data_8XHM # _entry.id 8XHM # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.398 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 8XHM pdb_00008xhm 10.2210/pdb8xhm/pdb WWPDB D_1300043531 ? ? # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2024-11-13 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 8XHM _pdbx_database_status.recvd_initial_deposition_date 2023-12-18 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_contact_author.id 2 _pdbx_contact_author.email weizigong@163.com _pdbx_contact_author.name_first Zigong _pdbx_contact_author.name_last Wei _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-2445-6171 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Weng, J.' 1 0000-0002-8295-3459 'Wei, Z.' 2 0000-0002-2445-6171 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'J Enzyme Inhib Med Chem' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 1475-6374 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 39 _citation.language ? _citation.page_first 2411573 _citation.page_last 2411573 _citation.title 'Structure-guided discovery of novel dUTPase inhibitors with anti- Nocardia activity by computational design.' _citation.year 2024 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1080/14756366.2024.2411573 _citation.pdbx_database_id_PubMed 39390714 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Wang, Z.Z.' 1 ? primary 'Weng, J.' 2 ? primary 'Qi, J.' 3 ? primary 'Fu, X.X.' 4 ? primary 'Xing, B.B.' 5 ? primary 'Hu, Y.' 6 ? primary 'Huang, C.H.' 7 ? primary 'Chen, C.Y.' 8 ? primary 'Wei, Z.' 9 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man ;Deoxyuridine 5'-triphosphate nucleotidohydrolase ; 19699.186 1 3.6.1.23 ? ? ? 2 non-polymer syn ;2'-DEOXYURIDINE 5'-MONOPHOSPHATE ; 308.182 1 ? ? ? ? 3 non-polymer syn 'PHOSPHATE ION' 94.971 1 ? ? ? ? 4 non-polymer syn 2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL 122.143 2 ? ? ? ? 5 non-polymer syn 'DI(HYDROXYETHYL)ETHER' 106.120 2 ? ? ? ? 6 water nat water 18.015 45 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'dUTPase,dUTP pyrophosphatase' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MTGIPPIPLLRLDPGIPVPVRAHEGDAGVDLCTTEDVIIEPGERVLVGTGIAVALPIGTVGLIHPRSGLAAKAGLSVVNT PGTVDAGYRGEIKVCLINHDPRAAIELRRGDRIAQLLVQKVELVDFVEVETLDETARGAGGYGSSGGHASLAAQSGGAGQ ATGKEAGGGGSLEVLFQGPGGGGSLEVDHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MTGIPPIPLLRLDPGIPVPVRAHEGDAGVDLCTTEDVIIEPGERVLVGTGIAVALPIGTVGLIHPRSGLAAKAGLSVVNT PGTVDAGYRGEIKVCLINHDPRAAIELRRGDRIAQLLVQKVELVDFVEVETLDETARGAGGYGSSGGHASLAAQSGGAGQ ATGKEAGGGGSLEVLFQGPGGGGSLEVDHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 ;2'-DEOXYURIDINE 5'-MONOPHOSPHATE ; UMP 3 'PHOSPHATE ION' PO4 4 2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL TRS 5 'DI(HYDROXYETHYL)ETHER' PEG 6 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 THR n 1 3 GLY n 1 4 ILE n 1 5 PRO n 1 6 PRO n 1 7 ILE n 1 8 PRO n 1 9 LEU n 1 10 LEU n 1 11 ARG n 1 12 LEU n 1 13 ASP n 1 14 PRO n 1 15 GLY n 1 16 ILE n 1 17 PRO n 1 18 VAL n 1 19 PRO n 1 20 VAL n 1 21 ARG n 1 22 ALA n 1 23 HIS n 1 24 GLU n 1 25 GLY n 1 26 ASP n 1 27 ALA n 1 28 GLY n 1 29 VAL n 1 30 ASP n 1 31 LEU n 1 32 CYS n 1 33 THR n 1 34 THR n 1 35 GLU n 1 36 ASP n 1 37 VAL n 1 38 ILE n 1 39 ILE n 1 40 GLU n 1 41 PRO n 1 42 GLY n 1 43 GLU n 1 44 ARG n 1 45 VAL n 1 46 LEU n 1 47 VAL n 1 48 GLY n 1 49 THR n 1 50 GLY n 1 51 ILE n 1 52 ALA n 1 53 VAL n 1 54 ALA n 1 55 LEU n 1 56 PRO n 1 57 ILE n 1 58 GLY n 1 59 THR n 1 60 VAL n 1 61 GLY n 1 62 LEU n 1 63 ILE n 1 64 HIS n 1 65 PRO n 1 66 ARG n 1 67 SER n 1 68 GLY n 1 69 LEU n 1 70 ALA n 1 71 ALA n 1 72 LYS n 1 73 ALA n 1 74 GLY n 1 75 LEU n 1 76 SER n 1 77 VAL n 1 78 VAL n 1 79 ASN n 1 80 THR n 1 81 PRO n 1 82 GLY n 1 83 THR n 1 84 VAL n 1 85 ASP n 1 86 ALA n 1 87 GLY n 1 88 TYR n 1 89 ARG n 1 90 GLY n 1 91 GLU n 1 92 ILE n 1 93 LYS n 1 94 VAL n 1 95 CYS n 1 96 LEU n 1 97 ILE n 1 98 ASN n 1 99 HIS n 1 100 ASP n 1 101 PRO n 1 102 ARG n 1 103 ALA n 1 104 ALA n 1 105 ILE n 1 106 GLU n 1 107 LEU n 1 108 ARG n 1 109 ARG n 1 110 GLY n 1 111 ASP n 1 112 ARG n 1 113 ILE n 1 114 ALA n 1 115 GLN n 1 116 LEU n 1 117 LEU n 1 118 VAL n 1 119 GLN n 1 120 LYS n 1 121 VAL n 1 122 GLU n 1 123 LEU n 1 124 VAL n 1 125 ASP n 1 126 PHE n 1 127 VAL n 1 128 GLU n 1 129 VAL n 1 130 GLU n 1 131 THR n 1 132 LEU n 1 133 ASP n 1 134 GLU n 1 135 THR n 1 136 ALA n 1 137 ARG n 1 138 GLY n 1 139 ALA n 1 140 GLY n 1 141 GLY n 1 142 TYR n 1 143 GLY n 1 144 SER n 1 145 SER n 1 146 GLY n 1 147 GLY n 1 148 HIS n 1 149 ALA n 1 150 SER n 1 151 LEU n 1 152 ALA n 1 153 ALA n 1 154 GLN n 1 155 SER n 1 156 GLY n 1 157 GLY n 1 158 ALA n 1 159 GLY n 1 160 GLN n 1 161 ALA n 1 162 THR n 1 163 GLY n 1 164 LYS n 1 165 GLU n 1 166 ALA n 1 167 GLY n 1 168 GLY n 1 169 GLY n 1 170 GLY n 1 171 SER n 1 172 LEU n 1 173 GLU n 1 174 VAL n 1 175 LEU n 1 176 PHE n 1 177 GLN n 1 178 GLY n 1 179 PRO n 1 180 GLY n 1 181 GLY n 1 182 GLY n 1 183 GLY n 1 184 SER n 1 185 LEU n 1 186 GLU n 1 187 VAL n 1 188 ASP n 1 189 HIS n 1 190 HIS n 1 191 HIS n 1 192 HIS n 1 193 HIS n 1 194 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 194 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'dut, D6158_15615, NS07_v2contig00045-0031, NS506_05871' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Nocardia seriolae' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 37332 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 511693 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PEG non-polymer . 'DI(HYDROXYETHYL)ETHER' ? 'C4 H10 O3' 106.120 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PO4 non-polymer . 'PHOSPHATE ION' ? 'O4 P -3' 94.971 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRS non-polymer . 2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL 'TRIS BUFFER' 'C4 H12 N O3 1' 122.143 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 UMP non-polymer . ;2'-DEOXYURIDINE 5'-MONOPHOSPHATE ; DUMP 'C9 H13 N2 O8 P' 308.182 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 THR 2 2 ? ? ? A . n A 1 3 GLY 3 3 ? ? ? A . n A 1 4 ILE 4 4 4 ILE ILE A . n A 1 5 PRO 5 5 5 PRO PRO A . n A 1 6 PRO 6 6 6 PRO PRO A . n A 1 7 ILE 7 7 7 ILE ILE A . n A 1 8 PRO 8 8 8 PRO PRO A . n A 1 9 LEU 9 9 9 LEU LEU A . n A 1 10 LEU 10 10 10 LEU LEU A . n A 1 11 ARG 11 11 11 ARG ARG A . n A 1 12 LEU 12 12 12 LEU LEU A . n A 1 13 ASP 13 13 13 ASP ASP A . n A 1 14 PRO 14 14 14 PRO PRO A . n A 1 15 GLY 15 15 15 GLY GLY A . n A 1 16 ILE 16 16 16 ILE ILE A . n A 1 17 PRO 17 17 17 PRO PRO A . n A 1 18 VAL 18 18 18 VAL VAL A . n A 1 19 PRO 19 19 19 PRO PRO A . n A 1 20 VAL 20 20 20 VAL VAL A . n A 1 21 ARG 21 21 21 ARG ARG A . n A 1 22 ALA 22 22 22 ALA ALA A . n A 1 23 HIS 23 23 23 HIS HIS A . n A 1 24 GLU 24 24 24 GLU GLU A . n A 1 25 GLY 25 25 25 GLY GLY A . n A 1 26 ASP 26 26 26 ASP ASP A . n A 1 27 ALA 27 27 27 ALA ALA A . n A 1 28 GLY 28 28 28 GLY GLY A . n A 1 29 VAL 29 29 29 VAL VAL A . n A 1 30 ASP 30 30 30 ASP ASP A . n A 1 31 LEU 31 31 31 LEU LEU A . n A 1 32 CYS 32 32 32 CYS CYS A . n A 1 33 THR 33 33 33 THR THR A . n A 1 34 THR 34 34 34 THR THR A . n A 1 35 GLU 35 35 35 GLU GLU A . n A 1 36 ASP 36 36 36 ASP ASP A . n A 1 37 VAL 37 37 37 VAL VAL A . n A 1 38 ILE 38 38 38 ILE ILE A . n A 1 39 ILE 39 39 39 ILE ILE A . n A 1 40 GLU 40 40 40 GLU GLU A . n A 1 41 PRO 41 41 41 PRO PRO A . n A 1 42 GLY 42 42 42 GLY GLY A . n A 1 43 GLU 43 43 43 GLU GLU A . n A 1 44 ARG 44 44 44 ARG ARG A . n A 1 45 VAL 45 45 45 VAL VAL A . n A 1 46 LEU 46 46 46 LEU LEU A . n A 1 47 VAL 47 47 47 VAL VAL A . n A 1 48 GLY 48 48 48 GLY GLY A . n A 1 49 THR 49 49 49 THR THR A . n A 1 50 GLY 50 50 50 GLY GLY A . n A 1 51 ILE 51 51 51 ILE ILE A . n A 1 52 ALA 52 52 52 ALA ALA A . n A 1 53 VAL 53 53 53 VAL VAL A . n A 1 54 ALA 54 54 54 ALA ALA A . n A 1 55 LEU 55 55 55 LEU LEU A . n A 1 56 PRO 56 56 56 PRO PRO A . n A 1 57 ILE 57 57 57 ILE ILE A . n A 1 58 GLY 58 58 58 GLY GLY A . n A 1 59 THR 59 59 59 THR THR A . n A 1 60 VAL 60 60 60 VAL VAL A . n A 1 61 GLY 61 61 61 GLY GLY A . n A 1 62 LEU 62 62 62 LEU LEU A . n A 1 63 ILE 63 63 63 ILE ILE A . n A 1 64 HIS 64 64 64 HIS HIS A . n A 1 65 PRO 65 65 65 PRO PRO A . n A 1 66 ARG 66 66 66 ARG ARG A . n A 1 67 SER 67 67 67 SER SER A . n A 1 68 GLY 68 68 68 GLY GLY A . n A 1 69 LEU 69 69 69 LEU LEU A . n A 1 70 ALA 70 70 70 ALA ALA A . n A 1 71 ALA 71 71 71 ALA ALA A . n A 1 72 LYS 72 72 72 LYS LYS A . n A 1 73 ALA 73 73 73 ALA ALA A . n A 1 74 GLY 74 74 74 GLY GLY A . n A 1 75 LEU 75 75 75 LEU LEU A . n A 1 76 SER 76 76 76 SER SER A . n A 1 77 VAL 77 77 77 VAL VAL A . n A 1 78 VAL 78 78 78 VAL VAL A . n A 1 79 ASN 79 79 79 ASN ASN A . n A 1 80 THR 80 80 80 THR THR A . n A 1 81 PRO 81 81 81 PRO PRO A . n A 1 82 GLY 82 82 82 GLY GLY A . n A 1 83 THR 83 83 83 THR THR A . n A 1 84 VAL 84 84 84 VAL VAL A . n A 1 85 ASP 85 85 85 ASP ASP A . n A 1 86 ALA 86 86 86 ALA ALA A . n A 1 87 GLY 87 87 87 GLY GLY A . n A 1 88 TYR 88 88 88 TYR TYR A . n A 1 89 ARG 89 89 89 ARG ARG A . n A 1 90 GLY 90 90 90 GLY GLY A . n A 1 91 GLU 91 91 91 GLU GLU A . n A 1 92 ILE 92 92 92 ILE ILE A . n A 1 93 LYS 93 93 93 LYS LYS A . n A 1 94 VAL 94 94 94 VAL VAL A . n A 1 95 CYS 95 95 95 CYS CYS A . n A 1 96 LEU 96 96 96 LEU LEU A . n A 1 97 ILE 97 97 97 ILE ILE A . n A 1 98 ASN 98 98 98 ASN ASN A . n A 1 99 HIS 99 99 99 HIS HIS A . n A 1 100 ASP 100 100 100 ASP ASP A . n A 1 101 PRO 101 101 101 PRO PRO A . n A 1 102 ARG 102 102 102 ARG ARG A . n A 1 103 ALA 103 103 103 ALA ALA A . n A 1 104 ALA 104 104 104 ALA ALA A . n A 1 105 ILE 105 105 105 ILE ILE A . n A 1 106 GLU 106 106 106 GLU GLU A . n A 1 107 LEU 107 107 107 LEU LEU A . n A 1 108 ARG 108 108 108 ARG ARG A . n A 1 109 ARG 109 109 109 ARG ARG A . n A 1 110 GLY 110 110 110 GLY GLY A . n A 1 111 ASP 111 111 111 ASP ASP A . n A 1 112 ARG 112 112 112 ARG ARG A . n A 1 113 ILE 113 113 113 ILE ILE A . n A 1 114 ALA 114 114 114 ALA ALA A . n A 1 115 GLN 115 115 115 GLN GLN A . n A 1 116 LEU 116 116 116 LEU LEU A . n A 1 117 LEU 117 117 117 LEU LEU A . n A 1 118 VAL 118 118 118 VAL VAL A . n A 1 119 GLN 119 119 119 GLN GLN A . n A 1 120 LYS 120 120 120 LYS LYS A . n A 1 121 VAL 121 121 121 VAL VAL A . n A 1 122 GLU 122 122 122 GLU GLU A . n A 1 123 LEU 123 123 123 LEU LEU A . n A 1 124 VAL 124 124 124 VAL VAL A . n A 1 125 ASP 125 125 125 ASP ASP A . n A 1 126 PHE 126 126 126 PHE PHE A . n A 1 127 VAL 127 127 127 VAL VAL A . n A 1 128 GLU 128 128 128 GLU GLU A . n A 1 129 VAL 129 129 129 VAL VAL A . n A 1 130 GLU 130 130 130 GLU GLU A . n A 1 131 THR 131 131 131 THR THR A . n A 1 132 LEU 132 132 132 LEU LEU A . n A 1 133 ASP 133 133 133 ASP ASP A . n A 1 134 GLU 134 134 134 GLU GLU A . n A 1 135 THR 135 135 135 THR THR A . n A 1 136 ALA 136 136 136 ALA ALA A . n A 1 137 ARG 137 137 137 ARG ARG A . n A 1 138 GLY 138 138 138 GLY GLY A . n A 1 139 ALA 139 139 139 ALA ALA A . n A 1 140 GLY 140 140 140 GLY GLY A . n A 1 141 GLY 141 141 141 GLY GLY A . n A 1 142 TYR 142 142 142 TYR TYR A . n A 1 143 GLY 143 143 143 GLY GLY A . n A 1 144 SER 144 144 ? ? ? A . n A 1 145 SER 145 145 ? ? ? A . n A 1 146 GLY 146 146 ? ? ? A . n A 1 147 GLY 147 147 ? ? ? A . n A 1 148 HIS 148 148 ? ? ? A . n A 1 149 ALA 149 149 ? ? ? A . n A 1 150 SER 150 150 ? ? ? A . n A 1 151 LEU 151 151 ? ? ? A . n A 1 152 ALA 152 152 ? ? ? A . n A 1 153 ALA 153 153 ? ? ? A . n A 1 154 GLN 154 154 ? ? ? A . n A 1 155 SER 155 155 ? ? ? A . n A 1 156 GLY 156 156 ? ? ? A . n A 1 157 GLY 157 157 ? ? ? A . n A 1 158 ALA 158 158 ? ? ? A . n A 1 159 GLY 159 159 ? ? ? A . n A 1 160 GLN 160 160 ? ? ? A . n A 1 161 ALA 161 161 ? ? ? A . n A 1 162 THR 162 162 ? ? ? A . n A 1 163 GLY 163 163 ? ? ? A . n A 1 164 LYS 164 164 ? ? ? A . n A 1 165 GLU 165 165 ? ? ? A . n A 1 166 ALA 166 166 ? ? ? A . n A 1 167 GLY 167 167 ? ? ? A . n A 1 168 GLY 168 168 ? ? ? A . n A 1 169 GLY 169 169 ? ? ? A . n A 1 170 GLY 170 170 ? ? ? A . n A 1 171 SER 171 171 ? ? ? A . n A 1 172 LEU 172 172 ? ? ? A . n A 1 173 GLU 173 173 ? ? ? A . n A 1 174 VAL 174 174 ? ? ? A . n A 1 175 LEU 175 175 ? ? ? A . n A 1 176 PHE 176 176 ? ? ? A . n A 1 177 GLN 177 177 ? ? ? A . n A 1 178 GLY 178 178 ? ? ? A . n A 1 179 PRO 179 179 ? ? ? A . n A 1 180 GLY 180 180 ? ? ? A . n A 1 181 GLY 181 181 ? ? ? A . n A 1 182 GLY 182 182 ? ? ? A . n A 1 183 GLY 183 183 ? ? ? A . n A 1 184 SER 184 184 ? ? ? A . n A 1 185 LEU 185 185 ? ? ? A . n A 1 186 GLU 186 186 ? ? ? A . n A 1 187 VAL 187 187 ? ? ? A . n A 1 188 ASP 188 188 ? ? ? A . n A 1 189 HIS 189 189 ? ? ? A . n A 1 190 HIS 190 190 ? ? ? A . n A 1 191 HIS 191 191 ? ? ? A . n A 1 192 HIS 192 192 ? ? ? A . n A 1 193 HIS 193 193 ? ? ? A . n A 1 194 HIS 194 194 ? ? ? A . n # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id UMP _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id UMP _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 UMP 1 301 301 UMP UMP A . C 3 PO4 1 302 302 PO4 PO4 A . D 4 TRS 1 303 303 TRS TRS A . E 5 PEG 1 304 304 PEG PEG A . F 5 PEG 1 305 305 PEG PEG A . G 4 TRS 1 306 306 TRS TRS A . H 6 HOH 1 401 29 HOH HOH A . H 6 HOH 2 402 9 HOH HOH A . H 6 HOH 3 403 23 HOH HOH A . H 6 HOH 4 404 39 HOH HOH A . H 6 HOH 5 405 19 HOH HOH A . H 6 HOH 6 406 15 HOH HOH A . H 6 HOH 7 407 17 HOH HOH A . H 6 HOH 8 408 2 HOH HOH A . H 6 HOH 9 409 14 HOH HOH A . H 6 HOH 10 410 7 HOH HOH A . H 6 HOH 11 411 1 HOH HOH A . H 6 HOH 12 412 28 HOH HOH A . H 6 HOH 13 413 8 HOH HOH A . H 6 HOH 14 414 32 HOH HOH A . H 6 HOH 15 415 18 HOH HOH A . H 6 HOH 16 416 27 HOH HOH A . H 6 HOH 17 417 5 HOH HOH A . H 6 HOH 18 418 6 HOH HOH A . H 6 HOH 19 419 3 HOH HOH A . H 6 HOH 20 420 34 HOH HOH A . H 6 HOH 21 421 4 HOH HOH A . H 6 HOH 22 422 42 HOH HOH A . H 6 HOH 23 423 22 HOH HOH A . H 6 HOH 24 424 37 HOH HOH A . H 6 HOH 25 425 11 HOH HOH A . H 6 HOH 26 426 13 HOH HOH A . H 6 HOH 27 427 21 HOH HOH A . H 6 HOH 28 428 10 HOH HOH A . H 6 HOH 29 429 36 HOH HOH A . H 6 HOH 30 430 40 HOH HOH A . H 6 HOH 31 431 24 HOH HOH A . H 6 HOH 32 432 45 HOH HOH A . H 6 HOH 33 433 25 HOH HOH A . H 6 HOH 34 434 41 HOH HOH A . H 6 HOH 35 435 31 HOH HOH A . H 6 HOH 36 436 33 HOH HOH A . H 6 HOH 37 437 35 HOH HOH A . H 6 HOH 38 438 16 HOH HOH A . H 6 HOH 39 439 12 HOH HOH A . H 6 HOH 40 440 44 HOH HOH A . H 6 HOH 41 441 38 HOH HOH A . H 6 HOH 42 442 30 HOH HOH A . H 6 HOH 43 443 20 HOH HOH A . H 6 HOH 44 444 43 HOH HOH A . H 6 HOH 45 445 26 HOH HOH A . # _pdbx_unobs_or_zero_occ_atoms.id 1 _pdbx_unobs_or_zero_occ_atoms.PDB_model_num 1 _pdbx_unobs_or_zero_occ_atoms.polymer_flag N _pdbx_unobs_or_zero_occ_atoms.occupancy_flag 0 _pdbx_unobs_or_zero_occ_atoms.auth_asym_id A _pdbx_unobs_or_zero_occ_atoms.auth_comp_id TRS _pdbx_unobs_or_zero_occ_atoms.auth_seq_id 303 _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code ? _pdbx_unobs_or_zero_occ_atoms.auth_atom_id O2 _pdbx_unobs_or_zero_occ_atoms.label_alt_id ? _pdbx_unobs_or_zero_occ_atoms.label_asym_id D _pdbx_unobs_or_zero_occ_atoms.label_comp_id TRS _pdbx_unobs_or_zero_occ_atoms.label_seq_id ? _pdbx_unobs_or_zero_occ_atoms.label_atom_id O2 # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? '(1.20.1_4487: ???)' 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 8XHM _cell.details ? _cell.formula_units_Z ? _cell.length_a 120.807 _cell.length_a_esd ? _cell.length_b 120.807 _cell.length_b_esd ? _cell.length_c 120.807 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 24 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 8XHM _symmetry.cell_setting ? _symmetry.Int_Tables_number 213 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 41 3 2' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 8XHM _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 3.73 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 67.5 _exptl_crystal.description 'clear cubic crystal' _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 8.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details 'Diffractable crystals grew in 25% (w/v) polyethylene glycol 3350, 0.1 M Tris-HCl pH 8.5 at 293 K.' _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 293 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER2 X 16M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2023-04-14 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.976 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'NSRRC BEAMLINE TPS 07A' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.976 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 'TPS 07A' _diffrn_source.pdbx_synchrotron_site NSRRC # _reflns.B_iso_Wilson_estimate 52.7 _reflns.entry_id 8XHM _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.12 _reflns.d_resolution_low 29.3 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 17649 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.8 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 50.7 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 36.67 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.076 _reflns.pdbx_Rpim_I_all 0.011 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 1.0 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs 0.075 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 2.12 _reflns_shell.d_res_low 2.196 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 3.35 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 1723 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.936 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.percent_possible_all 98.8 _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean ? _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 8XHM _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.12 _refine.ls_d_res_low 29.30 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 17649 _refine.ls_number_reflns_R_free 882 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.8 _refine.ls_percent_reflns_R_free 5.00 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1868 _refine.ls_R_factor_R_free 0.2053 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1859 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.36 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 1SIX _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.10 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 21.91 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.19 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 2.12 _refine_hist.d_res_low 29.30 _refine_hist.number_atoms_solvent 45 _refine_hist.number_atoms_total 1127 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 1027 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 55 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.007 ? 1094 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.909 ? 1489 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 6.404 ? 166 ? f_dihedral_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.064 ? 177 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.009 ? 190 ? f_plane_restr ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free _refine_ls_shell.R_factor_R_free 'X-RAY DIFFRACTION' 2.12 2.25 . . 142 2703 99.00 . . . . 0.2290 . . . . . . . . . . . 0.2621 'X-RAY DIFFRACTION' 2.25 2.43 . . 144 2733 100.00 . . . . 0.2125 . . . . . . . . . . . 0.2184 'X-RAY DIFFRACTION' 2.43 2.67 . . 145 2752 100.00 . . . . 0.2332 . . . . . . . . . . . 0.2777 'X-RAY DIFFRACTION' 2.67 3.06 . . 146 2773 100.00 . . . . 0.2288 . . . . . . . . . . . 0.2478 'X-RAY DIFFRACTION' 3.06 3.85 . . 148 2817 100.00 . . . . 0.1995 . . . . . . . . . . . 0.2069 'X-RAY DIFFRACTION' 3.85 29.30 . . 157 2989 100.00 . . . . 0.1557 . . . . . . . . . . . 0.1767 # _struct.entry_id 8XHM _struct.title 'Crystal structure of Nocardia seriolae dUTP diphosphatase' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 8XHM _struct_keywords.text 'Nocardia seriolae, dUTP diphosphatase, HYDROLASE, dUMP' _struct_keywords.pdbx_keywords HYDROLASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? E N N 5 ? F N N 5 ? G N N 4 ? H N N 6 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code A0A0B8NBT7_9NOCA _struct_ref.pdbx_db_accession A0A0B8NBT7 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MTGIPPIPLLRLDPGIPVPVRAHEGDAGVDLCTTEDVIIEPGERVLVGTGIAVALPIGTVGLIHPRSGLAAKAGLSVVNT PGTVDAGYRGEIKVCLINHDPRAAIELRRGDRIAQLLVQKVELVDFVEVETLDETARGAGGYGSSGGHASLAAQSGGAGQ ATGKEA ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 8XHM _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 166 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession A0A0B8NBT7 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 166 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 166 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 8XHM GLY A 167 ? UNP A0A0B8NBT7 ? ? 'expression tag' 167 1 1 8XHM GLY A 168 ? UNP A0A0B8NBT7 ? ? 'expression tag' 168 2 1 8XHM GLY A 169 ? UNP A0A0B8NBT7 ? ? 'expression tag' 169 3 1 8XHM GLY A 170 ? UNP A0A0B8NBT7 ? ? 'expression tag' 170 4 1 8XHM SER A 171 ? UNP A0A0B8NBT7 ? ? 'expression tag' 171 5 1 8XHM LEU A 172 ? UNP A0A0B8NBT7 ? ? 'expression tag' 172 6 1 8XHM GLU A 173 ? UNP A0A0B8NBT7 ? ? 'expression tag' 173 7 1 8XHM VAL A 174 ? UNP A0A0B8NBT7 ? ? 'expression tag' 174 8 1 8XHM LEU A 175 ? UNP A0A0B8NBT7 ? ? 'expression tag' 175 9 1 8XHM PHE A 176 ? UNP A0A0B8NBT7 ? ? 'expression tag' 176 10 1 8XHM GLN A 177 ? UNP A0A0B8NBT7 ? ? 'expression tag' 177 11 1 8XHM GLY A 178 ? UNP A0A0B8NBT7 ? ? 'expression tag' 178 12 1 8XHM PRO A 179 ? UNP A0A0B8NBT7 ? ? 'expression tag' 179 13 1 8XHM GLY A 180 ? UNP A0A0B8NBT7 ? ? 'expression tag' 180 14 1 8XHM GLY A 181 ? UNP A0A0B8NBT7 ? ? 'expression tag' 181 15 1 8XHM GLY A 182 ? UNP A0A0B8NBT7 ? ? 'expression tag' 182 16 1 8XHM GLY A 183 ? UNP A0A0B8NBT7 ? ? 'expression tag' 183 17 1 8XHM SER A 184 ? UNP A0A0B8NBT7 ? ? 'expression tag' 184 18 1 8XHM LEU A 185 ? UNP A0A0B8NBT7 ? ? 'expression tag' 185 19 1 8XHM GLU A 186 ? UNP A0A0B8NBT7 ? ? 'expression tag' 186 20 1 8XHM VAL A 187 ? UNP A0A0B8NBT7 ? ? 'expression tag' 187 21 1 8XHM ASP A 188 ? UNP A0A0B8NBT7 ? ? 'expression tag' 188 22 1 8XHM HIS A 189 ? UNP A0A0B8NBT7 ? ? 'expression tag' 189 23 1 8XHM HIS A 190 ? UNP A0A0B8NBT7 ? ? 'expression tag' 190 24 1 8XHM HIS A 191 ? UNP A0A0B8NBT7 ? ? 'expression tag' 191 25 1 8XHM HIS A 192 ? UNP A0A0B8NBT7 ? ? 'expression tag' 192 26 1 8XHM HIS A 193 ? UNP A0A0B8NBT7 ? ? 'expression tag' 193 27 1 8XHM HIS A 194 ? UNP A0A0B8NBT7 ? ? 'expression tag' 194 28 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details trimeric _pdbx_struct_assembly.oligomeric_count 3 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 18770 ? 1 MORE -37 ? 1 'SSA (A^2)' 15090 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2,3 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F,G,H # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 5_555 z,x,y 0.0000000000 0.0000000000 1.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 3 'crystal symmetry operation' 9_555 y,z,x 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id AA1 _struct_conf.beg_label_comp_id ARG _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 66 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id GLY _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 74 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id ARG _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 66 _struct_conf.end_auth_comp_id GLY _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 74 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 9 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id THR _struct_mon_prot_cis.label_seq_id 80 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id THR _struct_mon_prot_cis.auth_seq_id 80 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 81 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 81 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle -7.39 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 2 ? AA2 ? 4 ? AA3 ? 2 ? AA4 ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel AA3 1 2 ? anti-parallel AA4 1 2 ? anti-parallel AA4 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 LEU A 9 ? ARG A 11 ? LEU A 9 ARG A 11 AA1 2 ILE A 51 ? VAL A 53 ? ILE A 51 VAL A 53 AA2 1 GLY A 28 ? CYS A 32 ? GLY A 28 CYS A 32 AA2 2 ARG A 112 ? LYS A 120 ? ARG A 112 LYS A 120 AA2 3 THR A 59 ? PRO A 65 ? THR A 59 PRO A 65 AA2 4 GLY A 82 ? VAL A 84 ? GLY A 82 VAL A 84 AA3 1 VAL A 37 ? ILE A 39 ? VAL A 37 ILE A 39 AA3 2 ILE A 105 ? LEU A 107 ? ILE A 105 LEU A 107 AA4 1 ARG A 44 ? GLY A 48 ? ARG A 44 GLY A 48 AA4 2 LYS A 93 ? ASN A 98 ? LYS A 93 ASN A 98 AA4 3 LEU A 75 ? VAL A 77 ? LEU A 75 VAL A 77 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N LEU A 10 ? N LEU A 10 O ALA A 52 ? O ALA A 52 AA2 1 2 N VAL A 29 ? N VAL A 29 O LEU A 116 ? O LEU A 116 AA2 2 3 O GLN A 115 ? O GLN A 115 N HIS A 64 ? N HIS A 64 AA2 3 4 N GLY A 61 ? N GLY A 61 O VAL A 84 ? O VAL A 84 AA3 1 2 N ILE A 39 ? N ILE A 39 O ILE A 105 ? O ILE A 105 AA4 1 2 N VAL A 47 ? N VAL A 47 O VAL A 94 ? O VAL A 94 AA4 2 3 O ILE A 97 ? O ILE A 97 N SER A 76 ? N SER A 76 # _pdbx_entry_details.entry_id 8XHM _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_protein_modification N # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 O2 _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 TRS _pdbx_validate_close_contact.auth_seq_id_1 303 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 O _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 HOH _pdbx_validate_close_contact.auth_seq_id_2 401 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 2.12 # loop_ _pdbx_struct_special_symmetry.id _pdbx_struct_special_symmetry.PDB_model_num _pdbx_struct_special_symmetry.auth_asym_id _pdbx_struct_special_symmetry.auth_comp_id _pdbx_struct_special_symmetry.auth_seq_id _pdbx_struct_special_symmetry.PDB_ins_code _pdbx_struct_special_symmetry.label_asym_id _pdbx_struct_special_symmetry.label_comp_id _pdbx_struct_special_symmetry.label_seq_id 1 1 A PO4 302 ? C PO4 . 2 1 A PO4 302 ? C PO4 . 3 1 A TRS 306 ? G TRS . 4 1 A TRS 306 ? G TRS . 5 1 A HOH 443 ? H HOH . 6 1 A HOH 445 ? H HOH . # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A THR 2 ? A THR 2 3 1 Y 1 A GLY 3 ? A GLY 3 4 1 Y 1 A SER 144 ? A SER 144 5 1 Y 1 A SER 145 ? A SER 145 6 1 Y 1 A GLY 146 ? A GLY 146 7 1 Y 1 A GLY 147 ? A GLY 147 8 1 Y 1 A HIS 148 ? A HIS 148 9 1 Y 1 A ALA 149 ? A ALA 149 10 1 Y 1 A SER 150 ? A SER 150 11 1 Y 1 A LEU 151 ? A LEU 151 12 1 Y 1 A ALA 152 ? A ALA 152 13 1 Y 1 A ALA 153 ? A ALA 153 14 1 Y 1 A GLN 154 ? A GLN 154 15 1 Y 1 A SER 155 ? A SER 155 16 1 Y 1 A GLY 156 ? A GLY 156 17 1 Y 1 A GLY 157 ? A GLY 157 18 1 Y 1 A ALA 158 ? A ALA 158 19 1 Y 1 A GLY 159 ? A GLY 159 20 1 Y 1 A GLN 160 ? A GLN 160 21 1 Y 1 A ALA 161 ? A ALA 161 22 1 Y 1 A THR 162 ? A THR 162 23 1 Y 1 A GLY 163 ? A GLY 163 24 1 Y 1 A LYS 164 ? A LYS 164 25 1 Y 1 A GLU 165 ? A GLU 165 26 1 Y 1 A ALA 166 ? A ALA 166 27 1 Y 1 A GLY 167 ? A GLY 167 28 1 Y 1 A GLY 168 ? A GLY 168 29 1 Y 1 A GLY 169 ? A GLY 169 30 1 Y 1 A GLY 170 ? A GLY 170 31 1 Y 1 A SER 171 ? A SER 171 32 1 Y 1 A LEU 172 ? A LEU 172 33 1 Y 1 A GLU 173 ? A GLU 173 34 1 Y 1 A VAL 174 ? A VAL 174 35 1 Y 1 A LEU 175 ? A LEU 175 36 1 Y 1 A PHE 176 ? A PHE 176 37 1 Y 1 A GLN 177 ? A GLN 177 38 1 Y 1 A GLY 178 ? A GLY 178 39 1 Y 1 A PRO 179 ? A PRO 179 40 1 Y 1 A GLY 180 ? A GLY 180 41 1 Y 1 A GLY 181 ? A GLY 181 42 1 Y 1 A GLY 182 ? A GLY 182 43 1 Y 1 A GLY 183 ? A GLY 183 44 1 Y 1 A SER 184 ? A SER 184 45 1 Y 1 A LEU 185 ? A LEU 185 46 1 Y 1 A GLU 186 ? A GLU 186 47 1 Y 1 A VAL 187 ? A VAL 187 48 1 Y 1 A ASP 188 ? A ASP 188 49 1 Y 1 A HIS 189 ? A HIS 189 50 1 Y 1 A HIS 190 ? A HIS 190 51 1 Y 1 A HIS 191 ? A HIS 191 52 1 Y 1 A HIS 192 ? A HIS 192 53 1 Y 1 A HIS 193 ? A HIS 193 54 1 Y 1 A HIS 194 ? A HIS 194 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 HOH O O N N 158 HOH H1 H N N 159 HOH H2 H N N 160 ILE N N N N 161 ILE CA C N S 162 ILE C C N N 163 ILE O O N N 164 ILE CB C N S 165 ILE CG1 C N N 166 ILE CG2 C N N 167 ILE CD1 C N N 168 ILE OXT O N N 169 ILE H H N N 170 ILE H2 H N N 171 ILE HA H N N 172 ILE HB H N N 173 ILE HG12 H N N 174 ILE HG13 H N N 175 ILE HG21 H N N 176 ILE HG22 H N N 177 ILE HG23 H N N 178 ILE HD11 H N N 179 ILE HD12 H N N 180 ILE HD13 H N N 181 ILE HXT H N N 182 LEU N N N N 183 LEU CA C N S 184 LEU C C N N 185 LEU O O N N 186 LEU CB C N N 187 LEU CG C N N 188 LEU CD1 C N N 189 LEU CD2 C N N 190 LEU OXT O N N 191 LEU H H N N 192 LEU H2 H N N 193 LEU HA H N N 194 LEU HB2 H N N 195 LEU HB3 H N N 196 LEU HG H N N 197 LEU HD11 H N N 198 LEU HD12 H N N 199 LEU HD13 H N N 200 LEU HD21 H N N 201 LEU HD22 H N N 202 LEU HD23 H N N 203 LEU HXT H N N 204 LYS N N N N 205 LYS CA C N S 206 LYS C C N N 207 LYS O O N N 208 LYS CB C N N 209 LYS CG C N N 210 LYS CD C N N 211 LYS CE C N N 212 LYS NZ N N N 213 LYS OXT O N N 214 LYS H H N N 215 LYS H2 H N N 216 LYS HA H N N 217 LYS HB2 H N N 218 LYS HB3 H N N 219 LYS HG2 H N N 220 LYS HG3 H N N 221 LYS HD2 H N N 222 LYS HD3 H N N 223 LYS HE2 H N N 224 LYS HE3 H N N 225 LYS HZ1 H N N 226 LYS HZ2 H N N 227 LYS HZ3 H N N 228 LYS HXT H N N 229 MET N N N N 230 MET CA C N S 231 MET C C N N 232 MET O O N N 233 MET CB C N N 234 MET CG C N N 235 MET SD S N N 236 MET CE C N N 237 MET OXT O N N 238 MET H H N N 239 MET H2 H N N 240 MET HA H N N 241 MET HB2 H N N 242 MET HB3 H N N 243 MET HG2 H N N 244 MET HG3 H N N 245 MET HE1 H N N 246 MET HE2 H N N 247 MET HE3 H N N 248 MET HXT H N N 249 PEG C1 C N N 250 PEG O1 O N N 251 PEG C2 C N N 252 PEG O2 O N N 253 PEG C3 C N N 254 PEG C4 C N N 255 PEG O4 O N N 256 PEG H11 H N N 257 PEG H12 H N N 258 PEG HO1 H N N 259 PEG H21 H N N 260 PEG H22 H N N 261 PEG H31 H N N 262 PEG H32 H N N 263 PEG H41 H N N 264 PEG H42 H N N 265 PEG HO4 H N N 266 PHE N N N N 267 PHE CA C N S 268 PHE C C N N 269 PHE O O N N 270 PHE CB C N N 271 PHE CG C Y N 272 PHE CD1 C Y N 273 PHE CD2 C Y N 274 PHE CE1 C Y N 275 PHE CE2 C Y N 276 PHE CZ C Y N 277 PHE OXT O N N 278 PHE H H N N 279 PHE H2 H N N 280 PHE HA H N N 281 PHE HB2 H N N 282 PHE HB3 H N N 283 PHE HD1 H N N 284 PHE HD2 H N N 285 PHE HE1 H N N 286 PHE HE2 H N N 287 PHE HZ H N N 288 PHE HXT H N N 289 PO4 P P N N 290 PO4 O1 O N N 291 PO4 O2 O N N 292 PO4 O3 O N N 293 PO4 O4 O N N 294 PRO N N N N 295 PRO CA C N S 296 PRO C C N N 297 PRO O O N N 298 PRO CB C N N 299 PRO CG C N N 300 PRO CD C N N 301 PRO OXT O N N 302 PRO H H N N 303 PRO HA H N N 304 PRO HB2 H N N 305 PRO HB3 H N N 306 PRO HG2 H N N 307 PRO HG3 H N N 308 PRO HD2 H N N 309 PRO HD3 H N N 310 PRO HXT H N N 311 SER N N N N 312 SER CA C N S 313 SER C C N N 314 SER O O N N 315 SER CB C N N 316 SER OG O N N 317 SER OXT O N N 318 SER H H N N 319 SER H2 H N N 320 SER HA H N N 321 SER HB2 H N N 322 SER HB3 H N N 323 SER HG H N N 324 SER HXT H N N 325 THR N N N N 326 THR CA C N S 327 THR C C N N 328 THR O O N N 329 THR CB C N R 330 THR OG1 O N N 331 THR CG2 C N N 332 THR OXT O N N 333 THR H H N N 334 THR H2 H N N 335 THR HA H N N 336 THR HB H N N 337 THR HG1 H N N 338 THR HG21 H N N 339 THR HG22 H N N 340 THR HG23 H N N 341 THR HXT H N N 342 TRS C C N N 343 TRS C1 C N N 344 TRS C2 C N N 345 TRS C3 C N N 346 TRS N N N N 347 TRS O1 O N N 348 TRS O2 O N N 349 TRS O3 O N N 350 TRS H11 H N N 351 TRS H12 H N N 352 TRS H21 H N N 353 TRS H22 H N N 354 TRS H31 H N N 355 TRS H32 H N N 356 TRS HN1 H N N 357 TRS HN2 H N N 358 TRS HN3 H N N 359 TRS HO1 H N N 360 TRS HO2 H N N 361 TRS HO3 H N N 362 TYR N N N N 363 TYR CA C N S 364 TYR C C N N 365 TYR O O N N 366 TYR CB C N N 367 TYR CG C Y N 368 TYR CD1 C Y N 369 TYR CD2 C Y N 370 TYR CE1 C Y N 371 TYR CE2 C Y N 372 TYR CZ C Y N 373 TYR OH O N N 374 TYR OXT O N N 375 TYR H H N N 376 TYR H2 H N N 377 TYR HA H N N 378 TYR HB2 H N N 379 TYR HB3 H N N 380 TYR HD1 H N N 381 TYR HD2 H N N 382 TYR HE1 H N N 383 TYR HE2 H N N 384 TYR HH H N N 385 TYR HXT H N N 386 UMP N1 N N N 387 UMP C2 C N N 388 UMP N3 N N N 389 UMP C4 C N N 390 UMP C5 C N N 391 UMP C6 C N N 392 UMP O2 O N N 393 UMP O4 O N N 394 UMP "C1'" C N R 395 UMP "C2'" C N N 396 UMP "C3'" C N S 397 UMP "C4'" C N R 398 UMP "O3'" O N N 399 UMP "O4'" O N N 400 UMP "C5'" C N N 401 UMP "O5'" O N N 402 UMP P P N N 403 UMP OP1 O N N 404 UMP OP2 O N N 405 UMP OP3 O N N 406 UMP HN3 H N N 407 UMP H5 H N N 408 UMP H6 H N N 409 UMP "H1'" H N N 410 UMP "H2'" H N N 411 UMP "H2''" H N N 412 UMP "H3'" H N N 413 UMP "H4'" H N N 414 UMP "HO3'" H N N 415 UMP "H5'" H N N 416 UMP "H5''" H N N 417 UMP HOP2 H N N 418 UMP HOP3 H N N 419 VAL N N N N 420 VAL CA C N S 421 VAL C C N N 422 VAL O O N N 423 VAL CB C N N 424 VAL CG1 C N N 425 VAL CG2 C N N 426 VAL OXT O N N 427 VAL H H N N 428 VAL H2 H N N 429 VAL HA H N N 430 VAL HB H N N 431 VAL HG11 H N N 432 VAL HG12 H N N 433 VAL HG13 H N N 434 VAL HG21 H N N 435 VAL HG22 H N N 436 VAL HG23 H N N 437 VAL HXT H N N 438 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MET N CA sing N N 218 MET N H sing N N 219 MET N H2 sing N N 220 MET CA C sing N N 221 MET CA CB sing N N 222 MET CA HA sing N N 223 MET C O doub N N 224 MET C OXT sing N N 225 MET CB CG sing N N 226 MET CB HB2 sing N N 227 MET CB HB3 sing N N 228 MET CG SD sing N N 229 MET CG HG2 sing N N 230 MET CG HG3 sing N N 231 MET SD CE sing N N 232 MET CE HE1 sing N N 233 MET CE HE2 sing N N 234 MET CE HE3 sing N N 235 MET OXT HXT sing N N 236 PEG C1 O1 sing N N 237 PEG C1 C2 sing N N 238 PEG C1 H11 sing N N 239 PEG C1 H12 sing N N 240 PEG O1 HO1 sing N N 241 PEG C2 O2 sing N N 242 PEG C2 H21 sing N N 243 PEG C2 H22 sing N N 244 PEG O2 C3 sing N N 245 PEG C3 C4 sing N N 246 PEG C3 H31 sing N N 247 PEG C3 H32 sing N N 248 PEG C4 O4 sing N N 249 PEG C4 H41 sing N N 250 PEG C4 H42 sing N N 251 PEG O4 HO4 sing N N 252 PHE N CA sing N N 253 PHE N H sing N N 254 PHE N H2 sing N N 255 PHE CA C sing N N 256 PHE CA CB sing N N 257 PHE CA HA sing N N 258 PHE C O doub N N 259 PHE C OXT sing N N 260 PHE CB CG sing N N 261 PHE CB HB2 sing N N 262 PHE CB HB3 sing N N 263 PHE CG CD1 doub Y N 264 PHE CG CD2 sing Y N 265 PHE CD1 CE1 sing Y N 266 PHE CD1 HD1 sing N N 267 PHE CD2 CE2 doub Y N 268 PHE CD2 HD2 sing N N 269 PHE CE1 CZ doub Y N 270 PHE CE1 HE1 sing N N 271 PHE CE2 CZ sing Y N 272 PHE CE2 HE2 sing N N 273 PHE CZ HZ sing N N 274 PHE OXT HXT sing N N 275 PO4 P O1 doub N N 276 PO4 P O2 sing N N 277 PO4 P O3 sing N N 278 PO4 P O4 sing N N 279 PRO N CA sing N N 280 PRO N CD sing N N 281 PRO N H sing N N 282 PRO CA C sing N N 283 PRO CA CB sing N N 284 PRO CA HA sing N N 285 PRO C O doub N N 286 PRO C OXT sing N N 287 PRO CB CG sing N N 288 PRO CB HB2 sing N N 289 PRO CB HB3 sing N N 290 PRO CG CD sing N N 291 PRO CG HG2 sing N N 292 PRO CG HG3 sing N N 293 PRO CD HD2 sing N N 294 PRO CD HD3 sing N N 295 PRO OXT HXT sing N N 296 SER N CA sing N N 297 SER N H sing N N 298 SER N H2 sing N N 299 SER CA C sing N N 300 SER CA CB sing N N 301 SER CA HA sing N N 302 SER C O doub N N 303 SER C OXT sing N N 304 SER CB OG sing N N 305 SER CB HB2 sing N N 306 SER CB HB3 sing N N 307 SER OG HG sing N N 308 SER OXT HXT sing N N 309 THR N CA sing N N 310 THR N H sing N N 311 THR N H2 sing N N 312 THR CA C sing N N 313 THR CA CB sing N N 314 THR CA HA sing N N 315 THR C O doub N N 316 THR C OXT sing N N 317 THR CB OG1 sing N N 318 THR CB CG2 sing N N 319 THR CB HB sing N N 320 THR OG1 HG1 sing N N 321 THR CG2 HG21 sing N N 322 THR CG2 HG22 sing N N 323 THR CG2 HG23 sing N N 324 THR OXT HXT sing N N 325 TRS C C1 sing N N 326 TRS C C2 sing N N 327 TRS C C3 sing N N 328 TRS C N sing N N 329 TRS C1 O1 sing N N 330 TRS C1 H11 sing N N 331 TRS C1 H12 sing N N 332 TRS C2 O2 sing N N 333 TRS C2 H21 sing N N 334 TRS C2 H22 sing N N 335 TRS C3 O3 sing N N 336 TRS C3 H31 sing N N 337 TRS C3 H32 sing N N 338 TRS N HN1 sing N N 339 TRS N HN2 sing N N 340 TRS N HN3 sing N N 341 TRS O1 HO1 sing N N 342 TRS O2 HO2 sing N N 343 TRS O3 HO3 sing N N 344 TYR N CA sing N N 345 TYR N H sing N N 346 TYR N H2 sing N N 347 TYR CA C sing N N 348 TYR CA CB sing N N 349 TYR CA HA sing N N 350 TYR C O doub N N 351 TYR C OXT sing N N 352 TYR CB CG sing N N 353 TYR CB HB2 sing N N 354 TYR CB HB3 sing N N 355 TYR CG CD1 doub Y N 356 TYR CG CD2 sing Y N 357 TYR CD1 CE1 sing Y N 358 TYR CD1 HD1 sing N N 359 TYR CD2 CE2 doub Y N 360 TYR CD2 HD2 sing N N 361 TYR CE1 CZ doub Y N 362 TYR CE1 HE1 sing N N 363 TYR CE2 CZ sing Y N 364 TYR CE2 HE2 sing N N 365 TYR CZ OH sing N N 366 TYR OH HH sing N N 367 TYR OXT HXT sing N N 368 UMP N1 C2 sing N N 369 UMP N1 C6 sing N N 370 UMP N1 "C1'" sing N N 371 UMP C2 N3 sing N N 372 UMP C2 O2 doub N N 373 UMP N3 C4 sing N N 374 UMP N3 HN3 sing N N 375 UMP C4 C5 sing N N 376 UMP C4 O4 doub N N 377 UMP C5 C6 doub N N 378 UMP C5 H5 sing N N 379 UMP C6 H6 sing N N 380 UMP "C1'" "C2'" sing N N 381 UMP "C1'" "O4'" sing N N 382 UMP "C1'" "H1'" sing N N 383 UMP "C2'" "C3'" sing N N 384 UMP "C2'" "H2'" sing N N 385 UMP "C2'" "H2''" sing N N 386 UMP "C3'" "C4'" sing N N 387 UMP "C3'" "O3'" sing N N 388 UMP "C3'" "H3'" sing N N 389 UMP "C4'" "O4'" sing N N 390 UMP "C4'" "C5'" sing N N 391 UMP "C4'" "H4'" sing N N 392 UMP "O3'" "HO3'" sing N N 393 UMP "C5'" "O5'" sing N N 394 UMP "C5'" "H5'" sing N N 395 UMP "C5'" "H5''" sing N N 396 UMP "O5'" P sing N N 397 UMP P OP1 doub N N 398 UMP P OP2 sing N N 399 UMP P OP3 sing N N 400 UMP OP2 HOP2 sing N N 401 UMP OP3 HOP3 sing N N 402 VAL N CA sing N N 403 VAL N H sing N N 404 VAL N H2 sing N N 405 VAL CA C sing N N 406 VAL CA CB sing N N 407 VAL CA HA sing N N 408 VAL C O doub N N 409 VAL C OXT sing N N 410 VAL CB CG1 sing N N 411 VAL CB CG2 sing N N 412 VAL CB HB sing N N 413 VAL CG1 HG11 sing N N 414 VAL CG1 HG12 sing N N 415 VAL CG1 HG13 sing N N 416 VAL CG2 HG21 sing N N 417 VAL CG2 HG22 sing N N 418 VAL CG2 HG23 sing N N 419 VAL OXT HXT sing N N 420 # _pdbx_audit_support.funding_organization 'Other government' _pdbx_audit_support.country China _pdbx_audit_support.grant_number SKLBEE2022007 _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 1SIX _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 8XHM _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 0.008278 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.008278 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.008278 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C N O P S # loop_ #