data_8YD6 # _entry.id 8YD6 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.402 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 8YD6 pdb_00008yd6 10.2210/pdb8yd6/pdb WWPDB D_1300045414 ? ? BMRB 36648 ? 10.13018/BMR36648 # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2025-02-26 _pdbx_audit_revision_history.part_number ? # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr . _pdbx_database_status.entry_id 8YD6 _pdbx_database_status.recvd_initial_deposition_date 2024-02-19 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs . _pdbx_database_status.status_code_nmr_data REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_database_related.db_name BMRB _pdbx_database_related.details 'Solution structure of peptide H30 by Nuclear Magnetic Resonance Spectroscopy' _pdbx_database_related.db_id 36648 _pdbx_database_related.content_type unspecified # _pdbx_contact_author.id 2 _pdbx_contact_author.email hjzhao13@hku.hk _pdbx_contact_author.name_first Hanjun _pdbx_contact_author.name_last Zhao _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-4642-1682 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Sze, K.H.' 1 0000-0002-0898-605X 'Zhao, H.' 2 0000-0002-4642-1682 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Solution structure of H30 peptide by NMR spectroscopy' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Sze, K.H.' 1 0000-0002-0898-605X primary 'Zhao, H.' 2 0000-0002-4642-1682 # _entity.id 1 _entity.type polymer _entity.src_method syn _entity.pdbx_description 'Defensin beta 4A' _entity.formula_weight 3270.015 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Beta-defensin 2,BD-2,hBD-2,Defensin,beta 2,Skin-antimicrobial peptide 1,SAP1' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GAICHPVFCPRRYKQIGTCGLPGTKCCKKP _entity_poly.pdbx_seq_one_letter_code_can GAICHPVFCPRRYKQIGTCGLPGTKCCKKP _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 ALA n 1 3 ILE n 1 4 CYS n 1 5 HIS n 1 6 PRO n 1 7 VAL n 1 8 PHE n 1 9 CYS n 1 10 PRO n 1 11 ARG n 1 12 ARG n 1 13 TYR n 1 14 LYS n 1 15 GLN n 1 16 ILE n 1 17 GLY n 1 18 THR n 1 19 CYS n 1 20 GLY n 1 21 LEU n 1 22 PRO n 1 23 GLY n 1 24 THR n 1 25 LYS n 1 26 CYS n 1 27 CYS n 1 28 LYS n 1 29 LYS n 1 30 PRO n # _pdbx_entity_src_syn.entity_id 1 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num 1 _pdbx_entity_src_syn.pdbx_end_seq_num 30 _pdbx_entity_src_syn.organism_scientific 'Homo sapiens' _pdbx_entity_src_syn.organism_common_name human _pdbx_entity_src_syn.ncbi_taxonomy_id 9606 _pdbx_entity_src_syn.details ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 ALA 2 2 2 ALA ALA A . n A 1 3 ILE 3 3 3 ILE ILE A . n A 1 4 CYS 4 4 4 CYS CYS A . n A 1 5 HIS 5 5 5 HIS HIS A . n A 1 6 PRO 6 6 6 PRO PRO A . n A 1 7 VAL 7 7 7 VAL VAL A . n A 1 8 PHE 8 8 8 PHE PHE A . n A 1 9 CYS 9 9 9 CYS CYS A . n A 1 10 PRO 10 10 10 PRO PRO A . n A 1 11 ARG 11 11 11 ARG ARG A . n A 1 12 ARG 12 12 12 ARG ARG A . n A 1 13 TYR 13 13 13 TYR TYR A . n A 1 14 LYS 14 14 14 LYS LYS A . n A 1 15 GLN 15 15 15 GLN GLN A . n A 1 16 ILE 16 16 16 ILE ILE A . n A 1 17 GLY 17 17 17 GLY GLY A . n A 1 18 THR 18 18 18 THR THR A . n A 1 19 CYS 19 19 19 CYS CYS A . n A 1 20 GLY 20 20 20 GLY GLY A . n A 1 21 LEU 21 21 21 LEU LEU A . n A 1 22 PRO 22 22 22 PRO PRO A . n A 1 23 GLY 23 23 23 GLY GLY A . n A 1 24 THR 24 24 24 THR THR A . n A 1 25 LYS 25 25 25 LYS LYS A . n A 1 26 CYS 26 26 26 CYS CYS A . n A 1 27 CYS 27 27 27 CYS CYS A . n A 1 28 LYS 28 28 28 LYS LYS A . n A 1 29 LYS 29 29 29 LYS LYS A . n A 1 30 PRO 30 30 30 PRO PRO A . n # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 8YD6 _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 8YD6 _struct.title 'Solution structure of peptide H30 by Nuclear Magnetic Resonance Spectroscopy' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 8YD6 _struct_keywords.text 'Cationic peptides, antiviral, virus-binding, ANTIVIRAL PROTEIN, ANTIMICROBIAL PROTEIN' _struct_keywords.pdbx_keywords 'ANTIMICROBIAL PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code DFB4A_HUMAN _struct_ref.pdbx_db_accession O15263 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code GAICHPVFCPRRYKQIGTCGLPGTKCCKKP _struct_ref.pdbx_align_begin 35 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 8YD6 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 30 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession O15263 _struct_ref_seq.db_align_beg 35 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 64 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 30 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'NMR Distance Restraints' _pdbx_struct_assembly_auth_evidence.details 'not applicable' # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0 _pdbx_struct_oper_list.matrix[1][2] 0.0 _pdbx_struct_oper_list.matrix[1][3] 0.0 _pdbx_struct_oper_list.vector[1] 0.0 _pdbx_struct_oper_list.matrix[2][1] 0.0 _pdbx_struct_oper_list.matrix[2][2] 1.0 _pdbx_struct_oper_list.matrix[2][3] 0.0 _pdbx_struct_oper_list.vector[2] 0.0 _pdbx_struct_oper_list.matrix[3][1] 0.0 _pdbx_struct_oper_list.matrix[3][2] 0.0 _pdbx_struct_oper_list.matrix[3][3] 1.0 _pdbx_struct_oper_list.vector[3] 0.0 # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id AA1 _struct_conf.beg_label_comp_id TYR _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 13 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id GLY _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 17 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id TYR _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 13 _struct_conf.end_auth_comp_id GLY _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 17 _struct_conf.pdbx_PDB_helix_class 5 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 4 SG ? ? ? 1_555 A CYS 19 SG ? ? A CYS 4 A CYS 19 1_555 ? ? ? ? ? ? ? 2.040 ? ? disulf2 disulf ? ? A CYS 9 SG ? ? ? 1_555 A CYS 27 SG ? ? A CYS 9 A CYS 27 1_555 ? ? ? ? ? ? ? 2.036 ? ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 CYS A 4 ? CYS A 19 ? CYS A 4 ? 1_555 CYS A 19 ? 1_555 SG SG . . . None 'Disulfide bridge' 2 CYS A 9 ? CYS A 27 ? CYS A 9 ? 1_555 CYS A 27 ? 1_555 SG SG . . . None 'Disulfide bridge' # _pdbx_entry_details.entry_id 8YD6 _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PHE A 8 ? ? -143.34 -88.32 2 1 CYS A 9 ? ? -168.61 51.98 3 1 CYS A 19 ? ? 34.90 61.55 4 1 LEU A 21 ? ? -111.84 78.14 5 1 CYS A 27 ? ? 54.59 18.84 6 2 ALA A 2 ? ? 57.01 13.96 7 2 PHE A 8 ? ? -141.21 -90.66 8 2 CYS A 9 ? ? -166.79 52.72 9 2 ARG A 12 ? ? -66.75 -175.23 10 2 CYS A 19 ? ? 38.71 52.66 11 2 CYS A 27 ? ? -52.51 102.37 12 2 LYS A 28 ? ? -159.54 -43.15 13 3 HIS A 5 ? ? -151.51 86.84 14 3 PHE A 8 ? ? -141.58 -90.70 15 3 CYS A 9 ? ? -166.81 53.39 16 3 ARG A 12 ? ? -65.28 -172.87 17 3 THR A 18 ? ? -72.79 31.11 18 3 CYS A 19 ? ? -50.76 105.82 19 3 CYS A 27 ? ? -46.75 107.71 20 3 LYS A 28 ? ? -152.36 -51.63 21 4 HIS A 5 ? ? -152.57 88.88 22 4 PHE A 8 ? ? -141.33 -93.58 23 4 CYS A 9 ? ? -163.10 53.40 24 4 ARG A 12 ? ? -62.84 -175.38 25 4 THR A 18 ? ? -68.36 22.60 26 4 CYS A 19 ? ? -45.91 104.86 27 4 LYS A 28 ? ? -150.96 -60.95 28 5 PHE A 8 ? ? -142.84 -88.64 29 5 CYS A 9 ? ? -170.00 56.28 30 5 CYS A 19 ? ? 35.87 59.29 31 5 LEU A 21 ? ? -111.83 75.93 32 5 CYS A 27 ? ? 27.15 79.50 33 5 LYS A 28 ? ? -128.90 -56.71 34 6 PHE A 8 ? ? -145.91 -87.12 35 6 CYS A 9 ? ? -172.33 61.75 36 6 ARG A 12 ? ? -68.02 -173.35 37 6 CYS A 19 ? ? 38.45 59.26 38 6 CYS A 27 ? ? 6.68 87.03 39 6 LYS A 28 ? ? -139.86 -51.71 40 7 PHE A 8 ? ? -142.29 -89.55 41 7 CYS A 9 ? ? -167.47 56.37 42 7 ARG A 12 ? ? -67.56 -174.97 43 7 CYS A 19 ? ? 32.41 61.49 44 7 CYS A 27 ? ? -53.11 99.88 45 7 LYS A 28 ? ? -156.18 -30.42 46 8 HIS A 5 ? ? -154.75 85.40 47 8 PHE A 8 ? ? -141.98 -126.34 48 8 THR A 18 ? ? -72.21 34.66 49 8 THR A 24 ? ? -123.77 -52.84 50 8 CYS A 27 ? ? 51.81 19.33 51 9 ALA A 2 ? ? -130.89 -48.83 52 9 PHE A 8 ? ? -140.46 -95.43 53 9 CYS A 9 ? ? -158.70 57.52 54 9 CYS A 19 ? ? 39.24 49.69 55 9 CYS A 27 ? ? -53.44 105.79 56 9 LYS A 28 ? ? -147.79 -51.04 57 10 ALA A 2 ? ? -124.03 -51.42 58 10 PHE A 8 ? ? -140.85 -92.35 59 10 CYS A 9 ? ? -164.67 55.73 60 10 ARG A 12 ? ? -62.49 -176.61 61 10 CYS A 19 ? ? 37.40 57.20 62 10 CYS A 27 ? ? -47.71 108.42 63 10 LYS A 28 ? ? -149.14 -58.86 64 11 PHE A 8 ? ? -142.86 -110.23 65 11 CYS A 19 ? ? 35.30 62.04 66 11 CYS A 27 ? ? -53.51 104.74 67 11 LYS A 28 ? ? -155.92 -40.86 68 12 PHE A 8 ? ? -148.90 -109.49 69 12 PRO A 22 ? ? -74.64 -169.62 70 12 CYS A 27 ? ? 39.38 49.38 71 13 PHE A 8 ? ? -149.18 -109.36 72 13 CYS A 19 ? ? 37.92 56.50 73 13 LEU A 21 ? ? -115.89 70.37 74 14 ALA A 2 ? ? -140.87 -46.07 75 14 PHE A 8 ? ? -148.30 -118.18 76 14 THR A 18 ? ? -68.87 20.02 77 14 CYS A 19 ? ? -40.40 96.14 78 15 PHE A 8 ? ? -143.40 -104.71 79 15 CYS A 9 ? ? -151.51 49.82 80 15 CYS A 27 ? ? 36.86 53.35 81 16 PHE A 8 ? ? -139.73 -92.17 82 16 CYS A 9 ? ? -162.81 54.15 83 16 ARG A 12 ? ? -64.03 -177.17 84 16 CYS A 19 ? ? 38.09 53.57 85 16 CYS A 27 ? ? -49.54 108.28 86 16 LYS A 28 ? ? -151.40 -56.93 87 17 HIS A 5 ? ? -150.60 81.33 88 17 PHE A 8 ? ? -141.27 -91.65 89 17 CYS A 9 ? ? -163.52 53.90 90 17 ARG A 12 ? ? -63.62 -176.74 91 17 CYS A 19 ? ? 37.43 53.26 92 17 CYS A 27 ? ? -48.61 106.99 93 17 LYS A 28 ? ? -150.47 -55.96 94 18 HIS A 5 ? ? -150.61 76.55 95 18 PHE A 8 ? ? -137.13 -94.54 96 18 CYS A 9 ? ? -158.48 52.64 97 18 CYS A 19 ? ? 39.43 53.17 98 18 CYS A 27 ? ? -55.90 103.41 99 18 LYS A 28 ? ? -147.00 -40.61 100 19 HIS A 5 ? ? -154.84 85.29 101 19 PHE A 8 ? ? -141.96 -126.33 102 19 THR A 18 ? ? -72.19 34.63 103 19 THR A 24 ? ? -123.78 -52.84 104 19 CYS A 27 ? ? 51.80 19.39 105 20 ALA A 2 ? ? -130.97 -48.81 106 20 PHE A 8 ? ? -140.46 -95.48 107 20 CYS A 9 ? ? -158.64 57.50 108 20 CYS A 19 ? ? 39.21 49.78 109 20 CYS A 27 ? ? -53.41 105.82 110 20 LYS A 28 ? ? -147.86 -51.03 # _pdbx_nmr_ensemble.entry_id 8YD6 _pdbx_nmr_ensemble.conformers_calculated_total_number 500 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'target function' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 8YD6 _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '0.9 mM H30, 13 mM TCEP.HCl, 0.175 mM 98%[U-2H]2,2,3,3-D4 TSP, 90% H2O/10% D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' _pdbx_nmr_sample_details.label H30 _pdbx_nmr_sample_details.type solution _pdbx_nmr_sample_details.details '0.9mM H30 in 90%H2O/10%D2O with 13mM TCEP as disulphide bond reducing agent' # loop_ _pdbx_nmr_exptl_sample.solution_id _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling 1 H30 0.9 ? mM 'natural abundance' 1 TCEP.HCl 13 ? mM 'natural abundance' 1 TSP 0.175 ? mM '98%[U-2H]2,2,3,3-D4' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 2.5 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0 _pdbx_nmr_exptl_sample_conditions.details 'TCEP was added to reduce intermolecular disulphide bonds' _pdbx_nmr_exptl_sample_conditions.ionic_strength_err ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units 'Not defined' _pdbx_nmr_exptl_sample_conditions.label 1 _pdbx_nmr_exptl_sample_conditions.pH_err ? _pdbx_nmr_exptl_sample_conditions.pH_units 'Not defined' _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 '2D 1H-1H COSY' 1 isotropic 2 1 1 '2D 1H-1H TOCSY' 1 isotropic 3 1 1 '2D 1H-1H NOESY' 1 isotropic # loop_ _pdbx_nmr_refine.entry_id _pdbx_nmr_refine.method _pdbx_nmr_refine.details _pdbx_nmr_refine.software_ordinal 8YD6 'torsion angle dynamics' 'The structures are based on 311 NOE-derived distance constraints and 195 dihedral angle restraints' 5 8YD6 'simulated annealing' 'Energy minimization with water solvent refinement' 6 # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 collection TopSpin 3.1 'Bruker Biospin' 2 processing TopSpin 3.1 'Bruker Biospin' 3 'peak picking' Sparky 3.106 Goddard 4 'data analysis' Sparky 3.106 Goddard 5 'structure calculation' CYANA 2.1 'Guntert, Mumenthaler and Wuthrich' 6 refinement Amber 16 'Case, Darden, Cheatham III, Simmerling, Wang, Duke, Luo, ... and Kollman' 7 'chemical shift assignment' Sparky 3.106 Goddard # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 CYS N N N N 41 CYS CA C N R 42 CYS C C N N 43 CYS O O N N 44 CYS CB C N N 45 CYS SG S N N 46 CYS OXT O N N 47 CYS H H N N 48 CYS H2 H N N 49 CYS HA H N N 50 CYS HB2 H N N 51 CYS HB3 H N N 52 CYS HG H N N 53 CYS HXT H N N 54 GLN N N N N 55 GLN CA C N S 56 GLN C C N N 57 GLN O O N N 58 GLN CB C N N 59 GLN CG C N N 60 GLN CD C N N 61 GLN OE1 O N N 62 GLN NE2 N N N 63 GLN OXT O N N 64 GLN H H N N 65 GLN H2 H N N 66 GLN HA H N N 67 GLN HB2 H N N 68 GLN HB3 H N N 69 GLN HG2 H N N 70 GLN HG3 H N N 71 GLN HE21 H N N 72 GLN HE22 H N N 73 GLN HXT H N N 74 GLY N N N N 75 GLY CA C N N 76 GLY C C N N 77 GLY O O N N 78 GLY OXT O N N 79 GLY H H N N 80 GLY H2 H N N 81 GLY HA2 H N N 82 GLY HA3 H N N 83 GLY HXT H N N 84 HIS N N N N 85 HIS CA C N S 86 HIS C C N N 87 HIS O O N N 88 HIS CB C N N 89 HIS CG C Y N 90 HIS ND1 N Y N 91 HIS CD2 C Y N 92 HIS CE1 C Y N 93 HIS NE2 N Y N 94 HIS OXT O N N 95 HIS H H N N 96 HIS H2 H N N 97 HIS HA H N N 98 HIS HB2 H N N 99 HIS HB3 H N N 100 HIS HD1 H N N 101 HIS HD2 H N N 102 HIS HE1 H N N 103 HIS HE2 H N N 104 HIS HXT H N N 105 ILE N N N N 106 ILE CA C N S 107 ILE C C N N 108 ILE O O N N 109 ILE CB C N S 110 ILE CG1 C N N 111 ILE CG2 C N N 112 ILE CD1 C N N 113 ILE OXT O N N 114 ILE H H N N 115 ILE H2 H N N 116 ILE HA H N N 117 ILE HB H N N 118 ILE HG12 H N N 119 ILE HG13 H N N 120 ILE HG21 H N N 121 ILE HG22 H N N 122 ILE HG23 H N N 123 ILE HD11 H N N 124 ILE HD12 H N N 125 ILE HD13 H N N 126 ILE HXT H N N 127 LEU N N N N 128 LEU CA C N S 129 LEU C C N N 130 LEU O O N N 131 LEU CB C N N 132 LEU CG C N N 133 LEU CD1 C N N 134 LEU CD2 C N N 135 LEU OXT O N N 136 LEU H H N N 137 LEU H2 H N N 138 LEU HA H N N 139 LEU HB2 H N N 140 LEU HB3 H N N 141 LEU HG H N N 142 LEU HD11 H N N 143 LEU HD12 H N N 144 LEU HD13 H N N 145 LEU HD21 H N N 146 LEU HD22 H N N 147 LEU HD23 H N N 148 LEU HXT H N N 149 LYS N N N N 150 LYS CA C N S 151 LYS C C N N 152 LYS O O N N 153 LYS CB C N N 154 LYS CG C N N 155 LYS CD C N N 156 LYS CE C N N 157 LYS NZ N N N 158 LYS OXT O N N 159 LYS H H N N 160 LYS H2 H N N 161 LYS HA H N N 162 LYS HB2 H N N 163 LYS HB3 H N N 164 LYS HG2 H N N 165 LYS HG3 H N N 166 LYS HD2 H N N 167 LYS HD3 H N N 168 LYS HE2 H N N 169 LYS HE3 H N N 170 LYS HZ1 H N N 171 LYS HZ2 H N N 172 LYS HZ3 H N N 173 LYS HXT H N N 174 PHE N N N N 175 PHE CA C N S 176 PHE C C N N 177 PHE O O N N 178 PHE CB C N N 179 PHE CG C Y N 180 PHE CD1 C Y N 181 PHE CD2 C Y N 182 PHE CE1 C Y N 183 PHE CE2 C Y N 184 PHE CZ C Y N 185 PHE OXT O N N 186 PHE H H N N 187 PHE H2 H N N 188 PHE HA H N N 189 PHE HB2 H N N 190 PHE HB3 H N N 191 PHE HD1 H N N 192 PHE HD2 H N N 193 PHE HE1 H N N 194 PHE HE2 H N N 195 PHE HZ H N N 196 PHE HXT H N N 197 PRO N N N N 198 PRO CA C N S 199 PRO C C N N 200 PRO O O N N 201 PRO CB C N N 202 PRO CG C N N 203 PRO CD C N N 204 PRO OXT O N N 205 PRO H H N N 206 PRO HA H N N 207 PRO HB2 H N N 208 PRO HB3 H N N 209 PRO HG2 H N N 210 PRO HG3 H N N 211 PRO HD2 H N N 212 PRO HD3 H N N 213 PRO HXT H N N 214 THR N N N N 215 THR CA C N S 216 THR C C N N 217 THR O O N N 218 THR CB C N R 219 THR OG1 O N N 220 THR CG2 C N N 221 THR OXT O N N 222 THR H H N N 223 THR H2 H N N 224 THR HA H N N 225 THR HB H N N 226 THR HG1 H N N 227 THR HG21 H N N 228 THR HG22 H N N 229 THR HG23 H N N 230 THR HXT H N N 231 TYR N N N N 232 TYR CA C N S 233 TYR C C N N 234 TYR O O N N 235 TYR CB C N N 236 TYR CG C Y N 237 TYR CD1 C Y N 238 TYR CD2 C Y N 239 TYR CE1 C Y N 240 TYR CE2 C Y N 241 TYR CZ C Y N 242 TYR OH O N N 243 TYR OXT O N N 244 TYR H H N N 245 TYR H2 H N N 246 TYR HA H N N 247 TYR HB2 H N N 248 TYR HB3 H N N 249 TYR HD1 H N N 250 TYR HD2 H N N 251 TYR HE1 H N N 252 TYR HE2 H N N 253 TYR HH H N N 254 TYR HXT H N N 255 VAL N N N N 256 VAL CA C N S 257 VAL C C N N 258 VAL O O N N 259 VAL CB C N N 260 VAL CG1 C N N 261 VAL CG2 C N N 262 VAL OXT O N N 263 VAL H H N N 264 VAL H2 H N N 265 VAL HA H N N 266 VAL HB H N N 267 VAL HG11 H N N 268 VAL HG12 H N N 269 VAL HG13 H N N 270 VAL HG21 H N N 271 VAL HG22 H N N 272 VAL HG23 H N N 273 VAL HXT H N N 274 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 CYS N CA sing N N 39 CYS N H sing N N 40 CYS N H2 sing N N 41 CYS CA C sing N N 42 CYS CA CB sing N N 43 CYS CA HA sing N N 44 CYS C O doub N N 45 CYS C OXT sing N N 46 CYS CB SG sing N N 47 CYS CB HB2 sing N N 48 CYS CB HB3 sing N N 49 CYS SG HG sing N N 50 CYS OXT HXT sing N N 51 GLN N CA sing N N 52 GLN N H sing N N 53 GLN N H2 sing N N 54 GLN CA C sing N N 55 GLN CA CB sing N N 56 GLN CA HA sing N N 57 GLN C O doub N N 58 GLN C OXT sing N N 59 GLN CB CG sing N N 60 GLN CB HB2 sing N N 61 GLN CB HB3 sing N N 62 GLN CG CD sing N N 63 GLN CG HG2 sing N N 64 GLN CG HG3 sing N N 65 GLN CD OE1 doub N N 66 GLN CD NE2 sing N N 67 GLN NE2 HE21 sing N N 68 GLN NE2 HE22 sing N N 69 GLN OXT HXT sing N N 70 GLY N CA sing N N 71 GLY N H sing N N 72 GLY N H2 sing N N 73 GLY CA C sing N N 74 GLY CA HA2 sing N N 75 GLY CA HA3 sing N N 76 GLY C O doub N N 77 GLY C OXT sing N N 78 GLY OXT HXT sing N N 79 HIS N CA sing N N 80 HIS N H sing N N 81 HIS N H2 sing N N 82 HIS CA C sing N N 83 HIS CA CB sing N N 84 HIS CA HA sing N N 85 HIS C O doub N N 86 HIS C OXT sing N N 87 HIS CB CG sing N N 88 HIS CB HB2 sing N N 89 HIS CB HB3 sing N N 90 HIS CG ND1 sing Y N 91 HIS CG CD2 doub Y N 92 HIS ND1 CE1 doub Y N 93 HIS ND1 HD1 sing N N 94 HIS CD2 NE2 sing Y N 95 HIS CD2 HD2 sing N N 96 HIS CE1 NE2 sing Y N 97 HIS CE1 HE1 sing N N 98 HIS NE2 HE2 sing N N 99 HIS OXT HXT sing N N 100 ILE N CA sing N N 101 ILE N H sing N N 102 ILE N H2 sing N N 103 ILE CA C sing N N 104 ILE CA CB sing N N 105 ILE CA HA sing N N 106 ILE C O doub N N 107 ILE C OXT sing N N 108 ILE CB CG1 sing N N 109 ILE CB CG2 sing N N 110 ILE CB HB sing N N 111 ILE CG1 CD1 sing N N 112 ILE CG1 HG12 sing N N 113 ILE CG1 HG13 sing N N 114 ILE CG2 HG21 sing N N 115 ILE CG2 HG22 sing N N 116 ILE CG2 HG23 sing N N 117 ILE CD1 HD11 sing N N 118 ILE CD1 HD12 sing N N 119 ILE CD1 HD13 sing N N 120 ILE OXT HXT sing N N 121 LEU N CA sing N N 122 LEU N H sing N N 123 LEU N H2 sing N N 124 LEU CA C sing N N 125 LEU CA CB sing N N 126 LEU CA HA sing N N 127 LEU C O doub N N 128 LEU C OXT sing N N 129 LEU CB CG sing N N 130 LEU CB HB2 sing N N 131 LEU CB HB3 sing N N 132 LEU CG CD1 sing N N 133 LEU CG CD2 sing N N 134 LEU CG HG sing N N 135 LEU CD1 HD11 sing N N 136 LEU CD1 HD12 sing N N 137 LEU CD1 HD13 sing N N 138 LEU CD2 HD21 sing N N 139 LEU CD2 HD22 sing N N 140 LEU CD2 HD23 sing N N 141 LEU OXT HXT sing N N 142 LYS N CA sing N N 143 LYS N H sing N N 144 LYS N H2 sing N N 145 LYS CA C sing N N 146 LYS CA CB sing N N 147 LYS CA HA sing N N 148 LYS C O doub N N 149 LYS C OXT sing N N 150 LYS CB CG sing N N 151 LYS CB HB2 sing N N 152 LYS CB HB3 sing N N 153 LYS CG CD sing N N 154 LYS CG HG2 sing N N 155 LYS CG HG3 sing N N 156 LYS CD CE sing N N 157 LYS CD HD2 sing N N 158 LYS CD HD3 sing N N 159 LYS CE NZ sing N N 160 LYS CE HE2 sing N N 161 LYS CE HE3 sing N N 162 LYS NZ HZ1 sing N N 163 LYS NZ HZ2 sing N N 164 LYS NZ HZ3 sing N N 165 LYS OXT HXT sing N N 166 PHE N CA sing N N 167 PHE N H sing N N 168 PHE N H2 sing N N 169 PHE CA C sing N N 170 PHE CA CB sing N N 171 PHE CA HA sing N N 172 PHE C O doub N N 173 PHE C OXT sing N N 174 PHE CB CG sing N N 175 PHE CB HB2 sing N N 176 PHE CB HB3 sing N N 177 PHE CG CD1 doub Y N 178 PHE CG CD2 sing Y N 179 PHE CD1 CE1 sing Y N 180 PHE CD1 HD1 sing N N 181 PHE CD2 CE2 doub Y N 182 PHE CD2 HD2 sing N N 183 PHE CE1 CZ doub Y N 184 PHE CE1 HE1 sing N N 185 PHE CE2 CZ sing Y N 186 PHE CE2 HE2 sing N N 187 PHE CZ HZ sing N N 188 PHE OXT HXT sing N N 189 PRO N CA sing N N 190 PRO N CD sing N N 191 PRO N H sing N N 192 PRO CA C sing N N 193 PRO CA CB sing N N 194 PRO CA HA sing N N 195 PRO C O doub N N 196 PRO C OXT sing N N 197 PRO CB CG sing N N 198 PRO CB HB2 sing N N 199 PRO CB HB3 sing N N 200 PRO CG CD sing N N 201 PRO CG HG2 sing N N 202 PRO CG HG3 sing N N 203 PRO CD HD2 sing N N 204 PRO CD HD3 sing N N 205 PRO OXT HXT sing N N 206 THR N CA sing N N 207 THR N H sing N N 208 THR N H2 sing N N 209 THR CA C sing N N 210 THR CA CB sing N N 211 THR CA HA sing N N 212 THR C O doub N N 213 THR C OXT sing N N 214 THR CB OG1 sing N N 215 THR CB CG2 sing N N 216 THR CB HB sing N N 217 THR OG1 HG1 sing N N 218 THR CG2 HG21 sing N N 219 THR CG2 HG22 sing N N 220 THR CG2 HG23 sing N N 221 THR OXT HXT sing N N 222 TYR N CA sing N N 223 TYR N H sing N N 224 TYR N H2 sing N N 225 TYR CA C sing N N 226 TYR CA CB sing N N 227 TYR CA HA sing N N 228 TYR C O doub N N 229 TYR C OXT sing N N 230 TYR CB CG sing N N 231 TYR CB HB2 sing N N 232 TYR CB HB3 sing N N 233 TYR CG CD1 doub Y N 234 TYR CG CD2 sing Y N 235 TYR CD1 CE1 sing Y N 236 TYR CD1 HD1 sing N N 237 TYR CD2 CE2 doub Y N 238 TYR CD2 HD2 sing N N 239 TYR CE1 CZ doub Y N 240 TYR CE1 HE1 sing N N 241 TYR CE2 CZ sing Y N 242 TYR CE2 HE2 sing N N 243 TYR CZ OH sing N N 244 TYR OH HH sing N N 245 TYR OXT HXT sing N N 246 VAL N CA sing N N 247 VAL N H sing N N 248 VAL N H2 sing N N 249 VAL CA C sing N N 250 VAL CA CB sing N N 251 VAL CA HA sing N N 252 VAL C O doub N N 253 VAL C OXT sing N N 254 VAL CB CG1 sing N N 255 VAL CB CG2 sing N N 256 VAL CB HB sing N N 257 VAL CG1 HG11 sing N N 258 VAL CG1 HG12 sing N N 259 VAL CG1 HG13 sing N N 260 VAL CG2 HG21 sing N N 261 VAL CG2 HG22 sing N N 262 VAL CG2 HG23 sing N N 263 VAL OXT HXT sing N N 264 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'Other government' 'Hong Kong' InnoHK 1 'Other government' 'Hong Kong' HMRF-2020-CID-HKU1-8 2 # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model 'AVANCE III' _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 600 _pdbx_nmr_spectrometer.details 'PASEI probe' # _atom_sites.entry_id 8YD6 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C H N O S # loop_ #