data_8XJG # _entry.id 8XJG # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 8XJG pdb_00008xjg 10.2210/pdb8xjg/pdb WWPDB D_1300043663 ? ? # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2024-05-22 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 8XJG _pdbx_database_status.recvd_initial_deposition_date 2023-12-21 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_database_related.db_name PDB _pdbx_database_related.details . _pdbx_database_related.db_id 8XJE _pdbx_database_related.content_type unspecified # _pdbx_contact_author.id 2 _pdbx_contact_author.email sungil@kangwon.ac.kr _pdbx_contact_author.name_first Sung-il _pdbx_contact_author.name_last Yoon _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0003-0777-0457 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Kim, S.Y.' 1 ? 'Yoon, S.I.' 2 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Biochem.Biophys.Res.Commun. _citation.journal_id_ASTM BBRCA9 _citation.journal_id_CSD 0146 _citation.journal_id_ISSN 1090-2104 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 695 _citation.language ? _citation.page_first 149485 _citation.page_last 149485 _citation.title 'Structural analysis of the YqeY proteins from Campylobacter jejuni and Vibrio parahaemolyticus.' _citation.year 2024 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1016/j.bbrc.2024.149485 _citation.pdbx_database_id_PubMed 38211535 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Kim, S.Y.' 1 ? primary 'Yoon, S.I.' 2 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man YqeY 16723.383 1 ? ? ? ? 2 non-polymer syn 'ZINC ION' 65.409 3 ? ? ? ? 3 water nat water 18.015 88 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSAKDPMALIDQLKEEQKLAMKAKDKLRLGTIRLALAAIKQREVDEQITLNDDDILAVLTKMVKQRRDSVTQYEAAGRQD LADVEQAEITVLEEFMPQPLTEEEVAALIEKAIAESGAAGMQDMGKVMGVLKPQIQGRADMGKVSGLVRAKLA ; _entity_poly.pdbx_seq_one_letter_code_can ;GSAKDPMALIDQLKEEQKLAMKAKDKLRLGTIRLALAAIKQREVDEQITLNDDDILAVLTKMVKQRRDSVTQYEAAGRQD LADVEQAEITVLEEFMPQPLTEEEVAALIEKAIAESGAAGMQDMGKVMGVLKPQIQGRADMGKVSGLVRAKLA ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'ZINC ION' ZN 3 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 ALA n 1 4 LYS n 1 5 ASP n 1 6 PRO n 1 7 MET n 1 8 ALA n 1 9 LEU n 1 10 ILE n 1 11 ASP n 1 12 GLN n 1 13 LEU n 1 14 LYS n 1 15 GLU n 1 16 GLU n 1 17 GLN n 1 18 LYS n 1 19 LEU n 1 20 ALA n 1 21 MET n 1 22 LYS n 1 23 ALA n 1 24 LYS n 1 25 ASP n 1 26 LYS n 1 27 LEU n 1 28 ARG n 1 29 LEU n 1 30 GLY n 1 31 THR n 1 32 ILE n 1 33 ARG n 1 34 LEU n 1 35 ALA n 1 36 LEU n 1 37 ALA n 1 38 ALA n 1 39 ILE n 1 40 LYS n 1 41 GLN n 1 42 ARG n 1 43 GLU n 1 44 VAL n 1 45 ASP n 1 46 GLU n 1 47 GLN n 1 48 ILE n 1 49 THR n 1 50 LEU n 1 51 ASN n 1 52 ASP n 1 53 ASP n 1 54 ASP n 1 55 ILE n 1 56 LEU n 1 57 ALA n 1 58 VAL n 1 59 LEU n 1 60 THR n 1 61 LYS n 1 62 MET n 1 63 VAL n 1 64 LYS n 1 65 GLN n 1 66 ARG n 1 67 ARG n 1 68 ASP n 1 69 SER n 1 70 VAL n 1 71 THR n 1 72 GLN n 1 73 TYR n 1 74 GLU n 1 75 ALA n 1 76 ALA n 1 77 GLY n 1 78 ARG n 1 79 GLN n 1 80 ASP n 1 81 LEU n 1 82 ALA n 1 83 ASP n 1 84 VAL n 1 85 GLU n 1 86 GLN n 1 87 ALA n 1 88 GLU n 1 89 ILE n 1 90 THR n 1 91 VAL n 1 92 LEU n 1 93 GLU n 1 94 GLU n 1 95 PHE n 1 96 MET n 1 97 PRO n 1 98 GLN n 1 99 PRO n 1 100 LEU n 1 101 THR n 1 102 GLU n 1 103 GLU n 1 104 GLU n 1 105 VAL n 1 106 ALA n 1 107 ALA n 1 108 LEU n 1 109 ILE n 1 110 GLU n 1 111 LYS n 1 112 ALA n 1 113 ILE n 1 114 ALA n 1 115 GLU n 1 116 SER n 1 117 GLY n 1 118 ALA n 1 119 ALA n 1 120 GLY n 1 121 MET n 1 122 GLN n 1 123 ASP n 1 124 MET n 1 125 GLY n 1 126 LYS n 1 127 VAL n 1 128 MET n 1 129 GLY n 1 130 VAL n 1 131 LEU n 1 132 LYS n 1 133 PRO n 1 134 GLN n 1 135 ILE n 1 136 GLN n 1 137 GLY n 1 138 ARG n 1 139 ALA n 1 140 ASP n 1 141 MET n 1 142 GLY n 1 143 LYS n 1 144 VAL n 1 145 SER n 1 146 GLY n 1 147 LEU n 1 148 VAL n 1 149 ARG n 1 150 ALA n 1 151 LYS n 1 152 LEU n 1 153 ALA n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 153 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Vibrio parahaemolyticus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 670 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 -5 ? ? ? A . n A 1 2 SER 2 -4 ? ? ? A . n A 1 3 ALA 3 -3 ? ? ? A . n A 1 4 LYS 4 -2 ? ? ? A . n A 1 5 ASP 5 -1 -1 ASP ASP A . n A 1 6 PRO 6 0 0 PRO PRO A . n A 1 7 MET 7 1 1 MET MET A . n A 1 8 ALA 8 2 2 ALA ALA A . n A 1 9 LEU 9 3 3 LEU LEU A . n A 1 10 ILE 10 4 4 ILE ILE A . n A 1 11 ASP 11 5 5 ASP ASP A . n A 1 12 GLN 12 6 6 GLN GLN A . n A 1 13 LEU 13 7 7 LEU LEU A . n A 1 14 LYS 14 8 8 LYS LYS A . n A 1 15 GLU 15 9 9 GLU GLU A . n A 1 16 GLU 16 10 10 GLU GLU A . n A 1 17 GLN 17 11 11 GLN GLN A . n A 1 18 LYS 18 12 12 LYS LYS A . n A 1 19 LEU 19 13 13 LEU LEU A . n A 1 20 ALA 20 14 14 ALA ALA A . n A 1 21 MET 21 15 15 MET MET A . n A 1 22 LYS 22 16 16 LYS LYS A . n A 1 23 ALA 23 17 17 ALA ALA A . n A 1 24 LYS 24 18 18 LYS LYS A . n A 1 25 ASP 25 19 19 ASP ASP A . n A 1 26 LYS 26 20 20 LYS LYS A . n A 1 27 LEU 27 21 21 LEU LEU A . n A 1 28 ARG 28 22 22 ARG ARG A . n A 1 29 LEU 29 23 23 LEU LEU A . n A 1 30 GLY 30 24 24 GLY GLY A . n A 1 31 THR 31 25 25 THR THR A . n A 1 32 ILE 32 26 26 ILE ILE A . n A 1 33 ARG 33 27 27 ARG ARG A . n A 1 34 LEU 34 28 28 LEU LEU A . n A 1 35 ALA 35 29 29 ALA ALA A . n A 1 36 LEU 36 30 30 LEU LEU A . n A 1 37 ALA 37 31 31 ALA ALA A . n A 1 38 ALA 38 32 32 ALA ALA A . n A 1 39 ILE 39 33 33 ILE ILE A . n A 1 40 LYS 40 34 34 LYS LYS A . n A 1 41 GLN 41 35 35 GLN GLN A . n A 1 42 ARG 42 36 36 ARG ARG A . n A 1 43 GLU 43 37 37 GLU GLU A . n A 1 44 VAL 44 38 38 VAL VAL A . n A 1 45 ASP 45 39 39 ASP ASP A . n A 1 46 GLU 46 40 40 GLU GLU A . n A 1 47 GLN 47 41 41 GLN GLN A . n A 1 48 ILE 48 42 42 ILE ILE A . n A 1 49 THR 49 43 43 THR THR A . n A 1 50 LEU 50 44 44 LEU LEU A . n A 1 51 ASN 51 45 45 ASN ASN A . n A 1 52 ASP 52 46 46 ASP ASP A . n A 1 53 ASP 53 47 47 ASP ASP A . n A 1 54 ASP 54 48 48 ASP ASP A . n A 1 55 ILE 55 49 49 ILE ILE A . n A 1 56 LEU 56 50 50 LEU LEU A . n A 1 57 ALA 57 51 51 ALA ALA A . n A 1 58 VAL 58 52 52 VAL VAL A . n A 1 59 LEU 59 53 53 LEU LEU A . n A 1 60 THR 60 54 54 THR THR A . n A 1 61 LYS 61 55 55 LYS LYS A . n A 1 62 MET 62 56 56 MET MET A . n A 1 63 VAL 63 57 57 VAL VAL A . n A 1 64 LYS 64 58 58 LYS LYS A . n A 1 65 GLN 65 59 59 GLN GLN A . n A 1 66 ARG 66 60 60 ARG ARG A . n A 1 67 ARG 67 61 61 ARG ARG A . n A 1 68 ASP 68 62 62 ASP ASP A . n A 1 69 SER 69 63 63 SER SER A . n A 1 70 VAL 70 64 64 VAL VAL A . n A 1 71 THR 71 65 65 THR THR A . n A 1 72 GLN 72 66 66 GLN GLN A . n A 1 73 TYR 73 67 67 TYR TYR A . n A 1 74 GLU 74 68 68 GLU GLU A . n A 1 75 ALA 75 69 69 ALA ALA A . n A 1 76 ALA 76 70 70 ALA ALA A . n A 1 77 GLY 77 71 71 GLY GLY A . n A 1 78 ARG 78 72 72 ARG ARG A . n A 1 79 GLN 79 73 73 GLN GLN A . n A 1 80 ASP 80 74 74 ASP ASP A . n A 1 81 LEU 81 75 75 LEU LEU A . n A 1 82 ALA 82 76 76 ALA ALA A . n A 1 83 ASP 83 77 77 ASP ASP A . n A 1 84 VAL 84 78 78 VAL VAL A . n A 1 85 GLU 85 79 79 GLU GLU A . n A 1 86 GLN 86 80 80 GLN GLN A . n A 1 87 ALA 87 81 81 ALA ALA A . n A 1 88 GLU 88 82 82 GLU GLU A . n A 1 89 ILE 89 83 83 ILE ILE A . n A 1 90 THR 90 84 84 THR THR A . n A 1 91 VAL 91 85 85 VAL VAL A . n A 1 92 LEU 92 86 86 LEU LEU A . n A 1 93 GLU 93 87 87 GLU GLU A . n A 1 94 GLU 94 88 88 GLU GLU A . n A 1 95 PHE 95 89 89 PHE PHE A . n A 1 96 MET 96 90 90 MET MET A . n A 1 97 PRO 97 91 91 PRO PRO A . n A 1 98 GLN 98 92 92 GLN GLN A . n A 1 99 PRO 99 93 93 PRO PRO A . n A 1 100 LEU 100 94 94 LEU LEU A . n A 1 101 THR 101 95 95 THR THR A . n A 1 102 GLU 102 96 96 GLU GLU A . n A 1 103 GLU 103 97 97 GLU GLU A . n A 1 104 GLU 104 98 98 GLU GLU A . n A 1 105 VAL 105 99 99 VAL VAL A . n A 1 106 ALA 106 100 100 ALA ALA A . n A 1 107 ALA 107 101 101 ALA ALA A . n A 1 108 LEU 108 102 102 LEU LEU A . n A 1 109 ILE 109 103 103 ILE ILE A . n A 1 110 GLU 110 104 104 GLU GLU A . n A 1 111 LYS 111 105 105 LYS LYS A . n A 1 112 ALA 112 106 106 ALA ALA A . n A 1 113 ILE 113 107 107 ILE ILE A . n A 1 114 ALA 114 108 108 ALA ALA A . n A 1 115 GLU 115 109 109 GLU GLU A . n A 1 116 SER 116 110 110 SER SER A . n A 1 117 GLY 117 111 111 GLY GLY A . n A 1 118 ALA 118 112 112 ALA ALA A . n A 1 119 ALA 119 113 113 ALA ALA A . n A 1 120 GLY 120 114 114 GLY GLY A . n A 1 121 MET 121 115 115 MET MET A . n A 1 122 GLN 122 116 116 GLN GLN A . n A 1 123 ASP 123 117 117 ASP ASP A . n A 1 124 MET 124 118 118 MET MET A . n A 1 125 GLY 125 119 119 GLY GLY A . n A 1 126 LYS 126 120 120 LYS LYS A . n A 1 127 VAL 127 121 121 VAL VAL A . n A 1 128 MET 128 122 122 MET MET A . n A 1 129 GLY 129 123 123 GLY GLY A . n A 1 130 VAL 130 124 124 VAL VAL A . n A 1 131 LEU 131 125 125 LEU LEU A . n A 1 132 LYS 132 126 126 LYS LYS A . n A 1 133 PRO 133 127 127 PRO PRO A . n A 1 134 GLN 134 128 128 GLN GLN A . n A 1 135 ILE 135 129 129 ILE ILE A . n A 1 136 GLN 136 130 130 GLN GLN A . n A 1 137 GLY 137 131 131 GLY GLY A . n A 1 138 ARG 138 132 132 ARG ARG A . n A 1 139 ALA 139 133 133 ALA ALA A . n A 1 140 ASP 140 134 134 ASP ASP A . n A 1 141 MET 141 135 135 MET MET A . n A 1 142 GLY 142 136 136 GLY GLY A . n A 1 143 LYS 143 137 137 LYS LYS A . n A 1 144 VAL 144 138 138 VAL VAL A . n A 1 145 SER 145 139 139 SER SER A . n A 1 146 GLY 146 140 140 GLY GLY A . n A 1 147 LEU 147 141 141 LEU LEU A . n A 1 148 VAL 148 142 142 VAL VAL A . n A 1 149 ARG 149 143 143 ARG ARG A . n A 1 150 ALA 150 144 144 ALA ALA A . n A 1 151 LYS 151 145 145 LYS LYS A . n A 1 152 LEU 152 146 146 LEU LEU A . n A 1 153 ALA 153 147 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 ZN 1 201 1 ZN ZN A . C 2 ZN 1 202 2 ZN ZN A . D 2 ZN 1 203 3 ZN ZN A . E 3 HOH 1 301 7 HOH HOH A . E 3 HOH 2 302 18 HOH HOH A . E 3 HOH 3 303 10 HOH HOH A . E 3 HOH 4 304 25 HOH HOH A . E 3 HOH 5 305 50 HOH HOH A . E 3 HOH 6 306 94 HOH HOH A . E 3 HOH 7 307 23 HOH HOH A . E 3 HOH 8 308 67 HOH HOH A . E 3 HOH 9 309 97 HOH HOH A . E 3 HOH 10 310 59 HOH HOH A . E 3 HOH 11 311 38 HOH HOH A . E 3 HOH 12 312 92 HOH HOH A . E 3 HOH 13 313 114 HOH HOH A . E 3 HOH 14 314 21 HOH HOH A . E 3 HOH 15 315 140 HOH HOH A . E 3 HOH 16 316 137 HOH HOH A . E 3 HOH 17 317 72 HOH HOH A . E 3 HOH 18 318 75 HOH HOH A . E 3 HOH 19 319 55 HOH HOH A . E 3 HOH 20 320 53 HOH HOH A . E 3 HOH 21 321 78 HOH HOH A . E 3 HOH 22 322 79 HOH HOH A . E 3 HOH 23 323 145 HOH HOH A . E 3 HOH 24 324 9 HOH HOH A . E 3 HOH 25 325 64 HOH HOH A . E 3 HOH 26 326 8 HOH HOH A . E 3 HOH 27 327 11 HOH HOH A . E 3 HOH 28 328 66 HOH HOH A . E 3 HOH 29 329 26 HOH HOH A . E 3 HOH 30 330 112 HOH HOH A . E 3 HOH 31 331 107 HOH HOH A . E 3 HOH 32 332 1 HOH HOH A . E 3 HOH 33 333 70 HOH HOH A . E 3 HOH 34 334 14 HOH HOH A . E 3 HOH 35 335 36 HOH HOH A . E 3 HOH 36 336 15 HOH HOH A . E 3 HOH 37 337 144 HOH HOH A . E 3 HOH 38 338 68 HOH HOH A . E 3 HOH 39 339 16 HOH HOH A . E 3 HOH 40 340 82 HOH HOH A . E 3 HOH 41 341 44 HOH HOH A . E 3 HOH 42 342 6 HOH HOH A . E 3 HOH 43 343 2 HOH HOH A . E 3 HOH 44 344 19 HOH HOH A . E 3 HOH 45 345 134 HOH HOH A . E 3 HOH 46 346 3 HOH HOH A . E 3 HOH 47 347 132 HOH HOH A . E 3 HOH 48 348 48 HOH HOH A . E 3 HOH 49 349 32 HOH HOH A . E 3 HOH 50 350 54 HOH HOH A . E 3 HOH 51 351 120 HOH HOH A . E 3 HOH 52 352 118 HOH HOH A . E 3 HOH 53 353 22 HOH HOH A . E 3 HOH 54 354 34 HOH HOH A . E 3 HOH 55 355 133 HOH HOH A . E 3 HOH 56 356 28 HOH HOH A . E 3 HOH 57 357 100 HOH HOH A . E 3 HOH 58 358 46 HOH HOH A . E 3 HOH 59 359 139 HOH HOH A . E 3 HOH 60 360 33 HOH HOH A . E 3 HOH 61 361 27 HOH HOH A . E 3 HOH 62 362 142 HOH HOH A . E 3 HOH 63 363 47 HOH HOH A . E 3 HOH 64 364 125 HOH HOH A . E 3 HOH 65 365 37 HOH HOH A . E 3 HOH 66 366 90 HOH HOH A . E 3 HOH 67 367 62 HOH HOH A . E 3 HOH 68 368 20 HOH HOH A . E 3 HOH 69 369 119 HOH HOH A . E 3 HOH 70 370 85 HOH HOH A . E 3 HOH 71 371 121 HOH HOH A . E 3 HOH 72 372 105 HOH HOH A . E 3 HOH 73 373 24 HOH HOH A . E 3 HOH 74 374 58 HOH HOH A . E 3 HOH 75 375 35 HOH HOH A . E 3 HOH 76 376 89 HOH HOH A . E 3 HOH 77 377 73 HOH HOH A . E 3 HOH 78 378 31 HOH HOH A . E 3 HOH 79 379 122 HOH HOH A . E 3 HOH 80 380 74 HOH HOH A . E 3 HOH 81 381 123 HOH HOH A . E 3 HOH 82 382 84 HOH HOH A . E 3 HOH 83 383 61 HOH HOH A . E 3 HOH 84 384 110 HOH HOH A . E 3 HOH 85 385 116 HOH HOH A . E 3 HOH 86 386 95 HOH HOH A . E 3 HOH 87 387 39 HOH HOH A . E 3 HOH 88 388 43 HOH HOH A . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A ASP -1 ? CG ? A ASP 5 CG 2 1 Y 1 A ASP -1 ? OD1 ? A ASP 5 OD1 3 1 Y 1 A ASP -1 ? OD2 ? A ASP 5 OD2 4 1 Y 1 A LYS 12 ? CE ? A LYS 18 CE 5 1 Y 1 A LYS 12 ? NZ ? A LYS 18 NZ 6 1 Y 1 A LYS 18 ? CE ? A LYS 24 CE 7 1 Y 1 A LYS 18 ? NZ ? A LYS 24 NZ 8 1 Y 1 A LYS 20 ? CG ? A LYS 26 CG 9 1 Y 1 A LYS 20 ? CD ? A LYS 26 CD 10 1 Y 1 A LYS 20 ? CE ? A LYS 26 CE 11 1 Y 1 A LYS 20 ? NZ ? A LYS 26 NZ 12 1 Y 1 A LYS 55 ? CE ? A LYS 61 CE 13 1 Y 1 A LYS 55 ? NZ ? A LYS 61 NZ 14 1 Y 1 A LYS 58 ? CD ? A LYS 64 CD 15 1 Y 1 A LYS 58 ? CE ? A LYS 64 CE 16 1 Y 1 A LYS 58 ? NZ ? A LYS 64 NZ 17 1 Y 1 A GLN 66 ? CG ? A GLN 72 CG 18 1 Y 1 A GLN 66 ? CD ? A GLN 72 CD 19 1 Y 1 A GLN 66 ? OE1 ? A GLN 72 OE1 20 1 Y 1 A GLN 66 ? NE2 ? A GLN 72 NE2 21 1 Y 1 A GLN 130 ? CG ? A GLN 136 CG 22 1 Y 1 A GLN 130 ? CD ? A GLN 136 CD 23 1 Y 1 A GLN 130 ? OE1 ? A GLN 136 OE1 24 1 Y 1 A GLN 130 ? NE2 ? A GLN 136 NE2 25 1 Y 1 A ARG 143 ? CG ? A ARG 149 CG 26 1 Y 1 A ARG 143 ? CD ? A ARG 149 CD 27 1 Y 1 A ARG 143 ? NE ? A ARG 149 NE 28 1 Y 1 A ARG 143 ? CZ ? A ARG 149 CZ 29 1 Y 1 A ARG 143 ? NH1 ? A ARG 149 NH1 30 1 Y 1 A ARG 143 ? NH2 ? A ARG 149 NH2 # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.15.2_3472 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 8XJG _cell.details ? _cell.formula_units_Z ? _cell.length_a 43.721 _cell.length_a_esd ? _cell.length_b 107.577 _cell.length_b_esd ? _cell.length_c 34.671 _cell.length_c_esd ? _cell.volume 163070.681 _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 8XJG _symmetry.cell_setting ? _symmetry.Int_Tables_number 18 _symmetry.space_group_name_Hall 'P 2 2ab' _symmetry.space_group_name_H-M 'P 21 21 2' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 8XJG _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.44 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 49.54 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 6.0 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details 'PEG 8000, zinc acetate, MES' _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 291 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'ADSC QUANTUM 270' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2022-07-22 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9793 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'PAL/PLS BEAMLINE 7A (6B, 6C1)' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9793 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline '7A (6B, 6C1)' _diffrn_source.pdbx_synchrotron_site PAL/PLS # _reflns.B_iso_Wilson_estimate 25.08 _reflns.entry_id 8XJG _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.7 _reflns.d_resolution_low 30 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 18735 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.8 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 6.4 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 40.0 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.996 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 1.70 _reflns_shell.d_res_low 1.73 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 2.3 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 912 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 5.8 _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.887 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.percent_possible_all 99.7 _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 33.11 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 8XJG _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.70 _refine.ls_d_res_low 29.14 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 18664 _refine.ls_number_reflns_R_free 951 _refine.ls_number_reflns_R_work 17713 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.74 _refine.ls_percent_reflns_R_free 5.10 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2281 _refine.ls_R_factor_R_free 0.2578 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2265 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.34 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values 'GeoStd + Monomer Library + CDL v1.2' _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 29.9213 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.2412 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 1.70 _refine_hist.d_res_low 29.14 _refine_hist.number_atoms_solvent 88 _refine_hist.number_atoms_total 1195 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 1104 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 3 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.0077 ? 1136 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.9450 ? 1535 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.3788 ? 188 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.0050 ? 201 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 28.9090 ? 450 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free _refine_ls_shell.R_factor_R_free 'X-RAY DIFFRACTION' 1.70 1.79 . . 116 2477 99.54 . . . . 0.3035 . . . . . . . . . . . 0.3910 'X-RAY DIFFRACTION' 1.79 1.90 . . 141 2485 99.70 . . . . 0.2875 . . . . . . . . . . . 0.3619 'X-RAY DIFFRACTION' 1.90 2.05 . . 117 2513 99.77 . . . . 0.2572 . . . . . . . . . . . 0.3006 'X-RAY DIFFRACTION' 2.05 2.25 . . 133 2493 99.92 . . . . 0.2297 . . . . . . . . . . . 0.2885 'X-RAY DIFFRACTION' 2.25 2.58 . . 139 2529 99.89 . . . . 0.2274 . . . . . . . . . . . 0.2594 'X-RAY DIFFRACTION' 2.58 3.25 . . 166 2526 99.93 . . . . 0.2357 . . . . . . . . . . . 0.2575 'X-RAY DIFFRACTION' 3.25 29.14 . . 139 2690 99.47 . . . . 0.2018 . . . . . . . . . . . 0.2216 # _struct.entry_id 8XJG _struct.title 'Crystal structure of the YqeY protein from Vibrio parahaemolyticus' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 8XJG _struct_keywords.text 'UNKNOWN FUNCTION' _struct_keywords.pdbx_keywords 'UNKNOWN FUNCTION' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 2 ? E N N 3 ? # _struct_ref.id 1 _struct_ref.db_name PDB _struct_ref.db_code 8XJG _struct_ref.pdbx_db_accession 8XJG _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 8XJG _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 153 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession 8XJG _struct_ref_seq.db_align_beg -5 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 147 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg -5 _struct_ref_seq.pdbx_auth_seq_align_end 147 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 160 ? 1 MORE -43 ? 1 'SSA (A^2)' 9120 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ALA A 8 ? LYS A 24 ? ALA A 2 LYS A 18 1 ? 17 HELX_P HELX_P2 AA2 ASP A 25 ? GLN A 47 ? ASP A 19 GLN A 41 1 ? 23 HELX_P HELX_P3 AA3 ASN A 51 ? ALA A 76 ? ASN A 45 ALA A 70 1 ? 26 HELX_P HELX_P4 AA4 ARG A 78 ? GLU A 94 ? ARG A 72 GLU A 88 1 ? 17 HELX_P HELX_P5 AA5 THR A 101 ? GLY A 117 ? THR A 95 GLY A 111 1 ? 17 HELX_P HELX_P6 AA6 GLY A 120 ? GLN A 122 ? GLY A 114 GLN A 116 5 ? 3 HELX_P HELX_P7 AA7 ASP A 123 ? GLN A 136 ? ASP A 117 GLN A 130 1 ? 14 HELX_P HELX_P8 AA8 ASP A 140 ? LEU A 152 ? ASP A 134 LEU A 146 1 ? 13 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A GLU 16 OE2 ? ? ? 1_555 D ZN . ZN ? ? A GLU 10 A ZN 203 1_555 ? ? ? ? ? ? ? 2.244 ? ? metalc2 metalc ? ? A GLU 16 OE2 ? ? ? 1_555 D ZN . ZN ? ? A GLU 10 A ZN 203 2_555 ? ? ? ? ? ? ? 2.244 ? ? metalc3 metalc ? ? A ASP 25 OD1 ? ? ? 1_555 C ZN . ZN ? ? A ASP 19 A ZN 202 2_555 ? ? ? ? ? ? ? 2.129 ? ? metalc4 metalc ? ? A GLU 85 OE1 ? ? ? 1_555 B ZN . ZN ? ? A GLU 79 A ZN 201 1_555 ? ? ? ? ? ? ? 1.841 ? ? metalc5 metalc ? ? A GLU 88 OE1 ? ? ? 1_555 B ZN . ZN ? ? A GLU 82 A ZN 201 1_555 ? ? ? ? ? ? ? 2.058 ? ? metalc6 metalc ? ? A GLU 88 OE2 ? ? ? 1_555 B ZN . ZN ? ? A GLU 82 A ZN 201 1_555 ? ? ? ? ? ? ? 2.371 ? ? metalc7 metalc ? ? A GLU 94 OE1 ? ? ? 1_555 D ZN . ZN ? ? A GLU 88 A ZN 203 1_555 ? ? ? ? ? ? ? 2.413 ? ? metalc8 metalc ? ? A GLU 94 OE1 ? ? ? 1_555 D ZN . ZN ? ? A GLU 88 A ZN 203 2_555 ? ? ? ? ? ? ? 2.413 ? ? metalc9 metalc ? ? A GLU 110 OE1 ? ? ? 1_555 B ZN . ZN ? ? A GLU 104 A ZN 201 1_455 ? ? ? ? ? ? ? 1.937 ? ? metalc10 metalc ? ? B ZN . ZN ? ? ? 1_555 E HOH . O ? ? A ZN 201 A HOH 330 1_555 ? ? ? ? ? ? ? 2.010 ? ? metalc11 metalc ? ? C ZN . ZN ? ? ? 1_555 E HOH . O ? ? A ZN 202 A HOH 311 2_555 ? ? ? ? ? ? ? 2.048 ? ? metalc12 metalc ? ? C ZN . ZN ? ? ? 1_555 E HOH . O ? ? A ZN 202 A HOH 328 1_555 ? ? ? ? ? ? ? 2.084 ? ? metalc13 metalc ? ? C ZN . ZN ? ? ? 1_555 E HOH . O ? ? A ZN 202 A HOH 344 2_555 ? ? ? ? ? ? ? 2.044 ? ? metalc14 metalc ? ? C ZN . ZN ? ? ? 1_555 E HOH . O ? ? A ZN 202 A HOH 348 1_555 ? ? ? ? ? ? ? 2.086 ? ? metalc15 metalc ? ? C ZN . ZN ? ? ? 1_555 E HOH . O ? ? A ZN 202 A HOH 365 2_555 ? ? ? ? ? ? ? 2.171 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OE2 ? A GLU 16 ? A GLU 10 ? 1_555 ZN ? D ZN . ? A ZN 203 ? 1_555 OE2 ? A GLU 16 ? A GLU 10 ? 1_555 0.0 ? 2 OE2 ? A GLU 16 ? A GLU 10 ? 1_555 ZN ? D ZN . ? A ZN 203 ? 1_555 OE1 ? A GLU 94 ? A GLU 88 ? 1_555 128.9 ? 3 OE2 ? A GLU 16 ? A GLU 10 ? 1_555 ZN ? D ZN . ? A ZN 203 ? 1_555 OE1 ? A GLU 94 ? A GLU 88 ? 1_555 128.9 ? 4 OE2 ? A GLU 16 ? A GLU 10 ? 1_555 ZN ? D ZN . ? A ZN 203 ? 1_555 OE1 ? A GLU 94 ? A GLU 88 ? 1_555 128.9 ? 5 OE2 ? A GLU 16 ? A GLU 10 ? 1_555 ZN ? D ZN . ? A ZN 203 ? 1_555 OE1 ? A GLU 94 ? A GLU 88 ? 1_555 128.9 ? 6 OE1 ? A GLU 94 ? A GLU 88 ? 1_555 ZN ? D ZN . ? A ZN 203 ? 1_555 OE1 ? A GLU 94 ? A GLU 88 ? 1_555 0.0 ? 7 OD1 ? A ASP 25 ? A ASP 19 ? 1_555 ZN ? C ZN . ? A ZN 202 ? 2_555 O ? E HOH . ? A HOH 311 ? 2_555 68.4 ? 8 OD1 ? A ASP 25 ? A ASP 19 ? 1_555 ZN ? C ZN . ? A ZN 202 ? 2_555 O ? E HOH . ? A HOH 328 ? 1_555 72.2 ? 9 O ? E HOH . ? A HOH 311 ? 2_555 ZN ? C ZN . ? A ZN 202 ? 2_555 O ? E HOH . ? A HOH 328 ? 1_555 7.5 ? 10 OD1 ? A ASP 25 ? A ASP 19 ? 1_555 ZN ? C ZN . ? A ZN 202 ? 2_555 O ? E HOH . ? A HOH 344 ? 2_555 70.2 ? 11 O ? E HOH . ? A HOH 311 ? 2_555 ZN ? C ZN . ? A ZN 202 ? 2_555 O ? E HOH . ? A HOH 344 ? 2_555 3.9 ? 12 O ? E HOH . ? A HOH 328 ? 1_555 ZN ? C ZN . ? A ZN 202 ? 2_555 O ? E HOH . ? A HOH 344 ? 2_555 10.2 ? 13 OD1 ? A ASP 25 ? A ASP 19 ? 1_555 ZN ? C ZN . ? A ZN 202 ? 2_555 O ? E HOH . ? A HOH 348 ? 1_555 67.0 ? 14 O ? E HOH . ? A HOH 311 ? 2_555 ZN ? C ZN . ? A ZN 202 ? 2_555 O ? E HOH . ? A HOH 348 ? 1_555 3.4 ? 15 O ? E HOH . ? A HOH 328 ? 1_555 ZN ? C ZN . ? A ZN 202 ? 2_555 O ? E HOH . ? A HOH 348 ? 1_555 6.1 ? 16 O ? E HOH . ? A HOH 344 ? 2_555 ZN ? C ZN . ? A ZN 202 ? 2_555 O ? E HOH . ? A HOH 348 ? 1_555 7.3 ? 17 OD1 ? A ASP 25 ? A ASP 19 ? 1_555 ZN ? C ZN . ? A ZN 202 ? 2_555 O ? E HOH . ? A HOH 365 ? 2_555 74.0 ? 18 O ? E HOH . ? A HOH 311 ? 2_555 ZN ? C ZN . ? A ZN 202 ? 2_555 O ? E HOH . ? A HOH 365 ? 2_555 6.3 ? 19 O ? E HOH . ? A HOH 328 ? 1_555 ZN ? C ZN . ? A ZN 202 ? 2_555 O ? E HOH . ? A HOH 365 ? 2_555 3.9 ? 20 O ? E HOH . ? A HOH 344 ? 2_555 ZN ? C ZN . ? A ZN 202 ? 2_555 O ? E HOH . ? A HOH 365 ? 2_555 7.6 ? 21 O ? E HOH . ? A HOH 348 ? 1_555 ZN ? C ZN . ? A ZN 202 ? 2_555 O ? E HOH . ? A HOH 365 ? 2_555 7.0 ? 22 OE1 ? A GLU 85 ? A GLU 79 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 OE1 ? A GLU 88 ? A GLU 82 ? 1_555 105.0 ? 23 OE1 ? A GLU 85 ? A GLU 79 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 OE2 ? A GLU 88 ? A GLU 82 ? 1_555 105.0 ? 24 OE1 ? A GLU 88 ? A GLU 82 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 OE2 ? A GLU 88 ? A GLU 82 ? 1_555 59.7 ? 25 OE1 ? A GLU 85 ? A GLU 79 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 OE1 ? A GLU 110 ? A GLU 104 ? 1_555 94.8 ? 26 OE1 ? A GLU 88 ? A GLU 82 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 OE1 ? A GLU 110 ? A GLU 104 ? 1_555 76.6 ? 27 OE2 ? A GLU 88 ? A GLU 82 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 OE1 ? A GLU 110 ? A GLU 104 ? 1_555 18.2 ? 28 OE1 ? A GLU 85 ? A GLU 79 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 O ? E HOH . ? A HOH 330 ? 1_555 90.7 ? 29 OE1 ? A GLU 88 ? A GLU 82 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 O ? E HOH . ? A HOH 330 ? 1_555 92.0 ? 30 OE2 ? A GLU 88 ? A GLU 82 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 O ? E HOH . ? A HOH 330 ? 1_555 150.1 ? 31 OE1 ? A GLU 110 ? A GLU 104 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 O ? E HOH . ? A HOH 330 ? 1_555 168.3 ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ARG A 72 ? ? -102.52 72.81 2 1 GLN A 130 ? ? 55.90 -126.92 # _pdbx_struct_special_symmetry.id 1 _pdbx_struct_special_symmetry.PDB_model_num 1 _pdbx_struct_special_symmetry.auth_asym_id A _pdbx_struct_special_symmetry.auth_comp_id ZN _pdbx_struct_special_symmetry.auth_seq_id 203 _pdbx_struct_special_symmetry.PDB_ins_code ? _pdbx_struct_special_symmetry.label_asym_id D _pdbx_struct_special_symmetry.label_comp_id ZN _pdbx_struct_special_symmetry.label_seq_id . # loop_ _space_group_symop.id _space_group_symop.operation_xyz 1 x,y,z 2 x+1/2,-y+1/2,-z 3 -x+1/2,y+1/2,-z 4 -x,-y,z # loop_ _pdbx_refine_tls.id _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[1][1]_esd _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][2]_esd _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[1][3]_esd _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[2][2]_esd _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.T[2][3]_esd _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[3][3]_esd _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[1][1]_esd _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][2]_esd _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[1][3]_esd _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[2][2]_esd _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.L[2][3]_esd _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[3][3]_esd _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][1]_esd _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][2]_esd _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[1][3]_esd _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][1]_esd _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][2]_esd _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[2][3]_esd _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][1]_esd _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][2]_esd _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.S[3][3]_esd 1 'X-RAY DIFFRACTION' ? refined 2.09531472587 4.4441261281 10.823212735 0.264909991181 ? -0.0170943855607 ? -0.014306456198 ? 0.192603513796 ? 0.00876103047733 ? 0.139758256564 ? 7.81199094364 ? -5.91578753587 ? -1.1707492316 ? 6.59274003456 ? 1.1821306735 ? 1.77831508406 ? -0.190703567713 ? -0.296352778624 ? -0.293532095563 ? 0.568937618765 ? 0.120684021824 ? 0.14457119928 ? -0.0807716398634 ? -0.00105232929314 ? 0.0816278212886 ? 2 'X-RAY DIFFRACTION' ? refined 5.01527682659 12.3250359034 -1.81847846865 0.152796439166 ? -0.0191246429442 ? -0.00683719421597 ? 0.21519022088 ? 0.0672787500905 ? 0.172605253127 ? 4.89108192907 ? -2.03362792516 ? -1.6353210675 ? 3.21561706072 ? 1.12630577838 ? 2.72396045143 ? 0.21104580736 ? 0.568813585723 ? 0.344375917797 ? -0.181495097828 ? -0.0521374698954 ? -0.182539633353 ? -0.211761650526 ? -0.192437123289 ? -0.157919777599 ? 3 'X-RAY DIFFRACTION' ? refined -22.6647007285 12.0653542539 -2.60091000348 0.176125268506 ? -0.0251292996969 ? -0.0342683808004 ? 0.256502231544 ? 0.0068395797939 ? 0.300970216938 ? 6.78929222183 ? 1.34933335068 ? 2.42090025646 ? 2.28195619032 ? -0.468099764005 ? 2.16855795164 ? -0.198019399817 ? 0.589901617611 ? -0.800019456824 ? 0.116400117231 ? 0.35317142527 ? 0.0828166551544 ? 0.163943279712 ? 0.260716928326 ? -0.196627870332 ? 4 'X-RAY DIFFRACTION' ? refined -23.7727793034 21.7190759531 -4.3497789477 0.276680039265 ? -0.0980305125784 ? -0.047532477805 ? 0.232189161365 ? -0.0232687714459 ? 0.425800143803 ? 9.47342970193 ? -2.30192470524 ? -3.18748827697 ? 2.37849136403 ? 2.36404151951 ? 7.13294861316 ? -0.354087460359 ? 0.239634231877 ? 0.201326406135 ? -0.251017199707 ? 0.581723840193 ? -0.289376840667 ? -0.0887997062135 ? 0.485653168231 ? -0.37529903959 ? 5 'X-RAY DIFFRACTION' ? refined -25.9666789136 18.4549488423 -10.8433015906 0.842538794543 ? -0.18562754083 ? -0.180812810541 ? 0.327905325144 ? 0.0174648730449 ? 0.269684503268 ? 4.30121503005 ? 0.83721434609 ? -0.181772784858 ? 4.74837881021 ? 2.51713485556 ? 6.82033682668 ? 0.320878551003 ? 0.589428936061 ? 0.358596323417 ? -1.47842593635 ? 0.292467780582 ? -0.0593478942901 ? 0.147468096118 ? -0.145490163588 ? -0.206612556134 ? # loop_ _pdbx_refine_tls_group.id _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.beg_PDB_ins_code _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.end_PDB_ins_code _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 1 'X-RAY DIFFRACTION' 1 ? ? ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid -1 through 19 ) ; 2 'X-RAY DIFFRACTION' 2 ? ? ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 20 through 89 ) ; 3 'X-RAY DIFFRACTION' 3 ? ? ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 90 through 110 ) ; 4 'X-RAY DIFFRACTION' 4 ? ? ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 111 through 134 ) ; 5 'X-RAY DIFFRACTION' 5 ? ? ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 135 through 146 ) ; # _pdbx_entry_details.entry_id 8XJG _pdbx_entry_details.has_ligand_of_interest N _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY -5 ? A GLY 1 2 1 Y 1 A SER -4 ? A SER 2 3 1 Y 1 A ALA -3 ? A ALA 3 4 1 Y 1 A LYS -2 ? A LYS 4 5 1 Y 1 A ALA 147 ? A ALA 153 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 GLU N N N N 94 GLU CA C N S 95 GLU C C N N 96 GLU O O N N 97 GLU CB C N N 98 GLU CG C N N 99 GLU CD C N N 100 GLU OE1 O N N 101 GLU OE2 O N N 102 GLU OXT O N N 103 GLU H H N N 104 GLU H2 H N N 105 GLU HA H N N 106 GLU HB2 H N N 107 GLU HB3 H N N 108 GLU HG2 H N N 109 GLU HG3 H N N 110 GLU HE2 H N N 111 GLU HXT H N N 112 GLY N N N N 113 GLY CA C N N 114 GLY C C N N 115 GLY O O N N 116 GLY OXT O N N 117 GLY H H N N 118 GLY H2 H N N 119 GLY HA2 H N N 120 GLY HA3 H N N 121 GLY HXT H N N 122 HOH O O N N 123 HOH H1 H N N 124 HOH H2 H N N 125 ILE N N N N 126 ILE CA C N S 127 ILE C C N N 128 ILE O O N N 129 ILE CB C N S 130 ILE CG1 C N N 131 ILE CG2 C N N 132 ILE CD1 C N N 133 ILE OXT O N N 134 ILE H H N N 135 ILE H2 H N N 136 ILE HA H N N 137 ILE HB H N N 138 ILE HG12 H N N 139 ILE HG13 H N N 140 ILE HG21 H N N 141 ILE HG22 H N N 142 ILE HG23 H N N 143 ILE HD11 H N N 144 ILE HD12 H N N 145 ILE HD13 H N N 146 ILE HXT H N N 147 LEU N N N N 148 LEU CA C N S 149 LEU C C N N 150 LEU O O N N 151 LEU CB C N N 152 LEU CG C N N 153 LEU CD1 C N N 154 LEU CD2 C N N 155 LEU OXT O N N 156 LEU H H N N 157 LEU H2 H N N 158 LEU HA H N N 159 LEU HB2 H N N 160 LEU HB3 H N N 161 LEU HG H N N 162 LEU HD11 H N N 163 LEU HD12 H N N 164 LEU HD13 H N N 165 LEU HD21 H N N 166 LEU HD22 H N N 167 LEU HD23 H N N 168 LEU HXT H N N 169 LYS N N N N 170 LYS CA C N S 171 LYS C C N N 172 LYS O O N N 173 LYS CB C N N 174 LYS CG C N N 175 LYS CD C N N 176 LYS CE C N N 177 LYS NZ N N N 178 LYS OXT O N N 179 LYS H H N N 180 LYS H2 H N N 181 LYS HA H N N 182 LYS HB2 H N N 183 LYS HB3 H N N 184 LYS HG2 H N N 185 LYS HG3 H N N 186 LYS HD2 H N N 187 LYS HD3 H N N 188 LYS HE2 H N N 189 LYS HE3 H N N 190 LYS HZ1 H N N 191 LYS HZ2 H N N 192 LYS HZ3 H N N 193 LYS HXT H N N 194 MET N N N N 195 MET CA C N S 196 MET C C N N 197 MET O O N N 198 MET CB C N N 199 MET CG C N N 200 MET SD S N N 201 MET CE C N N 202 MET OXT O N N 203 MET H H N N 204 MET H2 H N N 205 MET HA H N N 206 MET HB2 H N N 207 MET HB3 H N N 208 MET HG2 H N N 209 MET HG3 H N N 210 MET HE1 H N N 211 MET HE2 H N N 212 MET HE3 H N N 213 MET HXT H N N 214 PHE N N N N 215 PHE CA C N S 216 PHE C C N N 217 PHE O O N N 218 PHE CB C N N 219 PHE CG C Y N 220 PHE CD1 C Y N 221 PHE CD2 C Y N 222 PHE CE1 C Y N 223 PHE CE2 C Y N 224 PHE CZ C Y N 225 PHE OXT O N N 226 PHE H H N N 227 PHE H2 H N N 228 PHE HA H N N 229 PHE HB2 H N N 230 PHE HB3 H N N 231 PHE HD1 H N N 232 PHE HD2 H N N 233 PHE HE1 H N N 234 PHE HE2 H N N 235 PHE HZ H N N 236 PHE HXT H N N 237 PRO N N N N 238 PRO CA C N S 239 PRO C C N N 240 PRO O O N N 241 PRO CB C N N 242 PRO CG C N N 243 PRO CD C N N 244 PRO OXT O N N 245 PRO H H N N 246 PRO HA H N N 247 PRO HB2 H N N 248 PRO HB3 H N N 249 PRO HG2 H N N 250 PRO HG3 H N N 251 PRO HD2 H N N 252 PRO HD3 H N N 253 PRO HXT H N N 254 SER N N N N 255 SER CA C N S 256 SER C C N N 257 SER O O N N 258 SER CB C N N 259 SER OG O N N 260 SER OXT O N N 261 SER H H N N 262 SER H2 H N N 263 SER HA H N N 264 SER HB2 H N N 265 SER HB3 H N N 266 SER HG H N N 267 SER HXT H N N 268 THR N N N N 269 THR CA C N S 270 THR C C N N 271 THR O O N N 272 THR CB C N R 273 THR OG1 O N N 274 THR CG2 C N N 275 THR OXT O N N 276 THR H H N N 277 THR H2 H N N 278 THR HA H N N 279 THR HB H N N 280 THR HG1 H N N 281 THR HG21 H N N 282 THR HG22 H N N 283 THR HG23 H N N 284 THR HXT H N N 285 TYR N N N N 286 TYR CA C N S 287 TYR C C N N 288 TYR O O N N 289 TYR CB C N N 290 TYR CG C Y N 291 TYR CD1 C Y N 292 TYR CD2 C Y N 293 TYR CE1 C Y N 294 TYR CE2 C Y N 295 TYR CZ C Y N 296 TYR OH O N N 297 TYR OXT O N N 298 TYR H H N N 299 TYR H2 H N N 300 TYR HA H N N 301 TYR HB2 H N N 302 TYR HB3 H N N 303 TYR HD1 H N N 304 TYR HD2 H N N 305 TYR HE1 H N N 306 TYR HE2 H N N 307 TYR HH H N N 308 TYR HXT H N N 309 VAL N N N N 310 VAL CA C N S 311 VAL C C N N 312 VAL O O N N 313 VAL CB C N N 314 VAL CG1 C N N 315 VAL CG2 C N N 316 VAL OXT O N N 317 VAL H H N N 318 VAL H2 H N N 319 VAL HA H N N 320 VAL HB H N N 321 VAL HG11 H N N 322 VAL HG12 H N N 323 VAL HG13 H N N 324 VAL HG21 H N N 325 VAL HG22 H N N 326 VAL HG23 H N N 327 VAL HXT H N N 328 ZN ZN ZN N N 329 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 HOH O H1 sing N N 116 HOH O H2 sing N N 117 ILE N CA sing N N 118 ILE N H sing N N 119 ILE N H2 sing N N 120 ILE CA C sing N N 121 ILE CA CB sing N N 122 ILE CA HA sing N N 123 ILE C O doub N N 124 ILE C OXT sing N N 125 ILE CB CG1 sing N N 126 ILE CB CG2 sing N N 127 ILE CB HB sing N N 128 ILE CG1 CD1 sing N N 129 ILE CG1 HG12 sing N N 130 ILE CG1 HG13 sing N N 131 ILE CG2 HG21 sing N N 132 ILE CG2 HG22 sing N N 133 ILE CG2 HG23 sing N N 134 ILE CD1 HD11 sing N N 135 ILE CD1 HD12 sing N N 136 ILE CD1 HD13 sing N N 137 ILE OXT HXT sing N N 138 LEU N CA sing N N 139 LEU N H sing N N 140 LEU N H2 sing N N 141 LEU CA C sing N N 142 LEU CA CB sing N N 143 LEU CA HA sing N N 144 LEU C O doub N N 145 LEU C OXT sing N N 146 LEU CB CG sing N N 147 LEU CB HB2 sing N N 148 LEU CB HB3 sing N N 149 LEU CG CD1 sing N N 150 LEU CG CD2 sing N N 151 LEU CG HG sing N N 152 LEU CD1 HD11 sing N N 153 LEU CD1 HD12 sing N N 154 LEU CD1 HD13 sing N N 155 LEU CD2 HD21 sing N N 156 LEU CD2 HD22 sing N N 157 LEU CD2 HD23 sing N N 158 LEU OXT HXT sing N N 159 LYS N CA sing N N 160 LYS N H sing N N 161 LYS N H2 sing N N 162 LYS CA C sing N N 163 LYS CA CB sing N N 164 LYS CA HA sing N N 165 LYS C O doub N N 166 LYS C OXT sing N N 167 LYS CB CG sing N N 168 LYS CB HB2 sing N N 169 LYS CB HB3 sing N N 170 LYS CG CD sing N N 171 LYS CG HG2 sing N N 172 LYS CG HG3 sing N N 173 LYS CD CE sing N N 174 LYS CD HD2 sing N N 175 LYS CD HD3 sing N N 176 LYS CE NZ sing N N 177 LYS CE HE2 sing N N 178 LYS CE HE3 sing N N 179 LYS NZ HZ1 sing N N 180 LYS NZ HZ2 sing N N 181 LYS NZ HZ3 sing N N 182 LYS OXT HXT sing N N 183 MET N CA sing N N 184 MET N H sing N N 185 MET N H2 sing N N 186 MET CA C sing N N 187 MET CA CB sing N N 188 MET CA HA sing N N 189 MET C O doub N N 190 MET C OXT sing N N 191 MET CB CG sing N N 192 MET CB HB2 sing N N 193 MET CB HB3 sing N N 194 MET CG SD sing N N 195 MET CG HG2 sing N N 196 MET CG HG3 sing N N 197 MET SD CE sing N N 198 MET CE HE1 sing N N 199 MET CE HE2 sing N N 200 MET CE HE3 sing N N 201 MET OXT HXT sing N N 202 PHE N CA sing N N 203 PHE N H sing N N 204 PHE N H2 sing N N 205 PHE CA C sing N N 206 PHE CA CB sing N N 207 PHE CA HA sing N N 208 PHE C O doub N N 209 PHE C OXT sing N N 210 PHE CB CG sing N N 211 PHE CB HB2 sing N N 212 PHE CB HB3 sing N N 213 PHE CG CD1 doub Y N 214 PHE CG CD2 sing Y N 215 PHE CD1 CE1 sing Y N 216 PHE CD1 HD1 sing N N 217 PHE CD2 CE2 doub Y N 218 PHE CD2 HD2 sing N N 219 PHE CE1 CZ doub Y N 220 PHE CE1 HE1 sing N N 221 PHE CE2 CZ sing Y N 222 PHE CE2 HE2 sing N N 223 PHE CZ HZ sing N N 224 PHE OXT HXT sing N N 225 PRO N CA sing N N 226 PRO N CD sing N N 227 PRO N H sing N N 228 PRO CA C sing N N 229 PRO CA CB sing N N 230 PRO CA HA sing N N 231 PRO C O doub N N 232 PRO C OXT sing N N 233 PRO CB CG sing N N 234 PRO CB HB2 sing N N 235 PRO CB HB3 sing N N 236 PRO CG CD sing N N 237 PRO CG HG2 sing N N 238 PRO CG HG3 sing N N 239 PRO CD HD2 sing N N 240 PRO CD HD3 sing N N 241 PRO OXT HXT sing N N 242 SER N CA sing N N 243 SER N H sing N N 244 SER N H2 sing N N 245 SER CA C sing N N 246 SER CA CB sing N N 247 SER CA HA sing N N 248 SER C O doub N N 249 SER C OXT sing N N 250 SER CB OG sing N N 251 SER CB HB2 sing N N 252 SER CB HB3 sing N N 253 SER OG HG sing N N 254 SER OXT HXT sing N N 255 THR N CA sing N N 256 THR N H sing N N 257 THR N H2 sing N N 258 THR CA C sing N N 259 THR CA CB sing N N 260 THR CA HA sing N N 261 THR C O doub N N 262 THR C OXT sing N N 263 THR CB OG1 sing N N 264 THR CB CG2 sing N N 265 THR CB HB sing N N 266 THR OG1 HG1 sing N N 267 THR CG2 HG21 sing N N 268 THR CG2 HG22 sing N N 269 THR CG2 HG23 sing N N 270 THR OXT HXT sing N N 271 TYR N CA sing N N 272 TYR N H sing N N 273 TYR N H2 sing N N 274 TYR CA C sing N N 275 TYR CA CB sing N N 276 TYR CA HA sing N N 277 TYR C O doub N N 278 TYR C OXT sing N N 279 TYR CB CG sing N N 280 TYR CB HB2 sing N N 281 TYR CB HB3 sing N N 282 TYR CG CD1 doub Y N 283 TYR CG CD2 sing Y N 284 TYR CD1 CE1 sing Y N 285 TYR CD1 HD1 sing N N 286 TYR CD2 CE2 doub Y N 287 TYR CD2 HD2 sing N N 288 TYR CE1 CZ doub Y N 289 TYR CE1 HE1 sing N N 290 TYR CE2 CZ sing Y N 291 TYR CE2 HE2 sing N N 292 TYR CZ OH sing N N 293 TYR OH HH sing N N 294 TYR OXT HXT sing N N 295 VAL N CA sing N N 296 VAL N H sing N N 297 VAL N H2 sing N N 298 VAL CA C sing N N 299 VAL CA CB sing N N 300 VAL CA HA sing N N 301 VAL C O doub N N 302 VAL C OXT sing N N 303 VAL CB CG1 sing N N 304 VAL CB CG2 sing N N 305 VAL CB HB sing N N 306 VAL CG1 HG11 sing N N 307 VAL CG1 HG12 sing N N 308 VAL CG1 HG13 sing N N 309 VAL CG2 HG21 sing N N 310 VAL CG2 HG22 sing N N 311 VAL CG2 HG23 sing N N 312 VAL OXT HXT sing N N 313 # _pdbx_audit_support.funding_organization 'National Research Foundation (NRF, Korea)' _pdbx_audit_support.country 'Korea, Republic Of' _pdbx_audit_support.grant_number RS-2023-00208153 _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'in silico model' _pdbx_initial_refinement_model.source_name AlphaFold _pdbx_initial_refinement_model.accession_code ? _pdbx_initial_refinement_model.details ? # _space_group.name_H-M_alt 'P 21 21 2' _space_group.name_Hall 'P 2 2ab' _space_group.IT_number 18 _space_group.crystal_system orthorhombic _space_group.id 1 # _atom_sites.entry_id 8XJG _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 0.022872 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.009296 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.028843 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.scat_dispersion_real _atom_type.scat_dispersion_imag _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c _atom_type.scat_source _atom_type.scat_dispersion_source C ? ? 3.54356 2.42580 ? ? 25.62398 1.50364 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? N ? ? 4.01032 2.96436 ? ? 19.97189 1.75589 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O ? ? 4.49882 3.47563 ? ? 15.80542 1.70748 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? S ? ? 9.55732 6.39887 ? ? 1.23737 29.19336 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? ZN ? ? 24.64596 5.25405 ? ? 2.14387 29.76375 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? # loop_