 30 ? ? 54.46 80.33 216 20 GLU A 31 ? ? -128.17 -51.21 217 20 SER A 34 ? ? -141.08 -62.50 218 20 SER A 35 ? ? -149.78 -48.69 219 20 ALA A 46 ? ? -91.09 31.67 220 20 ALA A 47 ? ? 60.77 -84.94 221 20 THR A 48 ? ? -144.35 -77.35 222 20 ASP A 51 ? ? -106.17 41.71 223 20 SER A 54 ? ? 61.74 -82.18 224 20 TRP A 58 ? ? -151.07 -46.81 # _pdbx_nmr_ensemble.entry_id 8WRG _pdbx_nmr_ensemble.conformers_calculated_total_number 200 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 8WRG _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # _pdbx_nmr_sample_details.solution_id 2 _pdbx_nmr_sample_details.contents '0.95 mM [U-99% 13C; U-99% 15N] YAP-TAD, 20 mM HEPES, 100 mM sodium chloride, 5 % v/v [U-99% 2H] D2O, 95% H2O/5% D2O' _pdbx_nmr_sample_details.solvent_system '95% H2O/5% D2O' _pdbx_nmr_sample_details.label 13C15N_sample _pdbx_nmr_sample_details.type solution _pdbx_nmr_sample_details.details ? # loop_ _pdbx_nmr_exptl_sample.solution_id _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling 2 YAP-TAD 0.95 ? mM '[U-99% 13C; U-99% 15N]' 2 HEPES 20 ? mM 'natural abundance' 2 'sodium chloride' 100 ? mM 'natural abundance' 2 D2O 5 ? '% v/v' '[U-99% 2H]' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 120 _pdbx_nmr_exptl_sample_conditions.details ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_err ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units mM _pdbx_nmr_exptl_sample_conditions.label conditions_1 _pdbx_nmr_exptl_sample_conditions.pH_err ? _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 2 '2D 1H-15N HSQC' 1 isotropic 2 1 2 '3D CBCA(CO)NH' 1 isotropic 3 1 2 '3D CBCANH' 1 isotropic 4 1 2 '3D HNCO' 1 isotropic 5 1 2 '3D H(CCO)NH' 1 isotropic 6 1 2 '3D C(CO)NH' 1 isotropic 7 1 2 '3D HBHA(CO)NH' 1 isotropic 8 1 2 '3D 1H-15N NOESY' 1 isotropic # _pdbx_nmr_refine.entry_id 8WRG _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 2 # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 4 'peak picking' NMRFAM-SPARKY 'POKY build 20230213' 'Woonghee Lee, Mehdi Rahimi, Yeongjoon Lee and Abigail Chiu' 1 'chemical shift assignment' NMRFAM-SPARKY 'POKY build 20230213' 'Woonghee Lee, Mehdi Rahimi, Yeongjoon Lee and Abigail Chiu' 2 'structure calculation' CNS ARIA2.3 'Wolfgang Rieping, Michael Habeck, Benjamin Bardiaux, Aymeric Bernard, Therese E. Malliavin and Michael Nilges' # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET -4 ? A MET 1 2 1 Y 1 A HIS -3 ? A HIS 2 3 1 Y 1 A HIS -2 ? A HIS 3 4 1 Y 1 A HIS -1 ? A HIS 4 5 1 Y 1 A HIS 0 ? A HIS 5 6 2 Y 1 A MET -4 ? A MET 1 7 2 Y 1 A HIS -3 ? A HIS 2 8 2 Y 1 A HIS -2 ? A HIS 3 9 2 Y 1 A HIS -1 ? A HIS 4 10 2 Y 1 A HIS 0 ? A HIS 5 11 3 Y 1 A MET -4 ? A MET 1 12 3 Y 1 A HIS -3 ? A HIS 2 13 3 Y 1 A HIS -2 ? A HIS 3 14 3 Y 1 A HIS -1 ? A HIS 4 15 3 Y 1 A HIS 0 ? A HIS 5 16 4 Y 1 A MET -4 ? A MET 1 17 4 Y 1 A HIS -3 ? A HIS 2 18 4 Y 1 A HIS -2 ? A HIS 3 19 4 Y 1 A HIS -1 ? A HIS 4 20 4 Y 1 A HIS 0 ? A HIS 5 21 5 Y 1 A MET -4 ? A MET 1 22 5 Y 1 A HIS -3 ? A HIS 2 23 5 Y 1 A HIS -2 ? A HIS 3 24 5 Y 1 A HIS -1 ? A HIS 4 25 5 Y 1 A HIS 0 ? A HIS 5 26 6 Y 1 A MET -4 ? A MET 1 27 6 Y 1 A HIS -3 ? A HIS 2 28 6 Y 1 A HIS -2 ? A HIS 3 29 6 Y 1 A HIS -1 ? A HIS 4 30 6 Y 1 A HIS 0 ? A HIS 5 31 7 Y 1 A MET -4 ? A MET 1 32 7 Y 1 A HIS -3 ? A HIS 2 33 7 Y 1 A HIS -2 ? A HIS 3 34 7 Y 1 A HIS -1 ? A HIS 4 35 7 Y 1 A HIS 0 ? A HIS 5 36 8 Y 1 A MET -4 ? A MET 1 37 8 Y 1 A HIS -3 ? A HIS 2 38 8 Y 1 A HIS -2 ? A HIS 3 39 8 Y 1 A HIS -1 ? A HIS 4 40 8 Y 1 A HIS 0 ? A HIS 5 41 9 Y 1 A MET -4 ? A MET 1 42 9 Y 1 A HIS -3 ? A HIS 2 43 9 Y 1 A HIS -2 ? A HIS 3 44 9 Y 1 A HIS -1 ? A HIS 4 45 9 Y 1 A HIS 0 ? A HIS 5 46 10 Y 1 A MET -4 ? A MET 1 47 10 Y 1 A HIS -3 ? A HIS 2 48 10 Y 1 A HIS -2 ? A HIS 3 49 10 Y 1 A HIS -1 ? A HIS 4 50 10 Y 1 A HIS 0 ? A HIS 5 51 11 Y 1 A MET -4 ? A MET 1 52 11 Y 1 A HIS -3 ? A HIS 2 53 11 Y 1 A HIS -2 ? A HIS 3 54 11 Y 1 A HIS -1 ? A HIS 4 55 11 Y 1 A HIS 0 ? A HIS 5 56 12 Y 1 A MET -4 ? A MET 1 57 12 Y 1 A HIS -3 ? A HIS 2 58 12 Y 1 A HIS -2 ? A HIS 3 59 12 Y 1 A HIS -1 ? A HIS 4 60 12 Y 1 A HIS 0 ? A HIS 5 61 13 Y 1 A MET -4 ? A MET 1 62 13 Y 1 A HIS -3 ? A HIS 2 63 13 Y 1 A HIS -2 ? A HIS 3 64 13 Y 1 A HIS -1 ? A HIS 4 65 13 Y 1 A HIS 0 ? A HIS 5 66 14 Y 1 A MET -4 ? A MET 1 67 14 Y 1 A HIS -3 ? A HIS 2 68 14 Y 1 A HIS -2 ? A HIS 3 69 14 Y 1 A HIS -1 ? A HIS 4 70 14 Y 1 A HIS 0 ? A HIS 5 71 15 Y 1 A MET -4 ? A MET 1 72 15 Y 1 A HIS -3 ? A HIS 2 73 15 Y 1 A HIS -2 ? A HIS 3 74 15 Y 1 A HIS -1 ? A HIS 4 75 15 Y 1 A HIS 0 ? A HIS 5 76 16 Y 1 A MET -4 ? A MET 1 77 16 Y 1 A HIS -3 ? A HIS 2 78 16 Y 1 A HIS -2 ? A HIS 3 79 16 Y 1 A HIS -1 ? A HIS 4 80 16 Y 1 A HIS 0 ? A HIS 5 81 17 Y 1 A MET -4 ? A MET 1 82 17 Y 1 A HIS -3 ? A HIS 2 83 17 Y 1 A HIS -2 ? A HIS 3 84 17 Y 1 A HIS -1 ? A HIS 4 85 17 Y 1 A HIS 0 ? A HIS 5 86 18 Y 1 A MET -4 ? A MET 1 87 18 Y 1 A HIS -3 ? A HIS 2 88 18 Y 1 A HIS -2 ? A HIS 3 89 18 Y 1 A HIS -1 ? A HIS 4 90 18 Y 1 A HIS 0 ? A HIS 5 91 19 Y 1 A MET -4 ? A MET 1 92 19 Y 1 A HIS -3 ? A HIS 2 93 19 Y 1 A HIS -2 ? A HIS 3 94 19 Y 1 A HIS -1 ? A HIS 4 95 19 Y 1 A HIS 0 ? A HIS 5 96 20 Y 1 A MET -4 ? A MET 1 97 20 Y 1 A HIS -3 ? A HIS 2 98 20 Y 1 A HIS -2 ? A HIS 3 99 20 Y 1 A HIS -1 ? A HIS 4 100 20 Y 1 A HIS 0 ? A HIS 5 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ASN N N N N 14 ASN CA C N S 15 ASN C C N N 16 ASN O O N N 17 ASN CB C N N 18 ASN CG C N N 19 ASN OD1 O N N 20 ASN ND2 N N N 21 ASN OXT O N N 22 ASN H H N N 23 ASN H2 H N N 24 ASN HA H N N 25 ASN HB2 H N N 26 ASN HB3 H N N 27 ASN HD21 H N N 28 ASN HD22 H N N 29 ASN HXT H N N 30 ASP N N N N 31 ASP CA C N S 32 ASP C C N N 33 ASP O O N N 34 ASP CB C N N 35 ASP CG C N N 36 ASP OD1 O N N 37 ASP OD2 O N N 38 ASP OXT O N N 39 ASP H H N N 40 ASP H2 H N N 41 ASP HA H N N 42 ASP HB2 H N N 43 ASP HB3 H N N 44 ASP HD2 H N N 45 ASP HXT H N N 46 GLN N N N N 47 GLN CA C N S 48 GLN C C N N 49 GLN O O N N 50 GLN CB C N N 51 GLN CG C N N 52 GLN CD C N N 53 GLN OE1 O N N 54 GLN NE2 N N N 55 GLN OXT O N N 56 GLN H H N N 57 GLN H2 H N N 58 GLN HA H N N 59 GLN HB2 H N N 60 GLN HB3 H N N 61 GLN HG2 H N N 62 GLN HG3 H N N 63 GLN HE21 H N N 64 GLN HE22 H N N 65 GLN HXT H N N 66 GLU N N N N 67 GLU CA C N S 68 GLU C C N N 69 GLU O O N N 70 GLU CB C N N 71 GLU CG C N N 72 GLU CD C N N 73 GLU OE1 O N N 74 GLU OE2 O N N 75 GLU OXT O N N 76 GLU H H N N 77 GLU H2 H N N 78 GLU HA H N N 79 GLU HB2 H N N 80 GLU HB3 H N N 81 GLU HG2 H N N 82 GLU HG3 H N N 83 GLU HE2 H N N 84 GLU HXT H N N 85 GLY N N N N 86 GLY CA C N N 87 GLY C C N N 88 GLY O O N N 89 GLY OXT O N N 90 GLY H H N N 91 GLY H2 H N N 92 GLY HA2 H N N 93 GLY HA3 H N N 94 GLY HXT H N N 95 HIS N N N N 96 HIS CA C N S 97 HIS C C N N 98 HIS O O N N 99 HIS CB C N N 100 HIS CG C Y N 101 HIS ND1 N Y N 102 HIS CD2 C Y N 103 HIS CE1 C Y N 104 HIS NE2 N Y N 105 HIS OXT O N N 106 HIS H H N N 107 HIS H2 H N N 108 HIS HA H N N 109 HIS HB2 H N N 110 HIS HB3 H N N 111 HIS HD1 H N N 112 HIS HD2 H N N 113 HIS HE1 H N N 114 HIS HE2 H N N 115 HIS HXT H N N 116 ILE N N N N 117 ILE CA C N S 118 ILE C C N N 119 ILE O O N N 120 ILE CB C N S 121 ILE CG1 C N N 122 ILE CG2 C N N 123 ILE CD1 C N N 124 ILE OXT O N N 125 ILE H H N N 126 ILE H2 H N N 127 ILE HA H N N 128 ILE HB H N N 129 ILE HG12 H N N 130 ILE HG13 H N N 131 ILE HG21 H N N 132 ILE HG22 H N N 133 ILE HG23 H N N 134 ILE HD11 H N N 135 ILE HD12 H N N 136 ILE HD13 H N N 137 ILE HXT H N N 138 LEU N N N N 139 LEU CA C N S 140 LEU C C N N 141 LEU O O N N 142 LEU CB C N N 143 LEU CG C N N 144 LEU CD1 C N N 145 LEU CD2 C N N 146 LEU OXT O N N 147 LEU H H N N 148 LEU H2 H N N 149 LEU HA H N N 150 LEU HB2 H N N 151 LEU HB3 H N N 152 LEU HG H N N 153 LEU HD11 H N N 154 LEU HD12 H N N 155 LEU HD13 H N N 156 LEU HD21 H N N 157 LEU HD22 H N N 158 LEU HD23 H N N 159 LEU HXT H N N 160 LYS N N N N 161 LYS CA C N S 162 LYS C C N N 163 LYS O O N N 164 LYS CB C N N 165 LYS CG C N N 166 LYS CD C N N 167 LYS CE C N N 168 LYS NZ N N N 169 LYS OXT O N N 170 LYS H H N N 171 LYS H2 H N N 172 LYS HA H N N 173 LYS HB2 H N N 174 LYS HB3 H N N 175 LYS HG2 H N N 176 LYS HG3 H N N 177 LYS HD2 H N N 178 LYS HD3 H N N 179 LYS HE2 H N N 180 LYS HE3 H N N 181 LYS HZ1 H N N 182 LYS HZ2 H N N 183 LYS HZ3 H N N 184 LYS HXT H N N 185 MET N N N N 186 MET CA C N S 187 MET C C N N 188 MET O O N N 189 MET CB C N N 190 MET CG C N N 191 MET SD S N N 192 MET CE C N N 193 MET OXT O N N 194 MET H H N N 195 MET H2 H N N 196 MET HA H N N 197 MET HB2 H N N 198 MET HB3 H N N 199 MET HG2 H N N 200 MET HG3 H N N 201 MET HE1 H N N 202 MET HE2 H N N 203 MET HE3 H N N 204 MET HXT H N N 205 PHE N N N N 206 PHE CA C N S 207 PHE C C N N 208 PHE O O N N 209 PHE CB C N N 210 PHE CG C Y N 211 PHE CD1 C Y N 212 PHE CD2 C Y N 213 PHE CE1 C Y N 214 PHE CE2 C Y N 215 PHE CZ C Y N 216 PHE OXT O N N 217 PHE H H N N 218 PHE H2 H N N 219 PHE HA H N N 220 PHE HB2 H N N 221 PHE HB3 H N N 222 PHE HD1 H N N 223 PHE HD2 H N N 224 PHE HE1 H N N 225 PHE HE2 H N N 226 PHE HZ H N N 227 PHE HXT H N N 228 PRO N N N N 229 PRO CA C N S 230 PRO C C N N 231 PRO O O N N 232 PRO CB C N N 233 PRO CG C N N 234 PRO CD C N N 235 PRO OXT O N N 236 PRO H H N N 237 PRO HA H N N 238 PRO HB2 H N N 239 PRO HB3 H N N 240 PRO HG2 H N N 241 PRO HG3 H N N 242 PRO HD2 H N N 243 PRO HD3 H N N 244 PRO HXT H N N 245 SER N N N N 246 SER CA C N S 247 SER C C N N 248 SER O O N N 249 SER CB C N N 250 SER OG O N N 251 SER OXT O N N 252 SER H H N N 253 SER H2 H N N 254 SER HA H N N 255 SER HB2 H N N 256 SER HB3 H N N 257 SER HG H N N 258 SER HXT H N N 259 THR N N N N 260 THR CA C N S 261 THR C C N N 262 THR O O N N 263 THR CB C N R 264 THR OG1 O N N 265 THR CG2 C N N 266 THR OXT O N N 267 THR H H N N 268 THR H2 H N N 269 THR HA H N N 270 THR HB H N N 271 THR HG1 H N N 272 THR HG21 H N N 273 THR HG22 H N N 274 THR HG23 H N N 275 THR HXT H N N 276 TRP N N N N 277 TRP CA C N S 278 TRP C C N N 279 TRP O O N N 280 TRP CB C N N 281 TRP CG C Y N 282 TRP CD1 C Y N 283 TRP CD2 C Y N 284 TRP NE1 N Y N 285 TRP CE2 C Y N 286 TRP CE3 C Y N 287 TRP CZ2 C Y N 288 TRP CZ3 C Y N 289 TRP CH2 C Y N 290 TRP OXT O N N 291 TRP H H N N 292 TRP H2 H N N 293 TRP HA H N N 294 TRP HB2 H N N 295 TRP HB3 H N N 296 TRP HD1 H N N 297 TRP HE1 H N N 298 TRP HE3 H N N 299 TRP HZ2 H N N 300 TRP HZ3 H N N 301 TRP HH2 H N N 302 TRP HXT H N N 303 VAL N N N N 304 VAL CA C N S 305 VAL C C N N 306 VAL O O N N 307 VAL CB C N N 308 VAL CG1 C N N 309 VAL CG2 C N N 310 VAL OXT O N N 311 VAL H H N N 312 VAL H2 H N N 313 VAL HA H N N 314 VAL HB H N N 315 VAL HG11 H N N 316 VAL HG12 H N N 317 VAL HG13 H N N 318 VAL HG21 H N N 319 VAL HG22 H N N 320 VAL HG23 H N N 321 VAL HXT H N N 322 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ASN N CA sing N N 13 ASN N H sing N N 14 ASN N H2 sing N N 15 ASN CA C sing N N 16 ASN CA CB sing N N 17 ASN CA HA sing N N 18 ASN C O doub N N 19 ASN C OXT sing N N 20 ASN CB CG sing N N 21 ASN CB HB2 sing N N 22 ASN CB HB3 sing N N 23 ASN CG OD1 doub N N 24 ASN CG ND2 sing N N 25 ASN ND2 HD21 sing N N 26 ASN ND2 HD22 sing N N 27 ASN OXT HXT sing N N 28 ASP N CA sing N N 29 ASP N H sing N N 30 ASP N H2 sing N N 31 ASP CA C sing N N 32 ASP CA CB sing N N 33 ASP CA HA sing N N 34 ASP C O doub N N 35 ASP C OXT sing N N 36 ASP CB CG sing N N 37 ASP CB HB2 sing N N 38 ASP CB HB3 sing N N 39 ASP CG OD1 doub N N 40 ASP CG OD2 sing N N 41 ASP OD2 HD2 sing N N 42 ASP OXT HXT sing N N 43 GLN N CA sing N N 44 GLN N H sing N N 45 GLN N H2 sing N N 46 GLN CA C sing N N 47 GLN CA CB sing N N 48 GLN CA HA sing N N 49 GLN C O doub N N 50 GLN C OXT sing N N 51 GLN CB CG sing N N 52 GLN CB HB2 sing N N 53 GLN CB HB3 sing N N 54 GLN CG CD sing N N 55 GLN CG HG2 sing N N 56 GLN CG HG3 sing N N 57 GLN CD OE1 doub N N 58 GLN CD NE2 sing N N 59 GLN NE2 HE21 sing N N 60 GLN NE2 HE22 sing N N 61 GLN OXT HXT sing N N 62 GLU N CA sing N N 63 GLU N H sing N N 64 GLU N H2 sing N N 65 GLU CA C sing N N 66 GLU CA CB sing N N 67 GLU CA HA sing N N 68 GLU C O doub N N 69 GLU C OXT sing N N 70 GLU CB CG sing N N 71 GLU CB HB2 sing N N 72 GLU CB HB3 sing N N 73 GLU CG CD sing N N 74 GLU CG HG2 sing N N 75 GLU CG HG3 sing N N 76 GLU CD OE1 doub N N 77 GLU CD OE2 sing N N 78 GLU OE2 HE2 sing N N 79 GLU OXT HXT sing N N 80 GLY N CA sing N N 81 GLY N H sing N N 82 GLY N H2 sing N N 83 GLY CA C sing N N 84 GLY CA HA2 sing N N 85 GLY CA HA3 sing N N 86 GLY C O doub N N 87 GLY C OXT sing N N 88 GLY OXT HXT sing N N 89 HIS N CA sing N N 90 HIS N H sing N N 91 HIS N H2 sing N N 92 HIS CA C sing N N 93 HIS CA CB sing N N 94 HIS CA HA sing N N 95 HIS C O doub N N 96 HIS C OXT sing N N 97 HIS CB CG sing N N 98 HIS CB HB2 sing N N 99 HIS CB HB3 sing N N 100 HIS CG ND1 sing Y N 101 HIS CG CD2 doub Y N 102 HIS ND1 CE1 doub Y N 103 HIS ND1 HD1 sing N N 104 HIS CD2 NE2 sing Y N 105 HIS CD2 HD2 sing N N 106 HIS CE1 NE2 sing Y N 107 HIS CE1 HE1 sing N N 108 HIS NE2 HE2 sing N N 109 HIS OXT HXT sing N N 110 ILE N CA sing N N 111 ILE N H sing N N 112 ILE N H2 sing N N 113 ILE CA C sing N N 114 ILE CA CB sing N N 115 ILE CA HA sing N N 116 ILE C O doub N N 117 ILE C OXT sing N N 118 ILE CB CG1 sing N N 119 ILE CB CG2 sing N N 120 ILE CB HB sing N N 121 ILE CG1 CD1 sing N N 122 ILE CG1 HG12 sing N N 123 ILE CG1 HG13 sing N N 124 ILE CG2 HG21 sing N N 125 ILE CG2 HG22 sing N N 126 ILE CG2 HG23 sing N N 127 ILE CD1 HD11 sing N N 128 ILE CD1 HD12 sing N N 129 ILE CD1 HD13 sing N N 130 ILE OXT HXT sing N N 131 LEU N CA sing N N 132 LEU N H sing N N 133 LEU N H2 sing N N 134 LEU CA C sing N N 135 LEU CA CB sing N N 136 LEU CA HA sing N N 137 LEU C O doub N N 138 LEU C OXT sing N N 139 LEU CB CG sing N N 140 LEU CB HB2 sing N N 141 LEU CB HB3 sing N N 142 LEU CG CD1 sing N N 143 LEU CG CD2 sing N N 144 LEU CG HG sing N N 145 LEU CD1 HD11 sing N N 146 LEU CD1 HD12 sing N N 147 LEU CD1 HD13 sing N N 148 LEU CD2 HD21 sing N N 149 LEU CD2 HD22 sing N N 150 LEU CD2 HD23 sing N N 151 LEU OXT HXT sing N N 152 LYS N CA sing N N 153 LYS N H sing N N 154 LYS N H2 sing N N 155 LYS CA C sing N N 156 LYS CA CB sing N N 157 LYS CA HA sing N N 158 LYS C O doub N N 159 LYS C OXT sing N N 160 LYS CB CG sing N N 161 LYS CB HB2 sing N N 162 LYS CB HB3 sing N N 163 LYS CG CD sing N N 164 LYS CG HG2 sing N N 165 LYS CG HG3 sing N N 166 LYS CD CE sing N N 167 LYS CD HD2 sing N N 168 LYS CD HD3 sing N N 169 LYS CE NZ sing N N 170 LYS CE HE2 sing N N 171 LYS CE HE3 sing N N 172 LYS NZ HZ1 sing N N 173 LYS NZ HZ2 sing N N 174 LYS NZ HZ3 sing N N 175 LYS OXT HXT sing N N 176 MET N CA sing N N 177 MET N H sing N N 178 MET N H2 sing N N 179 MET CA C sing N N 180 MET CA CB sing N N 181 MET CA HA sing N N 182 MET C O doub N N 183 MET C OXT sing N N 184 MET CB CG sing N N 185 MET CB HB2 sing N N 186 MET CB HB3 sing N N 187 MET CG SD sing N N 188 MET CG HG2 sing N N 189 MET CG HG3 sing N N 190 MET SD CE sing N N 191 MET CE HE1 sing N N 192 MET CE HE2 sing N N 193 MET CE HE3 sing N N 194 MET OXT HXT sing N N 195 PHE N CA sing N N 196 PHE N H sing N N 197 PHE N H2 sing N N 198 PHE CA C sing N N 199 PHE CA CB sing N N 200 PHE CA HA sing N N 201 PHE C O doub N N 202 PHE C OXT sing N N 203 PHE CB CG sing N N 204 PHE CB HB2 sing N N 205 PHE CB HB3 sing N N 206 PHE CG CD1 doub Y N 207 PHE CG CD2 sing Y N 208 PHE CD1 CE1 sing Y N 209 PHE CD1 HD1 sing N N 210 PHE CD2 CE2 doub Y N 211 PHE CD2 HD2 sing N N 212 PHE CE1 CZ doub Y N 213 PHE CE1 HE1 sing N N 214 PHE CE2 CZ sing Y N 215 PHE CE2 HE2 sing N N 216 PHE CZ HZ sing N N 217 PHE OXT HXT sing N N 218 PRO N CA sing N N 219 PRO N CD sing N N 220 PRO N H sing N N 221 PRO CA C sing N N 222 PRO CA CB sing N N 223 PRO CA HA sing N N 224 PRO C O doub N N 225 PRO C OXT sing N N 226 PRO CB CG sing N N 227 PRO CB HB2 sing N N 228 PRO CB HB3 sing N N 229 PRO CG CD sing N N 230 PRO CG HG2 sing N N 231 PRO CG HG3 sing N N 232 PRO CD HD2 sing N N 233 PRO CD HD3 sing N N 234 PRO OXT HXT sing N N 235 SER N CA sing N N 236 SER N H sing N N 237 SER N H2 sing N N 238 SER CA C sing N N 239 SER CA CB sing N N 240 SER CA HA sing N N 241 SER C O doub N N 242 SER C OXT sing N N 243 SER CB OG sing N N 244 SER CB HB2 sing N N 245 SER CB HB3 sing N N 246 SER OG HG sing N N 247 SER OXT HXT sing N N 248 THR N CA sing N N 249 THR N H sing N N 250 THR N H2 sing N N 251 THR CA C sing N N 252 THR CA CB sing N N 253 THR CA HA sing N N 254 THR C O doub N N 255 THR C OXT sing N N 256 THR CB OG1 sing N N 257 THR CB CG2 sing N N 258 THR CB HB sing N N 259 THR OG1 HG1 sing N N 260 THR CG2 HG21 sing N N 261 THR CG2 HG22 sing N N 262 THR CG2 HG23 sing N N 263 THR OXT HXT sing N N 264 TRP N CA sing N N 265 TRP N H sing N N 266 TRP N H2 sing N N 267 TRP CA C sing N N 268 TRP CA CB sing N N 269 TRP CA HA sing N N 270 TRP C O doub N N 271 TRP C OXT sing N N 272 TRP CB CG sing N N 273 TRP CB HB2 sing N N 274 TRP CB HB3 sing N N 275 TRP CG CD1 doub Y N 276 TRP CG CD2 sing Y N 277 TRP CD1 NE1 sing Y N 278 TRP CD1 HD1 sing N N 279 TRP CD2 CE2 doub Y N 280 TRP CD2 CE3 sing Y N 281 TRP NE1 CE2 sing Y N 282 TRP NE1 HE1 sing N N 283 TRP CE2 CZ2 sing Y N 284 TRP CE3 CZ3 doub Y N 285 TRP CE3 HE3 sing N N 286 TRP CZ2 CH2 doub Y N 287 TRP CZ2 HZ2 sing N N 288 TRP CZ3 CH2 sing Y N 289 TRP CZ3 HZ3 sing N N 290 TRP CH2 HH2 sing N N 291 TRP OXT HXT sing N N 292 VAL N CA sing N N 293 VAL N H sing N N 294 VAL N H2 sing N N 295 VAL CA C sing N N 296 VAL CA CB sing N N 297 VAL CA HA sing N N 298 VAL C O doub N N 299 VAL C OXT sing N N 300 VAL CB CG1 sing N N 301 VAL CB CG2 sing N N 302 VAL CB HB sing N N 303 VAL CG1 HG11 sing N N 304 VAL CG1 HG12 sing N N 305 VAL CG1 HG13 sing N N 306 VAL CG2 HG21 sing N N 307 VAL CG2 HG22 sing N N 308 VAL CG2 HG23 sing N N 309 VAL OXT HXT sing N N 310 # _pdbx_audit_support.funding_organization 'National Natural Science Foundation of China (NSFC)' _pdbx_audit_support.country China _pdbx_audit_support.grant_number 82172299 _pdbx_audit_support.ordinal 1 # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model 'AVANCE III' _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 600 _pdbx_nmr_spectrometer.details ? # _atom_sites.entry_id 8WRG _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C H N O S # loop_ #