data_8XLB # _entry.id 8XLB # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.399 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 8XLB pdb_00008xlb 10.2210/pdb8xlb/pdb WWPDB D_1300043725 ? ? BMRB 36633 ? 10.13018/BMR36633 # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2025-02-05 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr . _pdbx_database_status.entry_id 8XLB _pdbx_database_status.recvd_initial_deposition_date 2023-12-25 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs . _pdbx_database_status.status_code_nmr_data REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_database_related.db_name BMRB _pdbx_database_related.details 'Clamda3 domain of human immunoglobulin' _pdbx_database_related.db_id 36633 _pdbx_database_related.content_type unspecified # _pdbx_contact_author.id 3 _pdbx_contact_author.email kkatonmr@ims.ac.jp _pdbx_contact_author.name_first Koichi _pdbx_contact_author.name_last Kato _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0001-7187-9612 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Yanaka, S.' 1 ? 'Kodama, A.' 2 ? 'Miyanoiri, Y.' 3 ? 'Kato, K.' 4 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Int.Immunol. _citation.journal_id_ASTM INIMEN _citation.journal_id_CSD 0759 _citation.journal_id_ISSN 1460-2377 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 36 _citation.language ? _citation.page_first 405 _citation.page_last 412 _citation.title 'Identification of potential C1-binding sites in the immunoglobulin CL domains.' _citation.year 2024 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1093/intimm/dxae017 _citation.pdbx_database_id_PubMed 38564192 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Yanaka, S.' 1 0000-0002-3513-5701 primary 'Kodama, A.' 2 ? primary 'Nishiguchi, S.' 3 ? primary 'Fujita, R.' 4 ? primary 'Shen, J.' 5 ? primary 'Boonsri, P.' 6 ? primary 'Sung, D.' 7 ? primary 'Isono, Y.' 8 ? primary 'Yagi, H.' 9 ? primary 'Miyanoiri, Y.' 10 ? primary 'Uchihashi, T.' 11 ? primary 'Kato, K.' 12 0000-0001-7187-9612 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Immunoglobulin lambda constant 3' _entity.formula_weight 11981.213 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Ig lambda chain C region DOT,Ig lambda chain C region NEWM,Ig lambda-3 chain C regions' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;QPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVNAGVETTKPSKQSNNKYAASSYLSLTPEQWKS HKSYSCQVTHEGSTVEKTVAPAESSENLYFQ ; _entity_poly.pdbx_seq_one_letter_code_can ;QPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVNAGVETTKPSKQSNNKYAASSYLSLTPEQWKS HKSYSCQVTHEGSTVEKTVAPAESSENLYFQ ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLN n 1 2 PRO n 1 3 LYS n 1 4 ALA n 1 5 ALA n 1 6 PRO n 1 7 SER n 1 8 VAL n 1 9 THR n 1 10 LEU n 1 11 PHE n 1 12 PRO n 1 13 PRO n 1 14 SER n 1 15 SER n 1 16 GLU n 1 17 GLU n 1 18 LEU n 1 19 GLN n 1 20 ALA n 1 21 ASN n 1 22 LYS n 1 23 ALA n 1 24 THR n 1 25 LEU n 1 26 VAL n 1 27 CYS n 1 28 LEU n 1 29 ILE n 1 30 SER n 1 31 ASP n 1 32 PHE n 1 33 TYR n 1 34 PRO n 1 35 GLY n 1 36 ALA n 1 37 VAL n 1 38 THR n 1 39 VAL n 1 40 ALA n 1 41 TRP n 1 42 LYS n 1 43 ALA n 1 44 ASP n 1 45 SER n 1 46 SER n 1 47 PRO n 1 48 VAL n 1 49 ASN n 1 50 ALA n 1 51 GLY n 1 52 VAL n 1 53 GLU n 1 54 THR n 1 55 THR n 1 56 LYS n 1 57 PRO n 1 58 SER n 1 59 LYS n 1 60 GLN n 1 61 SER n 1 62 ASN n 1 63 ASN n 1 64 LYS n 1 65 TYR n 1 66 ALA n 1 67 ALA n 1 68 SER n 1 69 SER n 1 70 TYR n 1 71 LEU n 1 72 SER n 1 73 LEU n 1 74 THR n 1 75 PRO n 1 76 GLU n 1 77 GLN n 1 78 TRP n 1 79 LYS n 1 80 SER n 1 81 HIS n 1 82 LYS n 1 83 SER n 1 84 TYR n 1 85 SER n 1 86 CYS n 1 87 GLN n 1 88 VAL n 1 89 THR n 1 90 HIS n 1 91 GLU n 1 92 GLY n 1 93 SER n 1 94 THR n 1 95 VAL n 1 96 GLU n 1 97 LYS n 1 98 THR n 1 99 VAL n 1 100 ALA n 1 101 PRO n 1 102 ALA n 1 103 GLU n 1 104 SER n 1 105 SER n 1 106 GLU n 1 107 ASN n 1 108 LEU n 1 109 TYR n 1 110 PHE n 1 111 GLN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 111 _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene IGLC3 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLN 1 1 1 GLN GLN A . n A 1 2 PRO 2 2 2 PRO PRO A . n A 1 3 LYS 3 3 3 LYS LYS A . n A 1 4 ALA 4 4 4 ALA ALA A . n A 1 5 ALA 5 5 5 ALA ALA A . n A 1 6 PRO 6 6 6 PRO PRO A . n A 1 7 SER 7 7 7 SER SER A . n A 1 8 VAL 8 8 8 VAL VAL A . n A 1 9 THR 9 9 9 THR THR A . n A 1 10 LEU 10 10 10 LEU LEU A . n A 1 11 PHE 11 11 11 PHE PHE A . n A 1 12 PRO 12 12 12 PRO PRO A . n A 1 13 PRO 13 13 13 PRO PRO A . n A 1 14 SER 14 14 14 SER SER A . n A 1 15 SER 15 15 15 SER SER A . n A 1 16 GLU 16 16 16 GLU GLU A . n A 1 17 GLU 17 17 17 GLU GLU A . n A 1 18 LEU 18 18 18 LEU LEU A . n A 1 19 GLN 19 19 19 GLN GLN A . n A 1 20 ALA 20 20 20 ALA ALA A . n A 1 21 ASN 21 21 21 ASN ASN A . n A 1 22 LYS 22 22 22 LYS LYS A . n A 1 23 ALA 23 23 23 ALA ALA A . n A 1 24 THR 24 24 24 THR THR A . n A 1 25 LEU 25 25 25 LEU LEU A . n A 1 26 VAL 26 26 26 VAL VAL A . n A 1 27 CYS 27 27 27 CYS CYS A . n A 1 28 LEU 28 28 28 LEU LEU A . n A 1 29 ILE 29 29 29 ILE ILE A . n A 1 30 SER 30 30 30 SER SER A . n A 1 31 ASP 31 31 31 ASP ASP A . n A 1 32 PHE 32 32 32 PHE PHE A . n A 1 33 TYR 33 33 33 TYR TYR A . n A 1 34 PRO 34 34 34 PRO PRO A . n A 1 35 GLY 35 35 35 GLY GLY A . n A 1 36 ALA 36 36 36 ALA ALA A . n A 1 37 VAL 37 37 37 VAL VAL A . n A 1 38 THR 38 38 38 THR THR A . n A 1 39 VAL 39 39 39 VAL VAL A . n A 1 40 ALA 40 40 40 ALA ALA A . n A 1 41 TRP 41 41 41 TRP TRP A . n A 1 42 LYS 42 42 42 LYS LYS A . n A 1 43 ALA 43 43 43 ALA ALA A . n A 1 44 ASP 44 44 44 ASP ASP A . n A 1 45 SER 45 45 45 SER SER A . n A 1 46 SER 46 46 46 SER SER A . n A 1 47 PRO 47 47 47 PRO PRO A . n A 1 48 VAL 48 48 48 VAL VAL A . n A 1 49 ASN 49 49 49 ASN ASN A . n A 1 50 ALA 50 50 50 ALA ALA A . n A 1 51 GLY 51 51 51 GLY GLY A . n A 1 52 VAL 52 52 52 VAL VAL A . n A 1 53 GLU 53 53 53 GLU GLU A . n A 1 54 THR 54 54 54 THR THR A . n A 1 55 THR 55 55 55 THR THR A . n A 1 56 LYS 56 56 56 LYS LYS A . n A 1 57 PRO 57 57 57 PRO PRO A . n A 1 58 SER 58 58 58 SER SER A . n A 1 59 LYS 59 59 59 LYS LYS A . n A 1 60 GLN 60 60 60 GLN GLN A . n A 1 61 SER 61 61 61 SER SER A . n A 1 62 ASN 62 62 62 ASN ASN A . n A 1 63 ASN 63 63 63 ASN ASN A . n A 1 64 LYS 64 64 64 LYS LYS A . n A 1 65 TYR 65 65 65 TYR TYR A . n A 1 66 ALA 66 66 66 ALA ALA A . n A 1 67 ALA 67 67 67 ALA ALA A . n A 1 68 SER 68 68 68 SER SER A . n A 1 69 SER 69 69 69 SER SER A . n A 1 70 TYR 70 70 70 TYR TYR A . n A 1 71 LEU 71 71 71 LEU LEU A . n A 1 72 SER 72 72 72 SER SER A . n A 1 73 LEU 73 73 73 LEU LEU A . n A 1 74 THR 74 74 74 THR THR A . n A 1 75 PRO 75 75 75 PRO PRO A . n A 1 76 GLU 76 76 76 GLU GLU A . n A 1 77 GLN 77 77 77 GLN GLN A . n A 1 78 TRP 78 78 78 TRP TRP A . n A 1 79 LYS 79 79 79 LYS LYS A . n A 1 80 SER 80 80 80 SER SER A . n A 1 81 HIS 81 81 81 HIS HIS A . n A 1 82 LYS 82 82 82 LYS LYS A . n A 1 83 SER 83 83 83 SER SER A . n A 1 84 TYR 84 84 84 TYR TYR A . n A 1 85 SER 85 85 85 SER SER A . n A 1 86 CYS 86 86 86 CYS CYS A . n A 1 87 GLN 87 87 87 GLN GLN A . n A 1 88 VAL 88 88 88 VAL VAL A . n A 1 89 THR 89 89 89 THR THR A . n A 1 90 HIS 90 90 90 HIS HIS A . n A 1 91 GLU 91 91 91 GLU GLU A . n A 1 92 GLY 92 92 92 GLY GLY A . n A 1 93 SER 93 93 93 SER SER A . n A 1 94 THR 94 94 94 THR THR A . n A 1 95 VAL 95 95 95 VAL VAL A . n A 1 96 GLU 96 96 96 GLU GLU A . n A 1 97 LYS 97 97 97 LYS LYS A . n A 1 98 THR 98 98 98 THR THR A . n A 1 99 VAL 99 99 99 VAL VAL A . n A 1 100 ALA 100 100 100 ALA ALA A . n A 1 101 PRO 101 101 101 PRO PRO A . n A 1 102 ALA 102 102 102 ALA ALA A . n A 1 103 GLU 103 103 103 GLU GLU A . n A 1 104 SER 104 104 104 SER SER A . n A 1 105 SER 105 105 105 SER SER A . n A 1 106 GLU 106 106 106 GLU GLU A . n A 1 107 ASN 107 107 107 ASN ASN A . n A 1 108 LEU 108 108 108 LEU LEU A . n A 1 109 TYR 109 109 109 TYR TYR A . n A 1 110 PHE 110 110 110 PHE PHE A . n A 1 111 GLN 111 111 111 GLN GLN A . n # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 8XLB _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 8XLB _struct.title 'Clamda3 domain of human immunoglobulin' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 8XLB _struct_keywords.text 'STRUCTURE FROM CYANA 3.98.15, IMMUNE SYSTEM' _struct_keywords.pdbx_keywords 'IMMUNE SYSTEM' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code IGLC3_HUMAN _struct_ref.pdbx_db_accession P0DOY3 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;QPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKS HKSYSCQVTHEGSTVEKTVAP ; _struct_ref.pdbx_align_begin 2 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 8XLB _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 101 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P0DOY3 _struct_ref_seq.db_align_beg 2 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 102 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 101 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 8XLB ASN A 49 ? UNP P0DOY3 LYS 50 conflict 49 1 1 8XLB LYS A 56 ? UNP P0DOY3 THR 57 conflict 56 2 1 8XLB ALA A 102 ? UNP P0DOY3 ? ? 'expression tag' 102 3 1 8XLB GLU A 103 ? UNP P0DOY3 ? ? 'expression tag' 103 4 1 8XLB SER A 104 ? UNP P0DOY3 ? ? 'expression tag' 104 5 1 8XLB SER A 105 ? UNP P0DOY3 ? ? 'expression tag' 105 6 1 8XLB GLU A 106 ? UNP P0DOY3 ? ? 'expression tag' 106 7 1 8XLB ASN A 107 ? UNP P0DOY3 ? ? 'expression tag' 107 8 1 8XLB LEU A 108 ? UNP P0DOY3 ? ? 'expression tag' 108 9 1 8XLB TYR A 109 ? UNP P0DOY3 ? ? 'expression tag' 109 10 1 8XLB PHE A 110 ? UNP P0DOY3 ? ? 'expression tag' 110 11 1 8XLB GLN A 111 ? UNP P0DOY3 ? ? 'expression tag' 111 12 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'NMR Distance Restraints' _pdbx_struct_assembly_auth_evidence.details 'not applicable' # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0 _pdbx_struct_oper_list.matrix[1][2] 0.0 _pdbx_struct_oper_list.matrix[1][3] 0.0 _pdbx_struct_oper_list.vector[1] 0.0 _pdbx_struct_oper_list.matrix[2][1] 0.0 _pdbx_struct_oper_list.matrix[2][2] 1.0 _pdbx_struct_oper_list.matrix[2][3] 0.0 _pdbx_struct_oper_list.vector[2] 0.0 _pdbx_struct_oper_list.matrix[3][1] 0.0 _pdbx_struct_oper_list.matrix[3][2] 0.0 _pdbx_struct_oper_list.matrix[3][3] 1.0 _pdbx_struct_oper_list.vector[3] 0.0 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 SER A 14 ? ALA A 20 ? SER A 14 ALA A 20 1 ? 7 HELX_P HELX_P2 AA2 THR A 74 ? SER A 80 ? THR A 74 SER A 80 1 ? 7 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id disulf1 _struct_conn.conn_type_id disulf _struct_conn.pdbx_leaving_atom_flag ? _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id CYS _struct_conn.ptnr1_label_seq_id 27 _struct_conn.ptnr1_label_atom_id SG _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id A _struct_conn.ptnr2_label_comp_id CYS _struct_conn.ptnr2_label_seq_id 86 _struct_conn.ptnr2_label_atom_id SG _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id CYS _struct_conn.ptnr1_auth_seq_id 27 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id CYS _struct_conn.ptnr2_auth_seq_id 86 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 2.104 _struct_conn.pdbx_value_order ? _struct_conn.pdbx_role ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # _pdbx_modification_feature.ordinal 1 _pdbx_modification_feature.label_comp_id CYS _pdbx_modification_feature.label_asym_id A _pdbx_modification_feature.label_seq_id 27 _pdbx_modification_feature.label_alt_id ? _pdbx_modification_feature.modified_residue_label_comp_id CYS _pdbx_modification_feature.modified_residue_label_asym_id A _pdbx_modification_feature.modified_residue_label_seq_id 86 _pdbx_modification_feature.modified_residue_label_alt_id ? _pdbx_modification_feature.auth_comp_id CYS _pdbx_modification_feature.auth_asym_id A _pdbx_modification_feature.auth_seq_id 27 _pdbx_modification_feature.PDB_ins_code ? _pdbx_modification_feature.symmetry 1_555 _pdbx_modification_feature.modified_residue_auth_comp_id CYS _pdbx_modification_feature.modified_residue_auth_asym_id A _pdbx_modification_feature.modified_residue_auth_seq_id 86 _pdbx_modification_feature.modified_residue_PDB_ins_code ? _pdbx_modification_feature.modified_residue_symmetry 1_555 _pdbx_modification_feature.comp_id_linking_atom SG _pdbx_modification_feature.modified_residue_id_linking_atom SG _pdbx_modification_feature.modified_residue_id . _pdbx_modification_feature.ref_pcm_id . _pdbx_modification_feature.ref_comp_id . _pdbx_modification_feature.type None _pdbx_modification_feature.category 'Disulfide bridge' # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 4 ? AA2 ? 4 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 LEU A 10 ? PHE A 11 ? LEU A 10 PHE A 11 AA1 2 ALA A 23 ? PHE A 32 ? ALA A 23 PHE A 32 AA1 3 TYR A 65 ? LEU A 73 ? TYR A 65 LEU A 73 AA1 4 VAL A 52 ? LYS A 59 ? VAL A 52 LYS A 59 AA2 1 PRO A 47 ? VAL A 48 ? PRO A 47 VAL A 48 AA2 2 THR A 38 ? LYS A 42 ? THR A 38 LYS A 42 AA2 3 SER A 85 ? HIS A 90 ? SER A 85 HIS A 90 AA2 4 SER A 93 ? VAL A 95 ? SER A 93 VAL A 95 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N PHE A 11 ? N PHE A 11 O VAL A 26 ? O VAL A 26 AA1 2 3 N ILE A 29 ? N ILE A 29 O ALA A 67 ? O ALA A 67 AA1 3 4 O TYR A 70 ? O TYR A 70 N GLU A 53 ? N GLU A 53 AA2 1 2 O VAL A 48 ? O VAL A 48 N TRP A 41 ? N TRP A 41 AA2 2 3 N LYS A 42 ? N LYS A 42 O SER A 85 ? O SER A 85 AA2 3 4 N HIS A 90 ? N HIS A 90 O SER A 93 ? O SER A 93 # _pdbx_entry_details.entry_id 8XLB _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PRO A 2 ? ? -69.75 -173.41 2 1 ASN A 21 ? ? 63.80 62.16 3 1 TYR A 33 ? ? -45.67 164.87 4 1 PRO A 34 ? ? -69.68 65.35 5 1 ASP A 44 ? ? -21.50 -84.66 6 1 ASN A 49 ? ? -144.96 -53.74 7 1 PRO A 57 ? ? -69.77 -178.46 8 1 ASN A 107 ? ? -128.84 -169.78 9 2 PRO A 2 ? ? -69.80 -171.98 10 2 ASN A 21 ? ? 63.15 62.36 11 2 TYR A 33 ? ? -45.90 164.70 12 2 PRO A 34 ? ? -69.67 66.04 13 2 ASP A 44 ? ? 42.21 -107.14 14 2 ASN A 49 ? ? -140.30 -52.88 15 2 PRO A 101 ? ? -69.77 -172.52 16 2 ASN A 107 ? ? -51.71 -74.78 17 3 PRO A 2 ? ? -69.75 -172.24 18 3 ASN A 21 ? ? 63.13 61.50 19 3 TYR A 33 ? ? -45.57 164.87 20 3 PRO A 34 ? ? -69.76 65.26 21 3 ASP A 44 ? ? -23.96 -83.96 22 3 ASN A 49 ? ? -142.31 -54.81 23 3 PRO A 57 ? ? -69.73 -177.76 24 3 ASN A 63 ? ? 70.93 -0.05 25 3 SER A 105 ? ? -104.44 -169.01 26 4 PRO A 2 ? ? -69.77 -174.04 27 4 ASN A 21 ? ? 63.38 61.73 28 4 TYR A 33 ? ? -45.89 165.02 29 4 PRO A 34 ? ? -69.80 65.53 30 4 ASP A 44 ? ? -24.02 -83.83 31 4 ASN A 49 ? ? -148.62 -51.21 32 4 PRO A 57 ? ? -69.74 -178.99 33 4 ASN A 63 ? ? 70.81 -0.27 34 4 PRO A 101 ? ? -69.74 -175.41 35 4 GLU A 103 ? ? -67.08 -171.76 36 4 SER A 105 ? ? -99.34 -75.11 37 4 GLU A 106 ? ? -95.64 44.35 38 5 PRO A 2 ? ? -69.77 -171.89 39 5 ASN A 21 ? ? 62.94 61.99 40 5 TYR A 33 ? ? -45.79 164.95 41 5 PRO A 34 ? ? -69.79 64.89 42 5 ASP A 44 ? ? -23.20 -83.84 43 5 ASN A 49 ? ? -145.10 -54.98 44 5 PRO A 57 ? ? -69.70 -177.27 45 5 ASN A 63 ? ? 71.04 -0.63 46 5 SER A 104 ? ? -103.61 66.53 47 5 SER A 105 ? ? -65.65 -75.14 48 5 GLU A 106 ? ? -100.63 48.49 49 5 ASN A 107 ? ? -84.20 -74.74 50 6 PRO A 2 ? ? -69.80 -173.64 51 6 ASN A 21 ? ? 63.81 63.15 52 6 TYR A 33 ? ? -45.55 164.73 53 6 PRO A 34 ? ? -69.70 65.24 54 6 ASP A 44 ? ? -23.29 -83.58 55 6 ASN A 49 ? ? -152.80 -50.16 56 6 PRO A 57 ? ? -69.73 -178.56 57 6 ASN A 63 ? ? 70.98 -0.92 58 6 SER A 105 ? ? -120.28 -169.49 59 6 GLU A 106 ? ? -57.03 99.76 60 7 PRO A 2 ? ? -69.75 -173.22 61 7 ASN A 21 ? ? 63.86 62.88 62 7 TYR A 33 ? ? -45.55 164.81 63 7 PRO A 34 ? ? -69.75 66.59 64 7 ASP A 44 ? ? -23.84 -83.55 65 7 ASN A 49 ? ? -148.62 -53.23 66 7 PRO A 101 ? ? -69.72 -178.36 67 7 ASN A 107 ? ? -121.66 -74.58 68 8 PRO A 2 ? ? -69.76 -175.13 69 8 ASN A 21 ? ? 63.32 62.03 70 8 TYR A 33 ? ? -45.95 164.98 71 8 PRO A 34 ? ? -69.77 65.27 72 8 ASP A 44 ? ? -22.42 -84.12 73 8 ASN A 49 ? ? -141.81 -51.89 74 8 PRO A 57 ? ? -69.77 -176.60 75 8 ASN A 63 ? ? 71.02 -0.81 76 8 SER A 104 ? ? -95.09 38.90 77 8 ASN A 107 ? ? -64.29 -170.56 78 9 PRO A 2 ? ? -69.72 -170.27 79 9 ASN A 21 ? ? 63.74 62.04 80 9 TYR A 33 ? ? -45.60 164.99 81 9 PRO A 34 ? ? -69.77 65.29 82 9 ASP A 44 ? ? -20.10 -85.24 83 9 ASN A 49 ? ? -141.51 -54.40 84 9 PRO A 57 ? ? -69.78 -177.55 85 9 GLU A 103 ? ? -57.14 175.23 86 9 SER A 105 ? ? -65.06 -75.01 87 9 GLU A 106 ? ? -105.35 42.15 88 10 PRO A 2 ? ? -69.74 -175.24 89 10 ASN A 21 ? ? 63.53 61.67 90 10 TYR A 33 ? ? -45.72 165.03 91 10 PRO A 34 ? ? -69.71 64.96 92 10 ASP A 44 ? ? -23.72 -83.90 93 10 ASN A 49 ? ? -140.96 -55.25 94 10 PRO A 57 ? ? -69.70 -178.21 95 10 ASN A 63 ? ? 70.91 -0.74 96 10 ASN A 107 ? ? -109.70 -74.89 97 11 PRO A 2 ? ? -69.75 -174.58 98 11 TYR A 33 ? ? -45.82 164.81 99 11 PRO A 34 ? ? -69.71 65.44 100 11 ASP A 44 ? ? -9.58 -89.58 101 11 ASN A 49 ? ? -140.87 -53.07 102 11 PRO A 57 ? ? -69.78 -178.99 103 11 ASN A 63 ? ? 70.68 -0.15 104 11 PRO A 101 ? ? -69.75 -167.28 105 11 ALA A 102 ? ? -49.99 150.98 106 11 SER A 104 ? ? -91.58 44.95 107 11 ASN A 107 ? ? -75.10 -76.37 108 12 PRO A 2 ? ? -69.79 -175.17 109 12 ASN A 21 ? ? 63.27 61.96 110 12 TYR A 33 ? ? -46.16 165.18 111 12 PRO A 34 ? ? -69.83 66.21 112 12 ASP A 44 ? ? -23.87 -83.99 113 12 ASN A 49 ? ? -147.83 -53.38 114 12 PRO A 101 ? ? -69.73 -169.25 115 12 GLU A 103 ? ? -61.35 -169.44 116 13 PRO A 2 ? ? -69.73 -172.00 117 13 ASN A 21 ? ? 63.23 62.82 118 13 TYR A 33 ? ? -45.46 164.66 119 13 PRO A 34 ? ? -69.80 64.81 120 13 ASP A 44 ? ? -23.56 -83.64 121 13 ASN A 49 ? ? -147.62 -53.50 122 13 PRO A 57 ? ? -69.76 -176.20 123 13 ASN A 63 ? ? 70.86 -0.48 124 13 SER A 104 ? ? -92.02 45.75 125 13 GLU A 106 ? ? -66.98 94.03 126 14 PRO A 2 ? ? -69.75 -176.27 127 14 ASN A 21 ? ? 64.02 62.55 128 14 TYR A 33 ? ? -45.46 164.74 129 14 PRO A 34 ? ? -69.68 65.08 130 14 ASP A 44 ? ? -10.62 -88.91 131 14 ASN A 49 ? ? -136.82 -54.27 132 14 PRO A 57 ? ? -69.77 -178.67 133 14 ASN A 63 ? ? 70.78 -0.21 134 14 ASN A 107 ? ? -51.93 -74.28 135 15 PRO A 2 ? ? -69.78 -174.88 136 15 ASN A 21 ? ? 63.21 61.17 137 15 TYR A 33 ? ? -45.63 164.84 138 15 PRO A 34 ? ? -69.71 64.55 139 15 ASP A 44 ? ? -23.56 -83.90 140 15 ASN A 49 ? ? -147.48 -53.55 141 15 PRO A 57 ? ? -69.80 -177.35 142 15 ASN A 63 ? ? 70.96 -0.29 143 15 PRO A 101 ? ? -69.75 -170.03 144 15 ASN A 107 ? ? -105.68 -75.46 145 16 PRO A 2 ? ? -69.81 -170.62 146 16 ASN A 21 ? ? 62.82 61.95 147 16 TYR A 33 ? ? -45.83 164.86 148 16 PRO A 34 ? ? -69.76 65.16 149 16 ASP A 44 ? ? -23.48 -83.90 150 16 ASN A 49 ? ? -145.52 -53.47 151 16 SER A 105 ? ? -116.54 -169.72 152 16 GLU A 106 ? ? -63.04 93.92 153 17 PRO A 2 ? ? -69.84 -173.50 154 17 ASN A 21 ? ? 61.71 60.87 155 17 TYR A 33 ? ? -45.85 164.94 156 17 PRO A 34 ? ? -69.71 64.57 157 17 ASP A 44 ? ? -23.67 -83.97 158 17 ASN A 49 ? ? -142.16 -55.23 159 17 PRO A 57 ? ? -69.76 -178.58 160 17 ASN A 63 ? ? 70.76 -0.33 161 17 SER A 104 ? ? 47.49 72.59 162 17 SER A 105 ? ? -56.64 -76.31 163 17 ASN A 107 ? ? -94.33 -74.60 164 18 PRO A 2 ? ? -69.74 -177.03 165 18 ASN A 21 ? ? 64.00 62.36 166 18 TYR A 33 ? ? -45.71 165.00 167 18 PRO A 34 ? ? -69.72 64.87 168 18 ASP A 44 ? ? -20.89 -84.99 169 18 ASN A 49 ? ? -147.88 -52.25 170 18 PRO A 57 ? ? -69.73 -179.11 171 19 PRO A 2 ? ? -69.76 -175.73 172 19 ASN A 21 ? ? 63.06 60.55 173 19 TYR A 33 ? ? -45.55 164.66 174 19 PRO A 34 ? ? -69.72 65.88 175 19 ASP A 44 ? ? -22.67 -84.46 176 19 ASN A 49 ? ? -139.61 -56.43 177 19 PRO A 101 ? ? -69.78 -168.10 178 19 GLU A 103 ? ? -61.52 -171.74 179 19 GLU A 106 ? ? -93.11 43.57 180 20 PRO A 2 ? ? -69.81 -174.83 181 20 ASN A 21 ? ? 63.97 62.49 182 20 TYR A 33 ? ? -45.37 164.63 183 20 PRO A 34 ? ? -69.68 66.77 184 20 ASP A 44 ? ? -20.14 -85.39 185 20 ASN A 49 ? ? -143.58 -52.72 186 20 ASN A 63 ? ? 70.76 -0.04 187 20 SER A 105 ? ? -115.09 -169.16 188 20 GLU A 106 ? ? -56.72 99.67 # _pdbx_nmr_ensemble.entry_id 8XLB _pdbx_nmr_ensemble.conformers_calculated_total_number 40 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the least restraint violations' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 8XLB _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'closest to the average' # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '1.6 mM [U-100% 13C; U-100% 15N] Clamda3 domain of human immunoglobulin, 5 mM NaPi, 50 mM sodium chloride, 95% H2O/5% D2O' _pdbx_nmr_sample_details.solvent_system '95% H2O/5% D2O' _pdbx_nmr_sample_details.label '13C, 15N' _pdbx_nmr_sample_details.type solution _pdbx_nmr_sample_details.details ? # loop_ _pdbx_nmr_exptl_sample.solution_id _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling 1 'Clamda3 domain of human immunoglobulin' 1.6 ? mM '[U-100% 13C; U-100% 15N]' 1 NaPi 5 ? mM none 1 'sodium chloride' 50 ? mM none # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure_units Pa _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 6.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 'Not defined' _pdbx_nmr_exptl_sample_conditions.details ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_err ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units 'Not defined' _pdbx_nmr_exptl_sample_conditions.label condition_1 _pdbx_nmr_exptl_sample_conditions.pH_err ? _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 '2D 1H-15N HSQC' 1 isotropic 2 1 1 '3D CBCA(CO)NH' 1 isotropic 3 1 1 '3D HNCACB' 1 isotropic 4 1 1 '3D HNCO' 1 isotropic 5 1 1 '3D HCACO' 1 isotropic 6 1 1 '3D HNCA' 1 isotropic 7 1 1 '3D HN(CO)CA' 1 isotropic 8 1 1 '3D C(CO)NH' 1 isotropic 9 1 1 '3D CCH-TOCSY' 1 isotropic 10 1 1 '3D 1H-13C NOESY' 2 isotropic 11 1 1 '3D 1H-15N NOESY' 1 isotropic 12 1 1 '3D 1H-15N TOCSY' 1 isotropic 13 1 1 '3D HBHA(CO)NH' 1 isotropic # _pdbx_nmr_refine.entry_id 8XLB _pdbx_nmr_refine.method 'distance geometry' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 refinement ARTINA ? 'Klukowski, P., Riek, R. and Guntert, P.' 2 'structure calculation' ARTINA ? 'Klukowski, P., Riek, R. and Guntert, P.' 3 'chemical shift assignment' ARTINA ? 'Klukowski, P., Riek, R. and Guntert, P.' 4 'peak picking' ARTINA ? 'Klukowski, P., Riek, R. and Guntert, P.' # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ASN N N N N 14 ASN CA C N S 15 ASN C C N N 16 ASN O O N N 17 ASN CB C N N 18 ASN CG C N N 19 ASN OD1 O N N 20 ASN ND2 N N N 21 ASN OXT O N N 22 ASN H H N N 23 ASN H2 H N N 24 ASN HA H N N 25 ASN HB2 H N N 26 ASN HB3 H N N 27 ASN HD21 H N N 28 ASN HD22 H N N 29 ASN HXT H N N 30 ASP N N N N 31 ASP CA C N S 32 ASP C C N N 33 ASP O O N N 34 ASP CB C N N 35 ASP CG C N N 36 ASP OD1 O N N 37 ASP OD2 O N N 38 ASP OXT O N N 39 ASP H H N N 40 ASP H2 H N N 41 ASP HA H N N 42 ASP HB2 H N N 43 ASP HB3 H N N 44 ASP HD2 H N N 45 ASP HXT H N N 46 CYS N N N N 47 CYS CA C N R 48 CYS C C N N 49 CYS O O N N 50 CYS CB C N N 51 CYS SG S N N 52 CYS OXT O N N 53 CYS H H N N 54 CYS H2 H N N 55 CYS HA H N N 56 CYS HB2 H N N 57 CYS HB3 H N N 58 CYS HG H N N 59 CYS HXT H N N 60 GLN N N N N 61 GLN CA C N S 62 GLN C C N N 63 GLN O O N N 64 GLN CB C N N 65 GLN CG C N N 66 GLN CD C N N 67 GLN OE1 O N N 68 GLN NE2 N N N 69 GLN OXT O N N 70 GLN H H N N 71 GLN H2 H N N 72 GLN HA H N N 73 GLN HB2 H N N 74 GLN HB3 H N N 75 GLN HG2 H N N 76 GLN HG3 H N N 77 GLN HE21 H N N 78 GLN HE22 H N N 79 GLN HXT H N N 80 GLU N N N N 81 GLU CA C N S 82 GLU C C N N 83 GLU O O N N 84 GLU CB C N N 85 GLU CG C N N 86 GLU CD C N N 87 GLU OE1 O N N 88 GLU OE2 O N N 89 GLU OXT O N N 90 GLU H H N N 91 GLU H2 H N N 92 GLU HA H N N 93 GLU HB2 H N N 94 GLU HB3 H N N 95 GLU HG2 H N N 96 GLU HG3 H N N 97 GLU HE2 H N N 98 GLU HXT H N N 99 GLY N N N N 100 GLY CA C N N 101 GLY C C N N 102 GLY O O N N 103 GLY OXT O N N 104 GLY H H N N 105 GLY H2 H N N 106 GLY HA2 H N N 107 GLY HA3 H N N 108 GLY HXT H N N 109 HIS N N N N 110 HIS CA C N S 111 HIS C C N N 112 HIS O O N N 113 HIS CB C N N 114 HIS CG C Y N 115 HIS ND1 N Y N 116 HIS CD2 C Y N 117 HIS CE1 C Y N 118 HIS NE2 N Y N 119 HIS OXT O N N 120 HIS H H N N 121 HIS H2 H N N 122 HIS HA H N N 123 HIS HB2 H N N 124 HIS HB3 H N N 125 HIS HD1 H N N 126 HIS HD2 H N N 127 HIS HE1 H N N 128 HIS HE2 H N N 129 HIS HXT H N N 130 ILE N N N N 131 ILE CA C N S 132 ILE C C N N 133 ILE O O N N 134 ILE CB C N S 135 ILE CG1 C N N 136 ILE CG2 C N N 137 ILE CD1 C N N 138 ILE OXT O N N 139 ILE H H N N 140 ILE H2 H N N 141 ILE HA H N N 142 ILE HB H N N 143 ILE HG12 H N N 144 ILE HG13 H N N 145 ILE HG21 H N N 146 ILE HG22 H N N 147 ILE HG23 H N N 148 ILE HD11 H N N 149 ILE HD12 H N N 150 ILE HD13 H N N 151 ILE HXT H N N 152 LEU N N N N 153 LEU CA C N S 154 LEU C C N N 155 LEU O O N N 156 LEU CB C N N 157 LEU CG C N N 158 LEU CD1 C N N 159 LEU CD2 C N N 160 LEU OXT O N N 161 LEU H H N N 162 LEU H2 H N N 163 LEU HA H N N 164 LEU HB2 H N N 165 LEU HB3 H N N 166 LEU HG H N N 167 LEU HD11 H N N 168 LEU HD12 H N N 169 LEU HD13 H N N 170 LEU HD21 H N N 171 LEU HD22 H N N 172 LEU HD23 H N N 173 LEU HXT H N N 174 LYS N N N N 175 LYS CA C N S 176 LYS C C N N 177 LYS O O N N 178 LYS CB C N N 179 LYS CG C N N 180 LYS CD C N N 181 LYS CE C N N 182 LYS NZ N N N 183 LYS OXT O N N 184 LYS H H N N 185 LYS H2 H N N 186 LYS HA H N N 187 LYS HB2 H N N 188 LYS HB3 H N N 189 LYS HG2 H N N 190 LYS HG3 H N N 191 LYS HD2 H N N 192 LYS HD3 H N N 193 LYS HE2 H N N 194 LYS HE3 H N N 195 LYS HZ1 H N N 196 LYS HZ2 H N N 197 LYS HZ3 H N N 198 LYS HXT H N N 199 PHE N N N N 200 PHE CA C N S 201 PHE C C N N 202 PHE O O N N 203 PHE CB C N N 204 PHE CG C Y N 205 PHE CD1 C Y N 206 PHE CD2 C Y N 207 PHE CE1 C Y N 208 PHE CE2 C Y N 209 PHE CZ C Y N 210 PHE OXT O N N 211 PHE H H N N 212 PHE H2 H N N 213 PHE HA H N N 214 PHE HB2 H N N 215 PHE HB3 H N N 216 PHE HD1 H N N 217 PHE HD2 H N N 218 PHE HE1 H N N 219 PHE HE2 H N N 220 PHE HZ H N N 221 PHE HXT H N N 222 PRO N N N N 223 PRO CA C N S 224 PRO C C N N 225 PRO O O N N 226 PRO CB C N N 227 PRO CG C N N 228 PRO CD C N N 229 PRO OXT O N N 230 PRO H H N N 231 PRO HA H N N 232 PRO HB2 H N N 233 PRO HB3 H N N 234 PRO HG2 H N N 235 PRO HG3 H N N 236 PRO HD2 H N N 237 PRO HD3 H N N 238 PRO HXT H N N 239 SER N N N N 240 SER CA C N S 241 SER C C N N 242 SER O O N N 243 SER CB C N N 244 SER OG O N N 245 SER OXT O N N 246 SER H H N N 247 SER H2 H N N 248 SER HA H N N 249 SER HB2 H N N 250 SER HB3 H N N 251 SER HG H N N 252 SER HXT H N N 253 THR N N N N 254 THR CA C N S 255 THR C C N N 256 THR O O N N 257 THR CB C N R 258 THR OG1 O N N 259 THR CG2 C N N 260 THR OXT O N N 261 THR H H N N 262 THR H2 H N N 263 THR HA H N N 264 THR HB H N N 265 THR HG1 H N N 266 THR HG21 H N N 267 THR HG22 H N N 268 THR HG23 H N N 269 THR HXT H N N 270 TRP N N N N 271 TRP CA C N S 272 TRP C C N N 273 TRP O O N N 274 TRP CB C N N 275 TRP CG C Y N 276 TRP CD1 C Y N 277 TRP CD2 C Y N 278 TRP NE1 N Y N 279 TRP CE2 C Y N 280 TRP CE3 C Y N 281 TRP CZ2 C Y N 282 TRP CZ3 C Y N 283 TRP CH2 C Y N 284 TRP OXT O N N 285 TRP H H N N 286 TRP H2 H N N 287 TRP HA H N N 288 TRP HB2 H N N 289 TRP HB3 H N N 290 TRP HD1 H N N 291 TRP HE1 H N N 292 TRP HE3 H N N 293 TRP HZ2 H N N 294 TRP HZ3 H N N 295 TRP HH2 H N N 296 TRP HXT H N N 297 TYR N N N N 298 TYR CA C N S 299 TYR C C N N 300 TYR O O N N 301 TYR CB C N N 302 TYR CG C Y N 303 TYR CD1 C Y N 304 TYR CD2 C Y N 305 TYR CE1 C Y N 306 TYR CE2 C Y N 307 TYR CZ C Y N 308 TYR OH O N N 309 TYR OXT O N N 310 TYR H H N N 311 TYR H2 H N N 312 TYR HA H N N 313 TYR HB2 H N N 314 TYR HB3 H N N 315 TYR HD1 H N N 316 TYR HD2 H N N 317 TYR HE1 H N N 318 TYR HE2 H N N 319 TYR HH H N N 320 TYR HXT H N N 321 VAL N N N N 322 VAL CA C N S 323 VAL C C N N 324 VAL O O N N 325 VAL CB C N N 326 VAL CG1 C N N 327 VAL CG2 C N N 328 VAL OXT O N N 329 VAL H H N N 330 VAL H2 H N N 331 VAL HA H N N 332 VAL HB H N N 333 VAL HG11 H N N 334 VAL HG12 H N N 335 VAL HG13 H N N 336 VAL HG21 H N N 337 VAL HG22 H N N 338 VAL HG23 H N N 339 VAL HXT H N N 340 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ASN N CA sing N N 13 ASN N H sing N N 14 ASN N H2 sing N N 15 ASN CA C sing N N 16 ASN CA CB sing N N 17 ASN CA HA sing N N 18 ASN C O doub N N 19 ASN C OXT sing N N 20 ASN CB CG sing N N 21 ASN CB HB2 sing N N 22 ASN CB HB3 sing N N 23 ASN CG OD1 doub N N 24 ASN CG ND2 sing N N 25 ASN ND2 HD21 sing N N 26 ASN ND2 HD22 sing N N 27 ASN OXT HXT sing N N 28 ASP N CA sing N N 29 ASP N H sing N N 30 ASP N H2 sing N N 31 ASP CA C sing N N 32 ASP CA CB sing N N 33 ASP CA HA sing N N 34 ASP C O doub N N 35 ASP C OXT sing N N 36 ASP CB CG sing N N 37 ASP CB HB2 sing N N 38 ASP CB HB3 sing N N 39 ASP CG OD1 doub N N 40 ASP CG OD2 sing N N 41 ASP OD2 HD2 sing N N 42 ASP OXT HXT sing N N 43 CYS N CA sing N N 44 CYS N H sing N N 45 CYS N H2 sing N N 46 CYS CA C sing N N 47 CYS CA CB sing N N 48 CYS CA HA sing N N 49 CYS C O doub N N 50 CYS C OXT sing N N 51 CYS CB SG sing N N 52 CYS CB HB2 sing N N 53 CYS CB HB3 sing N N 54 CYS SG HG sing N N 55 CYS OXT HXT sing N N 56 GLN N CA sing N N 57 GLN N H sing N N 58 GLN N H2 sing N N 59 GLN CA C sing N N 60 GLN CA CB sing N N 61 GLN CA HA sing N N 62 GLN C O doub N N 63 GLN C OXT sing N N 64 GLN CB CG sing N N 65 GLN CB HB2 sing N N 66 GLN CB HB3 sing N N 67 GLN CG CD sing N N 68 GLN CG HG2 sing N N 69 GLN CG HG3 sing N N 70 GLN CD OE1 doub N N 71 GLN CD NE2 sing N N 72 GLN NE2 HE21 sing N N 73 GLN NE2 HE22 sing N N 74 GLN OXT HXT sing N N 75 GLU N CA sing N N 76 GLU N H sing N N 77 GLU N H2 sing N N 78 GLU CA C sing N N 79 GLU CA CB sing N N 80 GLU CA HA sing N N 81 GLU C O doub N N 82 GLU C OXT sing N N 83 GLU CB CG sing N N 84 GLU CB HB2 sing N N 85 GLU CB HB3 sing N N 86 GLU CG CD sing N N 87 GLU CG HG2 sing N N 88 GLU CG HG3 sing N N 89 GLU CD OE1 doub N N 90 GLU CD OE2 sing N N 91 GLU OE2 HE2 sing N N 92 GLU OXT HXT sing N N 93 GLY N CA sing N N 94 GLY N H sing N N 95 GLY N H2 sing N N 96 GLY CA C sing N N 97 GLY CA HA2 sing N N 98 GLY CA HA3 sing N N 99 GLY C O doub N N 100 GLY C OXT sing N N 101 GLY OXT HXT sing N N 102 HIS N CA sing N N 103 HIS N H sing N N 104 HIS N H2 sing N N 105 HIS CA C sing N N 106 HIS CA CB sing N N 107 HIS CA HA sing N N 108 HIS C O doub N N 109 HIS C OXT sing N N 110 HIS CB CG sing N N 111 HIS CB HB2 sing N N 112 HIS CB HB3 sing N N 113 HIS CG ND1 sing Y N 114 HIS CG CD2 doub Y N 115 HIS ND1 CE1 doub Y N 116 HIS ND1 HD1 sing N N 117 HIS CD2 NE2 sing Y N 118 HIS CD2 HD2 sing N N 119 HIS CE1 NE2 sing Y N 120 HIS CE1 HE1 sing N N 121 HIS NE2 HE2 sing N N 122 HIS OXT HXT sing N N 123 ILE N CA sing N N 124 ILE N H sing N N 125 ILE N H2 sing N N 126 ILE CA C sing N N 127 ILE CA CB sing N N 128 ILE CA HA sing N N 129 ILE C O doub N N 130 ILE C OXT sing N N 131 ILE CB CG1 sing N N 132 ILE CB CG2 sing N N 133 ILE CB HB sing N N 134 ILE CG1 CD1 sing N N 135 ILE CG1 HG12 sing N N 136 ILE CG1 HG13 sing N N 137 ILE CG2 HG21 sing N N 138 ILE CG2 HG22 sing N N 139 ILE CG2 HG23 sing N N 140 ILE CD1 HD11 sing N N 141 ILE CD1 HD12 sing N N 142 ILE CD1 HD13 sing N N 143 ILE OXT HXT sing N N 144 LEU N CA sing N N 145 LEU N H sing N N 146 LEU N H2 sing N N 147 LEU CA C sing N N 148 LEU CA CB sing N N 149 LEU CA HA sing N N 150 LEU C O doub N N 151 LEU C OXT sing N N 152 LEU CB CG sing N N 153 LEU CB HB2 sing N N 154 LEU CB HB3 sing N N 155 LEU CG CD1 sing N N 156 LEU CG CD2 sing N N 157 LEU CG HG sing N N 158 LEU CD1 HD11 sing N N 159 LEU CD1 HD12 sing N N 160 LEU CD1 HD13 sing N N 161 LEU CD2 HD21 sing N N 162 LEU CD2 HD22 sing N N 163 LEU CD2 HD23 sing N N 164 LEU OXT HXT sing N N 165 LYS N CA sing N N 166 LYS N H sing N N 167 LYS N H2 sing N N 168 LYS CA C sing N N 169 LYS CA CB sing N N 170 LYS CA HA sing N N 171 LYS C O doub N N 172 LYS C OXT sing N N 173 LYS CB CG sing N N 174 LYS CB HB2 sing N N 175 LYS CB HB3 sing N N 176 LYS CG CD sing N N 177 LYS CG HG2 sing N N 178 LYS CG HG3 sing N N 179 LYS CD CE sing N N 180 LYS CD HD2 sing N N 181 LYS CD HD3 sing N N 182 LYS CE NZ sing N N 183 LYS CE HE2 sing N N 184 LYS CE HE3 sing N N 185 LYS NZ HZ1 sing N N 186 LYS NZ HZ2 sing N N 187 LYS NZ HZ3 sing N N 188 LYS OXT HXT sing N N 189 PHE N CA sing N N 190 PHE N H sing N N 191 PHE N H2 sing N N 192 PHE CA C sing N N 193 PHE CA CB sing N N 194 PHE CA HA sing N N 195 PHE C O doub N N 196 PHE C OXT sing N N 197 PHE CB CG sing N N 198 PHE CB HB2 sing N N 199 PHE CB HB3 sing N N 200 PHE CG CD1 doub Y N 201 PHE CG CD2 sing Y N 202 PHE CD1 CE1 sing Y N 203 PHE CD1 HD1 sing N N 204 PHE CD2 CE2 doub Y N 205 PHE CD2 HD2 sing N N 206 PHE CE1 CZ doub Y N 207 PHE CE1 HE1 sing N N 208 PHE CE2 CZ sing Y N 209 PHE CE2 HE2 sing N N 210 PHE CZ HZ sing N N 211 PHE OXT HXT sing N N 212 PRO N CA sing N N 213 PRO N CD sing N N 214 PRO N H sing N N 215 PRO CA C sing N N 216 PRO CA CB sing N N 217 PRO CA HA sing N N 218 PRO C O doub N N 219 PRO C OXT sing N N 220 PRO CB CG sing N N 221 PRO CB HB2 sing N N 222 PRO CB HB3 sing N N 223 PRO CG CD sing N N 224 PRO CG HG2 sing N N 225 PRO CG HG3 sing N N 226 PRO CD HD2 sing N N 227 PRO CD HD3 sing N N 228 PRO OXT HXT sing N N 229 SER N CA sing N N 230 SER N H sing N N 231 SER N H2 sing N N 232 SER CA C sing N N 233 SER CA CB sing N N 234 SER CA HA sing N N 235 SER C O doub N N 236 SER C OXT sing N N 237 SER CB OG sing N N 238 SER CB HB2 sing N N 239 SER CB HB3 sing N N 240 SER OG HG sing N N 241 SER OXT HXT sing N N 242 THR N CA sing N N 243 THR N H sing N N 244 THR N H2 sing N N 245 THR CA C sing N N 246 THR CA CB sing N N 247 THR CA HA sing N N 248 THR C O doub N N 249 THR C OXT sing N N 250 THR CB OG1 sing N N 251 THR CB CG2 sing N N 252 THR CB HB sing N N 253 THR OG1 HG1 sing N N 254 THR CG2 HG21 sing N N 255 THR CG2 HG22 sing N N 256 THR CG2 HG23 sing N N 257 THR OXT HXT sing N N 258 TRP N CA sing N N 259 TRP N H sing N N 260 TRP N H2 sing N N 261 TRP CA C sing N N 262 TRP CA CB sing N N 263 TRP CA HA sing N N 264 TRP C O doub N N 265 TRP C OXT sing N N 266 TRP CB CG sing N N 267 TRP CB HB2 sing N N 268 TRP CB HB3 sing N N 269 TRP CG CD1 doub Y N 270 TRP CG CD2 sing Y N 271 TRP CD1 NE1 sing Y N 272 TRP CD1 HD1 sing N N 273 TRP CD2 CE2 doub Y N 274 TRP CD2 CE3 sing Y N 275 TRP NE1 CE2 sing Y N 276 TRP NE1 HE1 sing N N 277 TRP CE2 CZ2 sing Y N 278 TRP CE3 CZ3 doub Y N 279 TRP CE3 HE3 sing N N 280 TRP CZ2 CH2 doub Y N 281 TRP CZ2 HZ2 sing N N 282 TRP CZ3 CH2 sing Y N 283 TRP CZ3 HZ3 sing N N 284 TRP CH2 HH2 sing N N 285 TRP OXT HXT sing N N 286 TYR N CA sing N N 287 TYR N H sing N N 288 TYR N H2 sing N N 289 TYR CA C sing N N 290 TYR CA CB sing N N 291 TYR CA HA sing N N 292 TYR C O doub N N 293 TYR C OXT sing N N 294 TYR CB CG sing N N 295 TYR CB HB2 sing N N 296 TYR CB HB3 sing N N 297 TYR CG CD1 doub Y N 298 TYR CG CD2 sing Y N 299 TYR CD1 CE1 sing Y N 300 TYR CD1 HD1 sing N N 301 TYR CD2 CE2 doub Y N 302 TYR CD2 HD2 sing N N 303 TYR CE1 CZ doub Y N 304 TYR CE1 HE1 sing N N 305 TYR CE2 CZ sing Y N 306 TYR CE2 HE2 sing N N 307 TYR CZ OH sing N N 308 TYR OH HH sing N N 309 TYR OXT HXT sing N N 310 VAL N CA sing N N 311 VAL N H sing N N 312 VAL N H2 sing N N 313 VAL CA C sing N N 314 VAL CA CB sing N N 315 VAL CA HA sing N N 316 VAL C O doub N N 317 VAL C OXT sing N N 318 VAL CB CG1 sing N N 319 VAL CB CG2 sing N N 320 VAL CB HB sing N N 321 VAL CG1 HG11 sing N N 322 VAL CG1 HG12 sing N N 323 VAL CG1 HG13 sing N N 324 VAL CG2 HG21 sing N N 325 VAL CG2 HG22 sing N N 326 VAL CG2 HG23 sing N N 327 VAL OXT HXT sing N N 328 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'Ministry of Education, Culture, Sports, Science and Technology (Japan)' Japan JP22H02755 1 'Japan Agency for Medical Research and Development (AMED)' Japan JP21ae0121020h0001 2 'Japan Agency for Medical Research and Development (AMED)' Japan JP21ae0121013h0301 3 # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.type _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.details 1 'AVANCE NEO' ? Bruker 800 ? 2 'AVANCE III HD' ? Bruker 800 ? # _atom_sites.entry_id 8XLB _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C H N O S # loop_ #