data_8Y47 # _entry.id 8Y47 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.399 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 8Y47 pdb_00008y47 10.2210/pdb8y47/pdb WWPDB D_1300044803 ? ? # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2025-02-05 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 8Y47 _pdbx_database_status.recvd_initial_deposition_date 2024-01-30 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_contact_author.id 2 _pdbx_contact_author.email yekeqiong@ibp.ac.cn _pdbx_contact_author.name_first Keqiong _pdbx_contact_author.name_last Ye _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0001-6169-7049 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Zhang, W.' 1 0000-0002-9154-1077 'Ye, K.' 2 0000-0001-6169-7049 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To be published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Crystal Structure of SCAB1 in complex with CKL2' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Zhang, W.' 1 0000-0002-9154-1077 primary 'Ye, K.' 2 0000-0001-6169-7049 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Stomatal closure-related actin-binding protein 1' 24874.062 1 ? ? ? ? 2 polymer man 'Casein kinase 1-like protein 2' 2095.314 1 2.7.11.1 ? ? ? 3 water nat water 18.015 95 ? ? ? ? # _entity_name_com.entity_id 2 _entity_name_com.name 'Protein CASEIN KINASE I-LIKE 2' # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no ;GPSSSKSEENISLVYEIDGTEALGSCLRVRPCSNDAPDLSKCTIQWYRSSSDGSKKELISGATKSVYAPEPFDVGRVLHA DIIYDGHSLSLSTVGKIDPAAGLGSYVEALVRKHDVDFNVVVTQMSGEDHTSESIHLFHVGKMRIKLCKGKTVIAKEYYS SAMQLCGVRGGGNAAAQALYWQAKKGVSFVIAFESERERNAAIMLARRFACDCNVTLAGPEDRTETGQSP ; ;GPSSSKSEENISLVYEIDGTEALGSCLRVRPCSNDAPDLSKCTIQWYRSSSDGSKKELISGATKSVYAPEPFDVGRVLHA DIIYDGHSLSLSTVGKIDPAAGLGSYVEALVRKHDVDFNVVVTQMSGEDHTSESIHLFHVGKMRIKLCKGKTVIAKEYYS SAMQLCGVRGGGNAAAQALYWQAKKGVSFVIAFESERERNAAIMLARRFACDCNVTLAGPEDRTETGQSP ; A ? 2 'polypeptide(L)' no no GGSDPAISKDVVLSSSSFLRA GGSDPAISKDVVLSSSSFLRA B ? # _pdbx_entity_nonpoly.entity_id 3 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 PRO n 1 3 SER n 1 4 SER n 1 5 SER n 1 6 LYS n 1 7 SER n 1 8 GLU n 1 9 GLU n 1 10 ASN n 1 11 ILE n 1 12 SER n 1 13 LEU n 1 14 VAL n 1 15 TYR n 1 16 GLU n 1 17 ILE n 1 18 ASP n 1 19 GLY n 1 20 THR n 1 21 GLU n 1 22 ALA n 1 23 LEU n 1 24 GLY n 1 25 SER n 1 26 CYS n 1 27 LEU n 1 28 ARG n 1 29 VAL n 1 30 ARG n 1 31 PRO n 1 32 CYS n 1 33 SER n 1 34 ASN n 1 35 ASP n 1 36 ALA n 1 37 PRO n 1 38 ASP n 1 39 LEU n 1 40 SER n 1 41 LYS n 1 42 CYS n 1 43 THR n 1 44 ILE n 1 45 GLN n 1 46 TRP n 1 47 TYR n 1 48 ARG n 1 49 SER n 1 50 SER n 1 51 SER n 1 52 ASP n 1 53 GLY n 1 54 SER n 1 55 LYS n 1 56 LYS n 1 57 GLU n 1 58 LEU n 1 59 ILE n 1 60 SER n 1 61 GLY n 1 62 ALA n 1 63 THR n 1 64 LYS n 1 65 SER n 1 66 VAL n 1 67 TYR n 1 68 ALA n 1 69 PRO n 1 70 GLU n 1 71 PRO n 1 72 PHE n 1 73 ASP n 1 74 VAL n 1 75 GLY n 1 76 ARG n 1 77 VAL n 1 78 LEU n 1 79 HIS n 1 80 ALA n 1 81 ASP n 1 82 ILE n 1 83 ILE n 1 84 TYR n 1 85 ASP n 1 86 GLY n 1 87 HIS n 1 88 SER n 1 89 LEU n 1 90 SER n 1 91 LEU n 1 92 SER n 1 93 THR n 1 94 VAL n 1 95 GLY n 1 96 LYS n 1 97 ILE n 1 98 ASP n 1 99 PRO n 1 100 ALA n 1 101 ALA n 1 102 GLY n 1 103 LEU n 1 104 GLY n 1 105 SER n 1 106 TYR n 1 107 VAL n 1 108 GLU n 1 109 ALA n 1 110 LEU n 1 111 VAL n 1 112 ARG n 1 113 LYS n 1 114 HIS n 1 115 ASP n 1 116 VAL n 1 117 ASP n 1 118 PHE n 1 119 ASN n 1 120 VAL n 1 121 VAL n 1 122 VAL n 1 123 THR n 1 124 GLN n 1 125 MET n 1 126 SER n 1 127 GLY n 1 128 GLU n 1 129 ASP n 1 130 HIS n 1 131 THR n 1 132 SER n 1 133 GLU n 1 134 SER n 1 135 ILE n 1 136 HIS n 1 137 LEU n 1 138 PHE n 1 139 HIS n 1 140 VAL n 1 141 GLY n 1 142 LYS n 1 143 MET n 1 144 ARG n 1 145 ILE n 1 146 LYS n 1 147 LEU n 1 148 CYS n 1 149 LYS n 1 150 GLY n 1 151 LYS n 1 152 THR n 1 153 VAL n 1 154 ILE n 1 155 ALA n 1 156 LYS n 1 157 GLU n 1 158 TYR n 1 159 TYR n 1 160 SER n 1 161 SER n 1 162 ALA n 1 163 MET n 1 164 GLN n 1 165 LEU n 1 166 CYS n 1 167 GLY n 1 168 VAL n 1 169 ARG n 1 170 GLY n 1 171 GLY n 1 172 GLY n 1 173 ASN n 1 174 ALA n 1 175 ALA n 1 176 ALA n 1 177 GLN n 1 178 ALA n 1 179 LEU n 1 180 TYR n 1 181 TRP n 1 182 GLN n 1 183 ALA n 1 184 LYS n 1 185 LYS n 1 186 GLY n 1 187 VAL n 1 188 SER n 1 189 PHE n 1 190 VAL n 1 191 ILE n 1 192 ALA n 1 193 PHE n 1 194 GLU n 1 195 SER n 1 196 GLU n 1 197 ARG n 1 198 GLU n 1 199 ARG n 1 200 ASN n 1 201 ALA n 1 202 ALA n 1 203 ILE n 1 204 MET n 1 205 LEU n 1 206 ALA n 1 207 ARG n 1 208 ARG n 1 209 PHE n 1 210 ALA n 1 211 CYS n 1 212 ASP n 1 213 CYS n 1 214 ASN n 1 215 VAL n 1 216 THR n 1 217 LEU n 1 218 ALA n 1 219 GLY n 1 220 PRO n 1 221 GLU n 1 222 ASP n 1 223 ARG n 1 224 THR n 1 225 GLU n 1 226 THR n 1 227 GLY n 1 228 GLN n 1 229 SER n 1 230 PRO n 2 1 GLY n 2 2 GLY n 2 3 SER n 2 4 ASP n 2 5 PRO n 2 6 ALA n 2 7 ILE n 2 8 SER n 2 9 LYS n 2 10 ASP n 2 11 VAL n 2 12 VAL n 2 13 LEU n 2 14 SER n 2 15 SER n 2 16 SER n 2 17 SER n 2 18 PHE n 2 19 LEU n 2 20 ARG n 2 21 ALA n # loop_ _entity_src_gen.entity_id _entity_src_gen.pdbx_src_id _entity_src_gen.pdbx_alt_source_flag _entity_src_gen.pdbx_seq_type _entity_src_gen.pdbx_beg_seq_num _entity_src_gen.pdbx_end_seq_num _entity_src_gen.gene_src_common_name _entity_src_gen.gene_src_genus _entity_src_gen.pdbx_gene_src_gene _entity_src_gen.gene_src_species _entity_src_gen.gene_src_strain _entity_src_gen.gene_src_tissue _entity_src_gen.gene_src_tissue_fraction _entity_src_gen.gene_src_details _entity_src_gen.pdbx_gene_src_fragment _entity_src_gen.pdbx_gene_src_scientific_name _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id _entity_src_gen.pdbx_gene_src_variant _entity_src_gen.pdbx_gene_src_cell_line _entity_src_gen.pdbx_gene_src_atcc _entity_src_gen.pdbx_gene_src_organ _entity_src_gen.pdbx_gene_src_organelle _entity_src_gen.pdbx_gene_src_cell _entity_src_gen.pdbx_gene_src_cellular_location _entity_src_gen.host_org_common_name _entity_src_gen.pdbx_host_org_scientific_name _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id _entity_src_gen.host_org_genus _entity_src_gen.pdbx_host_org_gene _entity_src_gen.pdbx_host_org_organ _entity_src_gen.host_org_species _entity_src_gen.pdbx_host_org_tissue _entity_src_gen.pdbx_host_org_tissue_fraction _entity_src_gen.pdbx_host_org_strain _entity_src_gen.pdbx_host_org_variant _entity_src_gen.pdbx_host_org_cell_line _entity_src_gen.pdbx_host_org_atcc _entity_src_gen.pdbx_host_org_culture_collection _entity_src_gen.pdbx_host_org_cell _entity_src_gen.pdbx_host_org_organelle _entity_src_gen.pdbx_host_org_cellular_location _entity_src_gen.pdbx_host_org_vector_type _entity_src_gen.pdbx_host_org_vector _entity_src_gen.host_org_details _entity_src_gen.expression_system_id _entity_src_gen.plasmid_name _entity_src_gen.plasmid_details _entity_src_gen.pdbx_description 1 1 sample 'Biological sequence' 1 230 'thale cress' ? SCAB1 ? ? ? ? ? ? 'Arabidopsis thaliana' 3702 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 2 1 sample 'Biological sequence' 1 21 'thale cress' ? CKL2 ? ? ? ? ? ? 'Arabidopsis thaliana' 3702 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 267 ? ? ? A . n A 1 2 PRO 2 268 ? ? ? A . n A 1 3 SER 3 269 ? ? ? A . n A 1 4 SER 4 270 ? ? ? A . n A 1 5 SER 5 271 ? ? ? A . n A 1 6 LYS 6 272 ? ? ? A . n A 1 7 SER 7 273 ? ? ? A . n A 1 8 GLU 8 274 ? ? ? A . n A 1 9 GLU 9 275 ? ? ? A . n A 1 10 ASN 10 276 ? ? ? A . n A 1 11 ILE 11 277 ? ? ? A . n A 1 12 SER 12 278 278 SER SER A . n A 1 13 LEU 13 279 279 LEU LEU A . n A 1 14 VAL 14 280 280 VAL VAL A . n A 1 15 TYR 15 281 281 TYR TYR A . n A 1 16 GLU 16 282 282 GLU GLU A . n A 1 17 ILE 17 283 283 ILE ILE A . n A 1 18 ASP 18 284 284 ASP ASP A . n A 1 19 GLY 19 285 285 GLY GLY A . n A 1 20 THR 20 286 286 THR THR A . n A 1 21 GLU 21 287 287 GLU GLU A . n A 1 22 ALA 22 288 288 ALA ALA A . n A 1 23 LEU 23 289 289 LEU LEU A . n A 1 24 GLY 24 290 290 GLY GLY A . n A 1 25 SER 25 291 291 SER SER A . n A 1 26 CYS 26 292 292 CYS CYS A . n A 1 27 LEU 27 293 293 LEU LEU A . n A 1 28 ARG 28 294 294 ARG ARG A . n A 1 29 VAL 29 295 295 VAL VAL A . n A 1 30 ARG 30 296 296 ARG ARG A . n A 1 31 PRO 31 297 297 PRO PRO A . n A 1 32 CYS 32 298 298 CYS CYS A . n A 1 33 SER 33 299 299 SER SER A . n A 1 34 ASN 34 300 300 ASN ASN A . n A 1 35 ASP 35 301 301 ASP ASP A . n A 1 36 ALA 36 302 302 ALA ALA A . n A 1 37 PRO 37 303 303 PRO PRO A . n A 1 38 ASP 38 304 304 ASP ASP A . n A 1 39 LEU 39 305 305 LEU LEU A . n A 1 40 SER 40 306 306 SER SER A . n A 1 41 LYS 41 307 307 LYS LYS A . n A 1 42 CYS 42 308 308 CYS CYS A . n A 1 43 THR 43 309 309 THR THR A . n A 1 44 ILE 44 310 310 ILE ILE A . n A 1 45 GLN 45 311 311 GLN GLN A . n A 1 46 TRP 46 312 312 TRP TRP A . n A 1 47 TYR 47 313 313 TYR TYR A . n A 1 48 ARG 48 314 314 ARG ARG A . n A 1 49 SER 49 315 315 SER SER A . n A 1 50 SER 50 316 316 SER SER A . n A 1 51 SER 51 317 ? ? ? A . n A 1 52 ASP 52 318 ? ? ? A . n A 1 53 GLY 53 319 ? ? ? A . n A 1 54 SER 54 320 320 SER SER A . n A 1 55 LYS 55 321 321 LYS LYS A . n A 1 56 LYS 56 322 322 LYS LYS A . n A 1 57 GLU 57 323 323 GLU GLU A . n A 1 58 LEU 58 324 324 LEU LEU A . n A 1 59 ILE 59 325 325 ILE ILE A . n A 1 60 SER 60 326 326 SER SER A . n A 1 61 GLY 61 327 327 GLY GLY A . n A 1 62 ALA 62 328 328 ALA ALA A . n A 1 63 THR 63 329 329 THR THR A . n A 1 64 LYS 64 330 330 LYS LYS A . n A 1 65 SER 65 331 331 SER SER A . n A 1 66 VAL 66 332 332 VAL VAL A . n A 1 67 TYR 67 333 333 TYR TYR A . n A 1 68 ALA 68 334 334 ALA ALA A . n A 1 69 PRO 69 335 335 PRO PRO A . n A 1 70 GLU 70 336 336 GLU GLU A . n A 1 71 PRO 71 337 337 PRO PRO A . n A 1 72 PHE 72 338 338 PHE PHE A . n A 1 73 ASP 73 339 339 ASP ASP A . n A 1 74 VAL 74 340 340 VAL VAL A . n A 1 75 GLY 75 341 341 GLY GLY A . n A 1 76 ARG 76 342 342 ARG ARG A . n A 1 77 VAL 77 343 343 VAL VAL A . n A 1 78 LEU 78 344 344 LEU LEU A . n A 1 79 HIS 79 345 345 HIS HIS A . n A 1 80 ALA 80 346 346 ALA ALA A . n A 1 81 ASP 81 347 347 ASP ASP A . n A 1 82 ILE 82 348 348 ILE ILE A . n A 1 83 ILE 83 349 349 ILE ILE A . n A 1 84 TYR 84 350 350 TYR TYR A . n A 1 85 ASP 85 351 351 ASP ASP A . n A 1 86 GLY 86 352 352 GLY GLY A . n A 1 87 HIS 87 353 353 HIS HIS A . n A 1 88 SER 88 354 354 SER SER A . n A 1 89 LEU 89 355 355 LEU LEU A . n A 1 90 SER 90 356 356 SER SER A . n A 1 91 LEU 91 357 357 LEU LEU A . n A 1 92 SER 92 358 358 SER SER A . n A 1 93 THR 93 359 359 THR THR A . n A 1 94 VAL 94 360 360 VAL VAL A . n A 1 95 GLY 95 361 361 GLY GLY A . n A 1 96 LYS 96 362 362 LYS LYS A . n A 1 97 ILE 97 363 363 ILE ILE A . n A 1 98 ASP 98 364 364 ASP ASP A . n A 1 99 PRO 99 365 365 PRO PRO A . n A 1 100 ALA 100 366 366 ALA ALA A . n A 1 101 ALA 101 367 367 ALA ALA A . n A 1 102 GLY 102 368 368 GLY GLY A . n A 1 103 LEU 103 369 369 LEU LEU A . n A 1 104 GLY 104 370 370 GLY GLY A . n A 1 105 SER 105 371 371 SER SER A . n A 1 106 TYR 106 372 372 TYR TYR A . n A 1 107 VAL 107 373 373 VAL VAL A . n A 1 108 GLU 108 374 374 GLU GLU A . n A 1 109 ALA 109 375 375 ALA ALA A . n A 1 110 LEU 110 376 376 LEU LEU A . n A 1 111 VAL 111 377 377 VAL VAL A . n A 1 112 ARG 112 378 378 ARG ARG A . n A 1 113 LYS 113 379 379 LYS LYS A . n A 1 114 HIS 114 380 380 HIS HIS A . n A 1 115 ASP 115 381 ? ? ? A . n A 1 116 VAL 116 382 382 VAL VAL A . n A 1 117 ASP 117 383 383 ASP ASP A . n A 1 118 PHE 118 384 384 PHE PHE A . n A 1 119 ASN 119 385 385 ASN ASN A . n A 1 120 VAL 120 386 386 VAL VAL A . n A 1 121 VAL 121 387 387 VAL VAL A . n A 1 122 VAL 122 388 388 VAL VAL A . n A 1 123 THR 123 389 389 THR THR A . n A 1 124 GLN 124 390 390 GLN GLN A . n A 1 125 MET 125 391 391 MET MET A . n A 1 126 SER 126 392 ? ? ? A . n A 1 127 GLY 127 393 ? ? ? A . n A 1 128 GLU 128 394 394 GLU GLU A . n A 1 129 ASP 129 395 395 ASP ASP A . n A 1 130 HIS 130 396 396 HIS HIS A . n A 1 131 THR 131 397 397 THR THR A . n A 1 132 SER 132 398 398 SER SER A . n A 1 133 GLU 133 399 399 GLU GLU A . n A 1 134 SER 134 400 400 SER SER A . n A 1 135 ILE 135 401 401 ILE ILE A . n A 1 136 HIS 136 402 402 HIS HIS A . n A 1 137 LEU 137 403 403 LEU LEU A . n A 1 138 PHE 138 404 404 PHE PHE A . n A 1 139 HIS 139 405 405 HIS HIS A . n A 1 140 VAL 140 406 406 VAL VAL A . n A 1 141 GLY 141 407 407 GLY GLY A . n A 1 142 LYS 142 408 408 LYS LYS A . n A 1 143 MET 143 409 409 MET MET A . n A 1 144 ARG 144 410 410 ARG ARG A . n A 1 145 ILE 145 411 411 ILE ILE A . n A 1 146 LYS 146 412 412 LYS LYS A . n A 1 147 LEU 147 413 413 LEU LEU A . n A 1 148 CYS 148 414 414 CYS CYS A . n A 1 149 LYS 149 415 415 LYS LYS A . n A 1 150 GLY 150 416 416 GLY GLY A . n A 1 151 LYS 151 417 417 LYS LYS A . n A 1 152 THR 152 418 418 THR THR A . n A 1 153 VAL 153 419 419 VAL VAL A . n A 1 154 ILE 154 420 420 ILE ILE A . n A 1 155 ALA 155 421 421 ALA ALA A . n A 1 156 LYS 156 422 422 LYS LYS A . n A 1 157 GLU 157 423 423 GLU GLU A . n A 1 158 TYR 158 424 424 TYR TYR A . n A 1 159 TYR 159 425 425 TYR TYR A . n A 1 160 SER 160 426 426 SER SER A . n A 1 161 SER 161 427 427 SER SER A . n A 1 162 ALA 162 428 428 ALA ALA A . n A 1 163 MET 163 429 429 MET MET A . n A 1 164 GLN 164 430 430 GLN GLN A . n A 1 165 LEU 165 431 431 LEU LEU A . n A 1 166 CYS 166 432 432 CYS CYS A . n A 1 167 GLY 167 433 433 GLY GLY A . n A 1 168 VAL 168 434 434 VAL VAL A . n A 1 169 ARG 169 435 435 ARG ARG A . n A 1 170 GLY 170 436 436 GLY GLY A . n A 1 171 GLY 171 437 437 GLY GLY A . n A 1 172 GLY 172 438 438 GLY GLY A . n A 1 173 ASN 173 439 439 ASN ASN A . n A 1 174 ALA 174 440 440 ALA ALA A . n A 1 175 ALA 175 441 441 ALA ALA A . n A 1 176 ALA 176 442 442 ALA ALA A . n A 1 177 GLN 177 443 443 GLN GLN A . n A 1 178 ALA 178 444 444 ALA ALA A . n A 1 179 LEU 179 445 445 LEU LEU A . n A 1 180 TYR 180 446 446 TYR TYR A . n A 1 181 TRP 181 447 447 TRP TRP A . n A 1 182 GLN 182 448 448 GLN GLN A . n A 1 183 ALA 183 449 449 ALA ALA A . n A 1 184 LYS 184 450 450 LYS LYS A . n A 1 185 LYS 185 451 451 LYS LYS A . n A 1 186 GLY 186 452 452 GLY GLY A . n A 1 187 VAL 187 453 453 VAL VAL A . n A 1 188 SER 188 454 454 SER SER A . n A 1 189 PHE 189 455 455 PHE PHE A . n A 1 190 VAL 190 456 456 VAL VAL A . n A 1 191 ILE 191 457 457 ILE ILE A . n A 1 192 ALA 192 458 458 ALA ALA A . n A 1 193 PHE 193 459 459 PHE PHE A . n A 1 194 GLU 194 460 460 GLU GLU A . n A 1 195 SER 195 461 461 SER SER A . n A 1 196 GLU 196 462 462 GLU GLU A . n A 1 197 ARG 197 463 463 ARG ARG A . n A 1 198 GLU 198 464 464 GLU GLU A . n A 1 199 ARG 199 465 465 ARG ARG A . n A 1 200 ASN 200 466 466 ASN ASN A . n A 1 201 ALA 201 467 467 ALA ALA A . n A 1 202 ALA 202 468 468 ALA ALA A . n A 1 203 ILE 203 469 469 ILE ILE A . n A 1 204 MET 204 470 470 MET MET A . n A 1 205 LEU 205 471 471 LEU LEU A . n A 1 206 ALA 206 472 472 ALA ALA A . n A 1 207 ARG 207 473 473 ARG ARG A . n A 1 208 ARG 208 474 474 ARG ARG A . n A 1 209 PHE 209 475 475 PHE PHE A . n A 1 210 ALA 210 476 476 ALA ALA A . n A 1 211 CYS 211 477 477 CYS CYS A . n A 1 212 ASP 212 478 478 ASP ASP A . n A 1 213 CYS 213 479 479 CYS CYS A . n A 1 214 ASN 214 480 480 ASN ASN A . n A 1 215 VAL 215 481 481 VAL VAL A . n A 1 216 THR 216 482 482 THR THR A . n A 1 217 LEU 217 483 483 LEU LEU A . n A 1 218 ALA 218 484 484 ALA ALA A . n A 1 219 GLY 219 485 485 GLY GLY A . n A 1 220 PRO 220 486 486 PRO PRO A . n A 1 221 GLU 221 487 487 GLU GLU A . n A 1 222 ASP 222 488 488 ASP ASP A . n A 1 223 ARG 223 489 489 ARG ARG A . n A 1 224 THR 224 490 ? ? ? A . n A 1 225 GLU 225 491 ? ? ? A . n A 1 226 THR 226 492 ? ? ? A . n A 1 227 GLY 227 493 ? ? ? A . n A 1 228 GLN 228 494 ? ? ? A . n A 1 229 SER 229 495 ? ? ? A . n A 1 230 PRO 230 496 ? ? ? A . n B 2 1 GLY 1 363 ? ? ? B . n B 2 2 GLY 2 364 ? ? ? B . n B 2 3 SER 3 365 ? ? ? B . n B 2 4 ASP 4 366 366 ASP ASP B . n B 2 5 PRO 5 367 367 PRO PRO B . n B 2 6 ALA 6 368 368 ALA ALA B . n B 2 7 ILE 7 369 369 ILE ILE B . n B 2 8 SER 8 370 370 SER SER B . n B 2 9 LYS 9 371 371 LYS LYS B . n B 2 10 ASP 10 372 372 ASP ASP B . n B 2 11 VAL 11 373 373 VAL VAL B . n B 2 12 VAL 12 374 374 VAL VAL B . n B 2 13 LEU 13 375 375 LEU LEU B . n B 2 14 SER 14 376 376 SER SER B . n B 2 15 SER 15 377 ? ? ? B . n B 2 16 SER 16 378 ? ? ? B . n B 2 17 SER 17 379 ? ? ? B . n B 2 18 PHE 18 380 380 PHE PHE B . n B 2 19 LEU 19 381 ? ? ? B . n B 2 20 ARG 20 382 ? ? ? B . n B 2 21 ALA 21 383 ? ? ? B . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 3 HOH 1 501 61 HOH HOH A . C 3 HOH 2 502 68 HOH HOH A . C 3 HOH 3 503 8 HOH HOH A . C 3 HOH 4 504 93 HOH HOH A . C 3 HOH 5 505 96 HOH HOH A . C 3 HOH 6 506 54 HOH HOH A . C 3 HOH 7 507 6 HOH HOH A . C 3 HOH 8 508 50 HOH HOH A . C 3 HOH 9 509 33 HOH HOH A . C 3 HOH 10 510 78 HOH HOH A . C 3 HOH 11 511 57 HOH HOH A . C 3 HOH 12 512 44 HOH HOH A . C 3 HOH 13 513 82 HOH HOH A . C 3 HOH 14 514 65 HOH HOH A . C 3 HOH 15 515 2 HOH HOH A . C 3 HOH 16 516 1 HOH HOH A . C 3 HOH 17 517 81 HOH HOH A . C 3 HOH 18 518 52 HOH HOH A . C 3 HOH 19 519 43 HOH HOH A . C 3 HOH 20 520 63 HOH HOH A . C 3 HOH 21 521 3 HOH HOH A . C 3 HOH 22 522 71 HOH HOH A . C 3 HOH 23 523 11 HOH HOH A . C 3 HOH 24 524 29 HOH HOH A . C 3 HOH 25 525 45 HOH HOH A . C 3 HOH 26 526 21 HOH HOH A . C 3 HOH 27 527 48 HOH HOH A . C 3 HOH 28 528 94 HOH HOH A . C 3 HOH 29 529 30 HOH HOH A . C 3 HOH 30 530 83 HOH HOH A . C 3 HOH 31 531 70 HOH HOH A . C 3 HOH 32 532 72 HOH HOH A . C 3 HOH 33 533 19 HOH HOH A . C 3 HOH 34 534 16 HOH HOH A . C 3 HOH 35 535 53 HOH HOH A . C 3 HOH 36 536 59 HOH HOH A . C 3 HOH 37 537 5 HOH HOH A . C 3 HOH 38 538 4 HOH HOH A . C 3 HOH 39 539 47 HOH HOH A . C 3 HOH 40 540 39 HOH HOH A . C 3 HOH 41 541 14 HOH HOH A . C 3 HOH 42 542 36 HOH HOH A . C 3 HOH 43 543 27 HOH HOH A . C 3 HOH 44 544 31 HOH HOH A . C 3 HOH 45 545 80 HOH HOH A . C 3 HOH 46 546 84 HOH HOH A . C 3 HOH 47 547 42 HOH HOH A . C 3 HOH 48 548 18 HOH HOH A . C 3 HOH 49 549 98 HOH HOH A . C 3 HOH 50 550 55 HOH HOH A . C 3 HOH 51 551 7 HOH HOH A . C 3 HOH 52 552 97 HOH HOH A . C 3 HOH 53 553 67 HOH HOH A . C 3 HOH 54 554 13 HOH HOH A . C 3 HOH 55 555 49 HOH HOH A . C 3 HOH 56 556 75 HOH HOH A . C 3 HOH 57 557 38 HOH HOH A . C 3 HOH 58 558 9 HOH HOH A . C 3 HOH 59 559 32 HOH HOH A . C 3 HOH 60 560 28 HOH HOH A . C 3 HOH 61 561 74 HOH HOH A . C 3 HOH 62 562 25 HOH HOH A . C 3 HOH 63 563 92 HOH HOH A . C 3 HOH 64 564 62 HOH HOH A . C 3 HOH 65 565 20 HOH HOH A . C 3 HOH 66 566 15 HOH HOH A . C 3 HOH 67 567 73 HOH HOH A . C 3 HOH 68 568 76 HOH HOH A . C 3 HOH 69 569 26 HOH HOH A . C 3 HOH 70 570 41 HOH HOH A . C 3 HOH 71 571 22 HOH HOH A . C 3 HOH 72 572 66 HOH HOH A . C 3 HOH 73 573 64 HOH HOH A . C 3 HOH 74 574 37 HOH HOH A . C 3 HOH 75 575 51 HOH HOH A . C 3 HOH 76 576 69 HOH HOH A . C 3 HOH 77 577 10 HOH HOH A . C 3 HOH 78 578 56 HOH HOH A . C 3 HOH 79 579 35 HOH HOH A . C 3 HOH 80 580 58 HOH HOH A . C 3 HOH 81 581 12 HOH HOH A . C 3 HOH 82 582 91 HOH HOH A . C 3 HOH 83 583 85 HOH HOH A . C 3 HOH 84 584 87 HOH HOH A . C 3 HOH 85 585 24 HOH HOH A . C 3 HOH 86 586 86 HOH HOH A . C 3 HOH 87 587 88 HOH HOH A . C 3 HOH 88 588 95 HOH HOH A . C 3 HOH 89 589 60 HOH HOH A . C 3 HOH 90 590 79 HOH HOH A . C 3 HOH 91 591 89 HOH HOH A . D 3 HOH 1 401 17 HOH HOH B . D 3 HOH 2 402 23 HOH HOH B . D 3 HOH 3 403 90 HOH HOH B . D 3 HOH 4 404 77 HOH HOH B . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A SER 320 ? CB ? A SER 54 CB 2 1 Y 1 A SER 320 ? OG ? A SER 54 OG 3 1 Y 1 A ARG 489 ? CG ? A ARG 223 CG 4 1 Y 1 A ARG 489 ? CD ? A ARG 223 CD 5 1 Y 1 A ARG 489 ? NE ? A ARG 223 NE 6 1 Y 1 A ARG 489 ? CZ ? A ARG 223 CZ 7 1 Y 1 A ARG 489 ? NH1 ? A ARG 223 NH1 8 1 Y 1 A ARG 489 ? NH2 ? A ARG 223 NH2 # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0103 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 8Y47 _cell.details ? _cell.formula_units_Z ? _cell.length_a 35.378 _cell.length_a_esd ? _cell.length_b 63.907 _cell.length_b_esd ? _cell.length_c 89.765 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 8Y47 _symmetry.cell_setting ? _symmetry.Int_Tables_number 19 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 8Y47 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 1.88 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 34.62 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.1 M HEPES, pH 7.0 and 30% jeffamine ED-2001' _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 293 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'ADSC QUANTUM 315' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2010-01-02 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97947 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SSRF BEAMLINE BL17U1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.97947 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL17U1 _diffrn_source.pdbx_synchrotron_site SSRF # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 8Y47 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.00 _reflns.d_resolution_low 50 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 14473 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 98.3 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 7.1 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 27.75 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs 0.13 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 2.00 _reflns_shell.d_res_low 2.03 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 707 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.percent_possible_all ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.54 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] 0.03 _refine.aniso_B[1][2] 0.00 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][2] -0.06 _refine.aniso_B[2][3] -0.00 _refine.aniso_B[3][3] 0.02 _refine.B_iso_max ? _refine.B_iso_mean 25.680 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc 0.944 _refine.correlation_coeff_Fo_to_Fc_free 0.907 _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 8Y47 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.00 _refine.ls_d_res_low 19.24 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 13396 _refine.ls_number_reflns_R_free 708 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 98.20 _refine.ls_percent_reflns_R_free 5.0 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.19456 _refine.ls_R_factor_R_free 0.24516 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.19196 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details MASK _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.206 _refine.pdbx_overall_ESU_R_Free 0.182 _refine.pdbx_solvent_vdw_probe_radii 1.20 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 4.635 _refine.overall_SU_ML 0.129 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id 1 _refine_hist.details ? _refine_hist.d_res_high 2.00 _refine_hist.d_res_low 19.24 _refine_hist.number_atoms_solvent 95 _refine_hist.number_atoms_total 1754 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 1659 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.019 0.019 1685 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 0.002 0.020 1621 ? r_bond_other_d ? ? 'X-RAY DIFFRACTION' ? 2.070 1.959 2269 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 1.120 3.000 3728 ? r_angle_other_deg ? ? 'X-RAY DIFFRACTION' ? 6.285 5.000 212 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 35.761 23.478 69 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 18.097 15.000 289 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 10.776 15.000 11 ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.130 0.200 258 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.009 0.020 1875 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 0.001 0.020 372 ? r_gen_planes_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbd_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbd_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbtor_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbtor_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_xyhbond_nbd_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_xyhbond_nbd_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_metal_ion_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_metal_ion_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_vdw_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_vdw_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_hbond_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_hbond_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_metal_ion_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_metal_ion_other ? ? 'X-RAY DIFFRACTION' ? 2.407 2.288 866 ? r_mcbond_it ? ? 'X-RAY DIFFRACTION' ? 2.406 2.284 865 ? r_mcbond_other ? ? 'X-RAY DIFFRACTION' ? 3.596 3.385 1072 ? r_mcangle_it ? ? 'X-RAY DIFFRACTION' ? 3.594 3.390 1073 ? r_mcangle_other ? ? 'X-RAY DIFFRACTION' ? 3.718 2.755 819 ? r_scbond_it ? ? 'X-RAY DIFFRACTION' ? 3.716 2.757 820 ? r_scbond_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_scangle_it ? ? 'X-RAY DIFFRACTION' ? 5.716 3.939 1198 ? r_scangle_other ? ? 'X-RAY DIFFRACTION' ? 7.704 18.542 1796 ? r_long_range_B_refined ? ? 'X-RAY DIFFRACTION' ? 7.682 18.432 1778 ? r_long_range_B_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_rigid_bond_restr ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_sphericity_free ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_sphericity_bonded ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 2.000 _refine_ls_shell.d_res_low 2.051 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 60 _refine_ls_shell.number_reflns_R_work 957 _refine_ls_shell.percent_reflns_obs 98.83 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.R_factor_R_work 0.224 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_R_complete ? _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? _refine_ls_shell.R_factor_R_free 0.289 # _struct.entry_id 8Y47 _struct.title 'Crystal Structure of SCAB1 in complex with CKL2' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 8Y47 _struct_keywords.text 'cytoskeleton, plant, actin-binding, kinase, PLANT PROTEIN' _struct_keywords.pdbx_keywords 'PLANT PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 3 ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP SCAB1_ARATH O48791 ? 1 ;KSEENISLVYEIDGTEALGSCLRVRPCSNDAPDLSKCTIQWYRSSSDGSKKELISGATKSVYAPEPFDVGRVLHADIIYD GHSLSLSTVGKIDPAAGLGSYVEALVRKHDVDFNVVVTQMSGEDHTSESIHLFHVGKMRIKLCKGKTVIAKEYYSSAMQL CGVRGGGNAAAQALYWQAKKGVSFVIAFESERERNAAIMLARRFACDCNVTLAGPEDRTETGQSP ; 272 2 UNP CKL2_ARATH Q9CAI5 ? 2 SDPAISKDVVLSSSSFLRA 365 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 8Y47 A 6 ? 230 ? O48791 272 ? 496 ? 272 496 2 2 8Y47 B 3 ? 21 ? Q9CAI5 365 ? 383 ? 365 383 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 8Y47 GLY A 1 ? UNP O48791 ? ? 'expression tag' 267 1 1 8Y47 PRO A 2 ? UNP O48791 ? ? 'expression tag' 268 2 1 8Y47 SER A 3 ? UNP O48791 ? ? 'expression tag' 269 3 1 8Y47 SER A 4 ? UNP O48791 ? ? 'expression tag' 270 4 1 8Y47 SER A 5 ? UNP O48791 ? ? 'expression tag' 271 5 2 8Y47 GLY B 1 ? UNP Q9CAI5 ? ? 'expression tag' 363 6 2 8Y47 GLY B 2 ? UNP Q9CAI5 ? ? 'expression tag' 364 7 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 1470 ? 1 MORE -10 ? 1 'SSA (A^2)' 10750 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASP A 38 ? CYS A 42 ? ASP A 304 CYS A 308 5 ? 5 HELX_P HELX_P2 AA2 GLU A 70 ? VAL A 74 ? GLU A 336 VAL A 340 5 ? 5 HELX_P HELX_P3 AA3 GLY A 102 ? ARG A 112 ? GLY A 368 ARG A 378 1 ? 11 HELX_P HELX_P4 AA4 ALA A 174 ? ALA A 176 ? ALA A 440 ALA A 442 5 ? 3 HELX_P HELX_P5 AA5 SER A 195 ? CYS A 213 ? SER A 461 CYS A 479 1 ? 19 HELX_P HELX_P6 AA6 PRO B 5 ? LYS B 9 ? PRO B 367 LYS B 371 1 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 3 ? AA2 ? 4 ? AA3 ? 7 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel AA3 1 2 ? anti-parallel AA3 2 3 ? anti-parallel AA3 3 4 ? anti-parallel AA3 4 5 ? anti-parallel AA3 5 6 ? anti-parallel AA3 6 7 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 TYR A 15 ? ASP A 18 ? TYR A 281 ASP A 284 AA1 2 LEU A 27 ? PRO A 31 ? LEU A 293 PRO A 297 AA1 3 VAL A 66 ? TYR A 67 ? VAL A 332 TYR A 333 AA2 1 LYS A 56 ? LEU A 58 ? LYS A 322 LEU A 324 AA2 2 THR A 43 ? SER A 49 ? THR A 309 SER A 315 AA2 3 LEU A 78 ? TYR A 84 ? LEU A 344 TYR A 350 AA2 4 HIS A 87 ? SER A 92 ? HIS A 353 SER A 358 AA3 1 THR A 152 ? TYR A 158 ? THR A 418 TYR A 424 AA3 2 ARG A 144 ? LYS A 149 ? ARG A 410 LYS A 415 AA3 3 HIS A 136 ? VAL A 140 ? HIS A 402 VAL A 406 AA3 4 ASP A 117 ? GLN A 124 ? ASP A 383 GLN A 390 AA3 5 VAL A 187 ? PHE A 193 ? VAL A 453 PHE A 459 AA3 6 ALA A 178 ? LYS A 184 ? ALA A 444 LYS A 450 AA3 7 GLN A 164 ? GLY A 167 ? GLN A 430 GLY A 433 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N ASP A 18 ? N ASP A 284 O ARG A 28 ? O ARG A 294 AA1 2 3 N LEU A 27 ? N LEU A 293 O TYR A 67 ? O TYR A 333 AA2 1 2 O GLU A 57 ? O GLU A 323 N ARG A 48 ? N ARG A 314 AA2 2 3 N TYR A 47 ? N TYR A 313 O HIS A 79 ? O HIS A 345 AA2 3 4 N TYR A 84 ? N TYR A 350 O HIS A 87 ? O HIS A 353 AA3 1 2 O ALA A 155 ? O ALA A 421 N LEU A 147 ? N LEU A 413 AA3 2 3 O LYS A 146 ? O LYS A 412 N HIS A 139 ? N HIS A 405 AA3 3 4 O HIS A 136 ? O HIS A 402 N VAL A 120 ? N VAL A 386 AA3 4 5 N THR A 123 ? N THR A 389 O VAL A 190 ? O VAL A 456 AA3 5 6 O PHE A 189 ? O PHE A 455 N TRP A 181 ? N TRP A 447 AA3 6 7 O TYR A 180 ? O TYR A 446 N CYS A 166 ? N CYS A 432 # _pdbx_entry_details.entry_id 8Y47 _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification N # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 NE A ARG 296 ? ? CZ A ARG 296 ? ? NH2 A ARG 296 ? ? 116.80 120.30 -3.50 0.50 N 2 1 CB A ASP 347 ? ? CG A ASP 347 ? ? OD1 A ASP 347 ? ? 123.74 118.30 5.44 0.90 N 3 1 NE A ARG 435 ? ? CZ A ARG 435 ? ? NH2 A ARG 435 ? ? 117.06 120.30 -3.24 0.50 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 291 ? ? -120.27 -168.16 2 1 ASP A 395 ? ? -49.04 152.69 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 267 ? A GLY 1 2 1 Y 1 A PRO 268 ? A PRO 2 3 1 Y 1 A SER 269 ? A SER 3 4 1 Y 1 A SER 270 ? A SER 4 5 1 Y 1 A SER 271 ? A SER 5 6 1 Y 1 A LYS 272 ? A LYS 6 7 1 Y 1 A SER 273 ? A SER 7 8 1 Y 1 A GLU 274 ? A GLU 8 9 1 Y 1 A GLU 275 ? A GLU 9 10 1 Y 1 A ASN 276 ? A ASN 10 11 1 Y 1 A ILE 277 ? A ILE 11 12 1 Y 1 A SER 317 ? A SER 51 13 1 Y 1 A ASP 318 ? A ASP 52 14 1 Y 1 A GLY 319 ? A GLY 53 15 1 Y 1 A ASP 381 ? A ASP 115 16 1 Y 1 A SER 392 ? A SER 126 17 1 Y 1 A GLY 393 ? A GLY 127 18 1 Y 1 A THR 490 ? A THR 224 19 1 Y 1 A GLU 491 ? A GLU 225 20 1 Y 1 A THR 492 ? A THR 226 21 1 Y 1 A GLY 493 ? A GLY 227 22 1 Y 1 A GLN 494 ? A GLN 228 23 1 Y 1 A SER 495 ? A SER 229 24 1 Y 1 A PRO 496 ? A PRO 230 25 1 Y 1 B GLY 363 ? B GLY 1 26 1 Y 1 B GLY 364 ? B GLY 2 27 1 Y 1 B SER 365 ? B SER 3 28 1 Y 1 B SER 377 ? B SER 15 29 1 Y 1 B SER 378 ? B SER 16 30 1 Y 1 B SER 379 ? B SER 17 31 1 Y 1 B LEU 381 ? B LEU 19 32 1 Y 1 B ARG 382 ? B ARG 20 33 1 Y 1 B ALA 383 ? B ALA 21 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 HOH O O N N 158 HOH H1 H N N 159 HOH H2 H N N 160 ILE N N N N 161 ILE CA C N S 162 ILE C C N N 163 ILE O O N N 164 ILE CB C N S 165 ILE CG1 C N N 166 ILE CG2 C N N 167 ILE CD1 C N N 168 ILE OXT O N N 169 ILE H H N N 170 ILE H2 H N N 171 ILE HA H N N 172 ILE HB H N N 173 ILE HG12 H N N 174 ILE HG13 H N N 175 ILE HG21 H N N 176 ILE HG22 H N N 177 ILE HG23 H N N 178 ILE HD11 H N N 179 ILE HD12 H N N 180 ILE HD13 H N N 181 ILE HXT H N N 182 LEU N N N N 183 LEU CA C N S 184 LEU C C N N 185 LEU O O N N 186 LEU CB C N N 187 LEU CG C N N 188 LEU CD1 C N N 189 LEU CD2 C N N 190 LEU OXT O N N 191 LEU H H N N 192 LEU H2 H N N 193 LEU HA H N N 194 LEU HB2 H N N 195 LEU HB3 H N N 196 LEU HG H N N 197 LEU HD11 H N N 198 LEU HD12 H N N 199 LEU HD13 H N N 200 LEU HD21 H N N 201 LEU HD22 H N N 202 LEU HD23 H N N 203 LEU HXT H N N 204 LYS N N N N 205 LYS CA C N S 206 LYS C C N N 207 LYS O O N N 208 LYS CB C N N 209 LYS CG C N N 210 LYS CD C N N 211 LYS CE C N N 212 LYS NZ N N N 213 LYS OXT O N N 214 LYS H H N N 215 LYS H2 H N N 216 LYS HA H N N 217 LYS HB2 H N N 218 LYS HB3 H N N 219 LYS HG2 H N N 220 LYS HG3 H N N 221 LYS HD2 H N N 222 LYS HD3 H N N 223 LYS HE2 H N N 224 LYS HE3 H N N 225 LYS HZ1 H N N 226 LYS HZ2 H N N 227 LYS HZ3 H N N 228 LYS HXT H N N 229 MET N N N N 230 MET CA C N S 231 MET C C N N 232 MET O O N N 233 MET CB C N N 234 MET CG C N N 235 MET SD S N N 236 MET CE C N N 237 MET OXT O N N 238 MET H H N N 239 MET H2 H N N 240 MET HA H N N 241 MET HB2 H N N 242 MET HB3 H N N 243 MET HG2 H N N 244 MET HG3 H N N 245 MET HE1 H N N 246 MET HE2 H N N 247 MET HE3 H N N 248 MET HXT H N N 249 PHE N N N N 250 PHE CA C N S 251 PHE C C N N 252 PHE O O N N 253 PHE CB C N N 254 PHE CG C Y N 255 PHE CD1 C Y N 256 PHE CD2 C Y N 257 PHE CE1 C Y N 258 PHE CE2 C Y N 259 PHE CZ C Y N 260 PHE OXT O N N 261 PHE H H N N 262 PHE H2 H N N 263 PHE HA H N N 264 PHE HB2 H N N 265 PHE HB3 H N N 266 PHE HD1 H N N 267 PHE HD2 H N N 268 PHE HE1 H N N 269 PHE HE2 H N N 270 PHE HZ H N N 271 PHE HXT H N N 272 PRO N N N N 273 PRO CA C N S 274 PRO C C N N 275 PRO O O N N 276 PRO CB C N N 277 PRO CG C N N 278 PRO CD C N N 279 PRO OXT O N N 280 PRO H H N N 281 PRO HA H N N 282 PRO HB2 H N N 283 PRO HB3 H N N 284 PRO HG2 H N N 285 PRO HG3 H N N 286 PRO HD2 H N N 287 PRO HD3 H N N 288 PRO HXT H N N 289 SER N N N N 290 SER CA C N S 291 SER C C N N 292 SER O O N N 293 SER CB C N N 294 SER OG O N N 295 SER OXT O N N 296 SER H H N N 297 SER H2 H N N 298 SER HA H N N 299 SER HB2 H N N 300 SER HB3 H N N 301 SER HG H N N 302 SER HXT H N N 303 THR N N N N 304 THR CA C N S 305 THR C C N N 306 THR O O N N 307 THR CB C N R 308 THR OG1 O N N 309 THR CG2 C N N 310 THR OXT O N N 311 THR H H N N 312 THR H2 H N N 313 THR HA H N N 314 THR HB H N N 315 THR HG1 H N N 316 THR HG21 H N N 317 THR HG22 H N N 318 THR HG23 H N N 319 THR HXT H N N 320 TRP N N N N 321 TRP CA C N S 322 TRP C C N N 323 TRP O O N N 324 TRP CB C N N 325 TRP CG C Y N 326 TRP CD1 C Y N 327 TRP CD2 C Y N 328 TRP NE1 N Y N 329 TRP CE2 C Y N 330 TRP CE3 C Y N 331 TRP CZ2 C Y N 332 TRP CZ3 C Y N 333 TRP CH2 C Y N 334 TRP OXT O N N 335 TRP H H N N 336 TRP H2 H N N 337 TRP HA H N N 338 TRP HB2 H N N 339 TRP HB3 H N N 340 TRP HD1 H N N 341 TRP HE1 H N N 342 TRP HE3 H N N 343 TRP HZ2 H N N 344 TRP HZ3 H N N 345 TRP HH2 H N N 346 TRP HXT H N N 347 TYR N N N N 348 TYR CA C N S 349 TYR C C N N 350 TYR O O N N 351 TYR CB C N N 352 TYR CG C Y N 353 TYR CD1 C Y N 354 TYR CD2 C Y N 355 TYR CE1 C Y N 356 TYR CE2 C Y N 357 TYR CZ C Y N 358 TYR OH O N N 359 TYR OXT O N N 360 TYR H H N N 361 TYR H2 H N N 362 TYR HA H N N 363 TYR HB2 H N N 364 TYR HB3 H N N 365 TYR HD1 H N N 366 TYR HD2 H N N 367 TYR HE1 H N N 368 TYR HE2 H N N 369 TYR HH H N N 370 TYR HXT H N N 371 VAL N N N N 372 VAL CA C N S 373 VAL C C N N 374 VAL O O N N 375 VAL CB C N N 376 VAL CG1 C N N 377 VAL CG2 C N N 378 VAL OXT O N N 379 VAL H H N N 380 VAL H2 H N N 381 VAL HA H N N 382 VAL HB H N N 383 VAL HG11 H N N 384 VAL HG12 H N N 385 VAL HG13 H N N 386 VAL HG21 H N N 387 VAL HG22 H N N 388 VAL HG23 H N N 389 VAL HXT H N N 390 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MET N CA sing N N 218 MET N H sing N N 219 MET N H2 sing N N 220 MET CA C sing N N 221 MET CA CB sing N N 222 MET CA HA sing N N 223 MET C O doub N N 224 MET C OXT sing N N 225 MET CB CG sing N N 226 MET CB HB2 sing N N 227 MET CB HB3 sing N N 228 MET CG SD sing N N 229 MET CG HG2 sing N N 230 MET CG HG3 sing N N 231 MET SD CE sing N N 232 MET CE HE1 sing N N 233 MET CE HE2 sing N N 234 MET CE HE3 sing N N 235 MET OXT HXT sing N N 236 PHE N CA sing N N 237 PHE N H sing N N 238 PHE N H2 sing N N 239 PHE CA C sing N N 240 PHE CA CB sing N N 241 PHE CA HA sing N N 242 PHE C O doub N N 243 PHE C OXT sing N N 244 PHE CB CG sing N N 245 PHE CB HB2 sing N N 246 PHE CB HB3 sing N N 247 PHE CG CD1 doub Y N 248 PHE CG CD2 sing Y N 249 PHE CD1 CE1 sing Y N 250 PHE CD1 HD1 sing N N 251 PHE CD2 CE2 doub Y N 252 PHE CD2 HD2 sing N N 253 PHE CE1 CZ doub Y N 254 PHE CE1 HE1 sing N N 255 PHE CE2 CZ sing Y N 256 PHE CE2 HE2 sing N N 257 PHE CZ HZ sing N N 258 PHE OXT HXT sing N N 259 PRO N CA sing N N 260 PRO N CD sing N N 261 PRO N H sing N N 262 PRO CA C sing N N 263 PRO CA CB sing N N 264 PRO CA HA sing N N 265 PRO C O doub N N 266 PRO C OXT sing N N 267 PRO CB CG sing N N 268 PRO CB HB2 sing N N 269 PRO CB HB3 sing N N 270 PRO CG CD sing N N 271 PRO CG HG2 sing N N 272 PRO CG HG3 sing N N 273 PRO CD HD2 sing N N 274 PRO CD HD3 sing N N 275 PRO OXT HXT sing N N 276 SER N CA sing N N 277 SER N H sing N N 278 SER N H2 sing N N 279 SER CA C sing N N 280 SER CA CB sing N N 281 SER CA HA sing N N 282 SER C O doub N N 283 SER C OXT sing N N 284 SER CB OG sing N N 285 SER CB HB2 sing N N 286 SER CB HB3 sing N N 287 SER OG HG sing N N 288 SER OXT HXT sing N N 289 THR N CA sing N N 290 THR N H sing N N 291 THR N H2 sing N N 292 THR CA C sing N N 293 THR CA CB sing N N 294 THR CA HA sing N N 295 THR C O doub N N 296 THR C OXT sing N N 297 THR CB OG1 sing N N 298 THR CB CG2 sing N N 299 THR CB HB sing N N 300 THR OG1 HG1 sing N N 301 THR CG2 HG21 sing N N 302 THR CG2 HG22 sing N N 303 THR CG2 HG23 sing N N 304 THR OXT HXT sing N N 305 TRP N CA sing N N 306 TRP N H sing N N 307 TRP N H2 sing N N 308 TRP CA C sing N N 309 TRP CA CB sing N N 310 TRP CA HA sing N N 311 TRP C O doub N N 312 TRP C OXT sing N N 313 TRP CB CG sing N N 314 TRP CB HB2 sing N N 315 TRP CB HB3 sing N N 316 TRP CG CD1 doub Y N 317 TRP CG CD2 sing Y N 318 TRP CD1 NE1 sing Y N 319 TRP CD1 HD1 sing N N 320 TRP CD2 CE2 doub Y N 321 TRP CD2 CE3 sing Y N 322 TRP NE1 CE2 sing Y N 323 TRP NE1 HE1 sing N N 324 TRP CE2 CZ2 sing Y N 325 TRP CE3 CZ3 doub Y N 326 TRP CE3 HE3 sing N N 327 TRP CZ2 CH2 doub Y N 328 TRP CZ2 HZ2 sing N N 329 TRP CZ3 CH2 sing Y N 330 TRP CZ3 HZ3 sing N N 331 TRP CH2 HH2 sing N N 332 TRP OXT HXT sing N N 333 TYR N CA sing N N 334 TYR N H sing N N 335 TYR N H2 sing N N 336 TYR CA C sing N N 337 TYR CA CB sing N N 338 TYR CA HA sing N N 339 TYR C O doub N N 340 TYR C OXT sing N N 341 TYR CB CG sing N N 342 TYR CB HB2 sing N N 343 TYR CB HB3 sing N N 344 TYR CG CD1 doub Y N 345 TYR CG CD2 sing Y N 346 TYR CD1 CE1 sing Y N 347 TYR CD1 HD1 sing N N 348 TYR CD2 CE2 doub Y N 349 TYR CD2 HD2 sing N N 350 TYR CE1 CZ doub Y N 351 TYR CE1 HE1 sing N N 352 TYR CE2 CZ sing Y N 353 TYR CE2 HE2 sing N N 354 TYR CZ OH sing N N 355 TYR OH HH sing N N 356 TYR OXT HXT sing N N 357 VAL N CA sing N N 358 VAL N H sing N N 359 VAL N H2 sing N N 360 VAL CA C sing N N 361 VAL CA CB sing N N 362 VAL CA HA sing N N 363 VAL C O doub N N 364 VAL C OXT sing N N 365 VAL CB CG1 sing N N 366 VAL CB CG2 sing N N 367 VAL CB HB sing N N 368 VAL CG1 HG11 sing N N 369 VAL CG1 HG12 sing N N 370 VAL CG1 HG13 sing N N 371 VAL CG2 HG21 sing N N 372 VAL CG2 HG22 sing N N 373 VAL CG2 HG23 sing N N 374 VAL OXT HXT sing N N 375 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'Chinese Academy of Sciences' China XDB0570000 1 'Chinese Academy of Sciences' China XDB37010201 2 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list A _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 4DIX _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 8Y47 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 0.028266 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] -0.000000 _atom_sites.fract_transf_matrix[2][2] 0.015648 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] -0.000000 _atom_sites.fract_transf_matrix[3][3] 0.011140 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C N O S # loop_ #