data_8YZ7 # _entry.id 8YZ7 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.395 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 8YZ7 pdb_00008yz7 10.2210/pdb8yz7/pdb WWPDB D_1300046710 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2024-07-03 2 'Structure model' 1 1 2024-07-31 3 'Structure model' 1 2 2024-09-11 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' citation 4 3 'Structure model' citation_author # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_volume' 2 2 'Structure model' '_citation.page_first' 3 2 'Structure model' '_citation.page_last' 4 2 'Structure model' '_citation.title' 5 2 'Structure model' '_citation_author.identifier_ORCID' 6 3 'Structure model' '_citation.page_first' 7 3 'Structure model' '_citation.page_last' 8 3 'Structure model' '_citation.title' 9 3 'Structure model' '_citation_author.identifier_ORCID' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 8YZ7 _pdbx_database_status.recvd_initial_deposition_date 2024-04-06 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBC _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_contact_author.id 2 _pdbx_contact_author.email yezhao@zju.edu.cn _pdbx_contact_author.name_first Ye _pdbx_contact_author.name_last Zhao _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-5455-2586 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Zhao, Y.' 1 0000-0002-5455-2586 'Wang, Y.' 2 0009-0003-9462-135X # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Mbio _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2150-7511 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 15 _citation.language ? _citation.page_first e0114424 _citation.page_last e0114424 _citation.title 'cAMP-independent DNA binding of the CRP family protein DdrI from Deinococcus radiodurans.' _citation.year 2024 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1128/mbio.01144-24 _citation.pdbx_database_id_PubMed 38916345 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Wang, Y.' 1 0009-0003-9462-135X primary 'Hu, J.' 2 ? primary 'Gao, X.' 3 ? primary 'Cao, Y.' 4 ? primary 'Ye, S.' 5 ? primary 'Chen, C.' 6 ? primary 'Wang, L.' 7 ? primary 'Xu, H.' 8 ? primary 'Guo, M.' 9 ? primary 'Zhang, D.' 10 ? primary 'Zhou, R.' 11 ? primary 'Hua, Y.' 12 ? primary 'Zhao, Y.' 13 0000-0002-5455-2586 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Transcriptional regulator, FNR/CRP family' 22001.961 1 ? ? ? 'The GenBank accession number A2G07_08515' 2 non-polymer syn 'POTASSIUM ION' 39.098 3 ? ? ? ? 3 water nat water 18.015 65 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MTQTQTAARTFVDTVTYRPGAVILYPGKSDMLYRVSSGLVRVHTMDDDGNGLTLRYVKPGEYFGEEALAGVNRAYFAEAV TDSAIDVINPALMSAEDNLVVTTHLVRTLERAYESIYRLVGKRLRARIAGELLELKDTALATQLDSGETMIYATHDELAA AVGSVRETVTKVVGELSREGVISAGYGKITLKDERALATIAAA ; _entity_poly.pdbx_seq_one_letter_code_can ;MTQTQTAARTFVDTVTYRPGAVILYPGKSDMLYRVSSGLVRVHTMDDDGNGLTLRYVKPGEYFGEEALAGVNRAYFAEAV TDSAIDVINPALMSAEDNLVVTTHLVRTLERAYESIYRLVGKRLRARIAGELLELKDTALATQLDSGETMIYATHDELAA AVGSVRETVTKVVGELSREGVISAGYGKITLKDERALATIAAA ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'POTASSIUM ION' K 3 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 THR n 1 3 GLN n 1 4 THR n 1 5 GLN n 1 6 THR n 1 7 ALA n 1 8 ALA n 1 9 ARG n 1 10 THR n 1 11 PHE n 1 12 VAL n 1 13 ASP n 1 14 THR n 1 15 VAL n 1 16 THR n 1 17 TYR n 1 18 ARG n 1 19 PRO n 1 20 GLY n 1 21 ALA n 1 22 VAL n 1 23 ILE n 1 24 LEU n 1 25 TYR n 1 26 PRO n 1 27 GLY n 1 28 LYS n 1 29 SER n 1 30 ASP n 1 31 MET n 1 32 LEU n 1 33 TYR n 1 34 ARG n 1 35 VAL n 1 36 SER n 1 37 SER n 1 38 GLY n 1 39 LEU n 1 40 VAL n 1 41 ARG n 1 42 VAL n 1 43 HIS n 1 44 THR n 1 45 MET n 1 46 ASP n 1 47 ASP n 1 48 ASP n 1 49 GLY n 1 50 ASN n 1 51 GLY n 1 52 LEU n 1 53 THR n 1 54 LEU n 1 55 ARG n 1 56 TYR n 1 57 VAL n 1 58 LYS n 1 59 PRO n 1 60 GLY n 1 61 GLU n 1 62 TYR n 1 63 PHE n 1 64 GLY n 1 65 GLU n 1 66 GLU n 1 67 ALA n 1 68 LEU n 1 69 ALA n 1 70 GLY n 1 71 VAL n 1 72 ASN n 1 73 ARG n 1 74 ALA n 1 75 TYR n 1 76 PHE n 1 77 ALA n 1 78 GLU n 1 79 ALA n 1 80 VAL n 1 81 THR n 1 82 ASP n 1 83 SER n 1 84 ALA n 1 85 ILE n 1 86 ASP n 1 87 VAL n 1 88 ILE n 1 89 ASN n 1 90 PRO n 1 91 ALA n 1 92 LEU n 1 93 MET n 1 94 SER n 1 95 ALA n 1 96 GLU n 1 97 ASP n 1 98 ASN n 1 99 LEU n 1 100 VAL n 1 101 VAL n 1 102 THR n 1 103 THR n 1 104 HIS n 1 105 LEU n 1 106 VAL n 1 107 ARG n 1 108 THR n 1 109 LEU n 1 110 GLU n 1 111 ARG n 1 112 ALA n 1 113 TYR n 1 114 GLU n 1 115 SER n 1 116 ILE n 1 117 TYR n 1 118 ARG n 1 119 LEU n 1 120 VAL n 1 121 GLY n 1 122 LYS n 1 123 ARG n 1 124 LEU n 1 125 ARG n 1 126 ALA n 1 127 ARG n 1 128 ILE n 1 129 ALA n 1 130 GLY n 1 131 GLU n 1 132 LEU n 1 133 LEU n 1 134 GLU n 1 135 LEU n 1 136 LYS n 1 137 ASP n 1 138 THR n 1 139 ALA n 1 140 LEU n 1 141 ALA n 1 142 THR n 1 143 GLN n 1 144 LEU n 1 145 ASP n 1 146 SER n 1 147 GLY n 1 148 GLU n 1 149 THR n 1 150 MET n 1 151 ILE n 1 152 TYR n 1 153 ALA n 1 154 THR n 1 155 HIS n 1 156 ASP n 1 157 GLU n 1 158 LEU n 1 159 ALA n 1 160 ALA n 1 161 ALA n 1 162 VAL n 1 163 GLY n 1 164 SER n 1 165 VAL n 1 166 ARG n 1 167 GLU n 1 168 THR n 1 169 VAL n 1 170 THR n 1 171 LYS n 1 172 VAL n 1 173 VAL n 1 174 GLY n 1 175 GLU n 1 176 LEU n 1 177 SER n 1 178 ARG n 1 179 GLU n 1 180 GLY n 1 181 VAL n 1 182 ILE n 1 183 SER n 1 184 ALA n 1 185 GLY n 1 186 TYR n 1 187 GLY n 1 188 LYS n 1 189 ILE n 1 190 THR n 1 191 LEU n 1 192 LYS n 1 193 ASP n 1 194 GLU n 1 195 ARG n 1 196 ALA n 1 197 LEU n 1 198 ALA n 1 199 THR n 1 200 ILE n 1 201 ALA n 1 202 ALA n 1 203 ALA n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 203 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene DR_0997 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Deinococcus radiodurans R1 = ATCC 13939 = DSM 20539' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 243230 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc 13939 _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 K non-polymer . 'POTASSIUM ION' ? 'K 1' 39.098 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 THR 2 2 ? ? ? A . n A 1 3 GLN 3 3 ? ? ? A . n A 1 4 THR 4 4 ? ? ? A . n A 1 5 GLN 5 5 ? ? ? A . n A 1 6 THR 6 6 ? ? ? A . n A 1 7 ALA 7 7 ? ? ? A . n A 1 8 ALA 8 8 ? ? ? A . n A 1 9 ARG 9 9 ? ? ? A . n A 1 10 THR 10 10 ? ? ? A . n A 1 11 PHE 11 11 ? ? ? A . n A 1 12 VAL 12 12 12 VAL VAL A . n A 1 13 ASP 13 13 13 ASP ASP A . n A 1 14 THR 14 14 14 THR THR A . n A 1 15 VAL 15 15 15 VAL VAL A . n A 1 16 THR 16 16 16 THR THR A . n A 1 17 TYR 17 17 17 TYR TYR A . n A 1 18 ARG 18 18 18 ARG ARG A . n A 1 19 PRO 19 19 19 PRO PRO A . n A 1 20 GLY 20 20 20 GLY GLY A . n A 1 21 ALA 21 21 21 ALA ALA A . n A 1 22 VAL 22 22 22 VAL VAL A . n A 1 23 ILE 23 23 23 ILE ILE A . n A 1 24 LEU 24 24 24 LEU LEU A . n A 1 25 TYR 25 25 25 TYR TYR A . n A 1 26 PRO 26 26 26 PRO PRO A . n A 1 27 GLY 27 27 27 GLY GLY A . n A 1 28 LYS 28 28 28 LYS LYS A . n A 1 29 SER 29 29 29 SER SER A . n A 1 30 ASP 30 30 30 ASP ASP A . n A 1 31 MET 31 31 31 MET MET A . n A 1 32 LEU 32 32 32 LEU LEU A . n A 1 33 TYR 33 33 33 TYR TYR A . n A 1 34 ARG 34 34 34 ARG ARG A . n A 1 35 VAL 35 35 35 VAL VAL A . n A 1 36 SER 36 36 36 SER SER A . n A 1 37 SER 37 37 37 SER SER A . n A 1 38 GLY 38 38 38 GLY GLY A . n A 1 39 LEU 39 39 39 LEU LEU A . n A 1 40 VAL 40 40 40 VAL VAL A . n A 1 41 ARG 41 41 41 ARG ARG A . n A 1 42 VAL 42 42 42 VAL VAL A . n A 1 43 HIS 43 43 43 HIS HIS A . n A 1 44 THR 44 44 44 THR THR A . n A 1 45 MET 45 45 45 MET MET A . n A 1 46 ASP 46 46 46 ASP ASP A . n A 1 47 ASP 47 47 47 ASP ASP A . n A 1 48 ASP 48 48 48 ASP ASP A . n A 1 49 GLY 49 49 49 GLY GLY A . n A 1 50 ASN 50 50 50 ASN ASN A . n A 1 51 GLY 51 51 51 GLY GLY A . n A 1 52 LEU 52 52 52 LEU LEU A . n A 1 53 THR 53 53 53 THR THR A . n A 1 54 LEU 54 54 54 LEU LEU A . n A 1 55 ARG 55 55 55 ARG ARG A . n A 1 56 TYR 56 56 56 TYR TYR A . n A 1 57 VAL 57 57 57 VAL VAL A . n A 1 58 LYS 58 58 58 LYS LYS A . n A 1 59 PRO 59 59 59 PRO PRO A . n A 1 60 GLY 60 60 60 GLY GLY A . n A 1 61 GLU 61 61 61 GLU GLU A . n A 1 62 TYR 62 62 62 TYR TYR A . n A 1 63 PHE 63 63 63 PHE PHE A . n A 1 64 GLY 64 64 64 GLY GLY A . n A 1 65 GLU 65 65 65 GLU GLU A . n A 1 66 GLU 66 66 66 GLU GLU A . n A 1 67 ALA 67 67 67 ALA ALA A . n A 1 68 LEU 68 68 68 LEU LEU A . n A 1 69 ALA 69 69 69 ALA ALA A . n A 1 70 GLY 70 70 70 GLY GLY A . n A 1 71 VAL 71 71 71 VAL VAL A . n A 1 72 ASN 72 72 72 ASN ASN A . n A 1 73 ARG 73 73 73 ARG ARG A . n A 1 74 ALA 74 74 74 ALA ALA A . n A 1 75 TYR 75 75 75 TYR TYR A . n A 1 76 PHE 76 76 76 PHE PHE A . n A 1 77 ALA 77 77 77 ALA ALA A . n A 1 78 GLU 78 78 78 GLU GLU A . n A 1 79 ALA 79 79 79 ALA ALA A . n A 1 80 VAL 80 80 80 VAL VAL A . n A 1 81 THR 81 81 81 THR THR A . n A 1 82 ASP 82 82 82 ASP ASP A . n A 1 83 SER 83 83 83 SER SER A . n A 1 84 ALA 84 84 84 ALA ALA A . n A 1 85 ILE 85 85 85 ILE ILE A . n A 1 86 ASP 86 86 86 ASP ASP A . n A 1 87 VAL 87 87 87 VAL VAL A . n A 1 88 ILE 88 88 88 ILE ILE A . n A 1 89 ASN 89 89 89 ASN ASN A . n A 1 90 PRO 90 90 90 PRO PRO A . n A 1 91 ALA 91 91 91 ALA ALA A . n A 1 92 LEU 92 92 92 LEU LEU A . n A 1 93 MET 93 93 93 MET MET A . n A 1 94 SER 94 94 94 SER SER A . n A 1 95 ALA 95 95 95 ALA ALA A . n A 1 96 GLU 96 96 96 GLU GLU A . n A 1 97 ASP 97 97 97 ASP ASP A . n A 1 98 ASN 98 98 98 ASN ASN A . n A 1 99 LEU 99 99 99 LEU LEU A . n A 1 100 VAL 100 100 100 VAL VAL A . n A 1 101 VAL 101 101 101 VAL VAL A . n A 1 102 THR 102 102 102 THR THR A . n A 1 103 THR 103 103 103 THR THR A . n A 1 104 HIS 104 104 104 HIS HIS A . n A 1 105 LEU 105 105 105 LEU LEU A . n A 1 106 VAL 106 106 106 VAL VAL A . n A 1 107 ARG 107 107 107 ARG ARG A . n A 1 108 THR 108 108 108 THR THR A . n A 1 109 LEU 109 109 109 LEU LEU A . n A 1 110 GLU 110 110 110 GLU GLU A . n A 1 111 ARG 111 111 111 ARG ARG A . n A 1 112 ALA 112 112 112 ALA ALA A . n A 1 113 TYR 113 113 113 TYR TYR A . n A 1 114 GLU 114 114 114 GLU GLU A . n A 1 115 SER 115 115 115 SER SER A . n A 1 116 ILE 116 116 116 ILE ILE A . n A 1 117 TYR 117 117 117 TYR TYR A . n A 1 118 ARG 118 118 118 ARG ARG A . n A 1 119 LEU 119 119 119 LEU LEU A . n A 1 120 VAL 120 120 120 VAL VAL A . n A 1 121 GLY 121 121 121 GLY GLY A . n A 1 122 LYS 122 122 122 LYS LYS A . n A 1 123 ARG 123 123 123 ARG ARG A . n A 1 124 LEU 124 124 124 LEU LEU A . n A 1 125 ARG 125 125 125 ARG ARG A . n A 1 126 ALA 126 126 126 ALA ALA A . n A 1 127 ARG 127 127 127 ARG ARG A . n A 1 128 ILE 128 128 128 ILE ILE A . n A 1 129 ALA 129 129 129 ALA ALA A . n A 1 130 GLY 130 130 130 GLY GLY A . n A 1 131 GLU 131 131 131 GLU GLU A . n A 1 132 LEU 132 132 132 LEU LEU A . n A 1 133 LEU 133 133 133 LEU LEU A . n A 1 134 GLU 134 134 134 GLU GLU A . n A 1 135 LEU 135 135 135 LEU LEU A . n A 1 136 LYS 136 136 136 LYS LYS A . n A 1 137 ASP 137 137 137 ASP ASP A . n A 1 138 THR 138 138 138 THR THR A . n A 1 139 ALA 139 139 139 ALA ALA A . n A 1 140 LEU 140 140 140 LEU LEU A . n A 1 141 ALA 141 141 141 ALA ALA A . n A 1 142 THR 142 142 142 THR THR A . n A 1 143 GLN 143 143 143 GLN GLN A . n A 1 144 LEU 144 144 144 LEU LEU A . n A 1 145 ASP 145 145 145 ASP ASP A . n A 1 146 SER 146 146 146 SER SER A . n A 1 147 GLY 147 147 147 GLY GLY A . n A 1 148 GLU 148 148 148 GLU GLU A . n A 1 149 THR 149 149 149 THR THR A . n A 1 150 MET 150 150 150 MET MET A . n A 1 151 ILE 151 151 151 ILE ILE A . n A 1 152 TYR 152 152 152 TYR TYR A . n A 1 153 ALA 153 153 153 ALA ALA A . n A 1 154 THR 154 154 154 THR THR A . n A 1 155 HIS 155 155 155 HIS HIS A . n A 1 156 ASP 156 156 156 ASP ASP A . n A 1 157 GLU 157 157 157 GLU GLU A . n A 1 158 LEU 158 158 158 LEU LEU A . n A 1 159 ALA 159 159 159 ALA ALA A . n A 1 160 ALA 160 160 160 ALA ALA A . n A 1 161 ALA 161 161 161 ALA ALA A . n A 1 162 VAL 162 162 162 VAL VAL A . n A 1 163 GLY 163 163 163 GLY GLY A . n A 1 164 SER 164 164 164 SER SER A . n A 1 165 VAL 165 165 165 VAL VAL A . n A 1 166 ARG 166 166 166 ARG ARG A . n A 1 167 GLU 167 167 167 GLU GLU A . n A 1 168 THR 168 168 168 THR THR A . n A 1 169 VAL 169 169 169 VAL VAL A . n A 1 170 THR 170 170 170 THR THR A . n A 1 171 LYS 171 171 171 LYS LYS A . n A 1 172 VAL 172 172 172 VAL VAL A . n A 1 173 VAL 173 173 173 VAL VAL A . n A 1 174 GLY 174 174 174 GLY GLY A . n A 1 175 GLU 175 175 175 GLU GLU A . n A 1 176 LEU 176 176 176 LEU LEU A . n A 1 177 SER 177 177 177 SER SER A . n A 1 178 ARG 178 178 178 ARG ARG A . n A 1 179 GLU 179 179 179 GLU GLU A . n A 1 180 GLY 180 180 180 GLY GLY A . n A 1 181 VAL 181 181 181 VAL VAL A . n A 1 182 ILE 182 182 182 ILE ILE A . n A 1 183 SER 183 183 183 SER SER A . n A 1 184 ALA 184 184 184 ALA ALA A . n A 1 185 GLY 185 185 185 GLY GLY A . n A 1 186 TYR 186 186 186 TYR TYR A . n A 1 187 GLY 187 187 187 GLY GLY A . n A 1 188 LYS 188 188 188 LYS LYS A . n A 1 189 ILE 189 189 189 ILE ILE A . n A 1 190 THR 190 190 190 THR THR A . n A 1 191 LEU 191 191 191 LEU LEU A . n A 1 192 LYS 192 192 192 LYS LYS A . n A 1 193 ASP 193 193 193 ASP ASP A . n A 1 194 GLU 194 194 194 GLU GLU A . n A 1 195 ARG 195 195 195 ARG ARG A . n A 1 196 ALA 196 196 196 ALA ALA A . n A 1 197 LEU 197 197 197 LEU LEU A . n A 1 198 ALA 198 198 198 ALA ALA A . n A 1 199 THR 199 199 199 THR THR A . n A 1 200 ILE 200 200 200 ILE ILE A . n A 1 201 ALA 201 201 201 ALA ALA A . n A 1 202 ALA 202 202 202 ALA ALA A . n A 1 203 ALA 203 203 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 K 1 301 1 K K A . C 2 K 1 302 2 K K A . D 2 K 1 303 3 K K A . E 3 HOH 1 401 4 HOH HOH A . E 3 HOH 2 402 20 HOH HOH A . E 3 HOH 3 403 23 HOH HOH A . E 3 HOH 4 404 36 HOH HOH A . E 3 HOH 5 405 57 HOH HOH A . E 3 HOH 6 406 29 HOH HOH A . E 3 HOH 7 407 31 HOH HOH A . E 3 HOH 8 408 9 HOH HOH A . E 3 HOH 9 409 1 HOH HOH A . E 3 HOH 10 410 11 HOH HOH A . E 3 HOH 11 411 37 HOH HOH A . E 3 HOH 12 412 18 HOH HOH A . E 3 HOH 13 413 46 HOH HOH A . E 3 HOH 14 414 15 HOH HOH A . E 3 HOH 15 415 47 HOH HOH A . E 3 HOH 16 416 12 HOH HOH A . E 3 HOH 17 417 56 HOH HOH A . E 3 HOH 18 418 6 HOH HOH A . E 3 HOH 19 419 33 HOH HOH A . E 3 HOH 20 420 40 HOH HOH A . E 3 HOH 21 421 26 HOH HOH A . E 3 HOH 22 422 2 HOH HOH A . E 3 HOH 23 423 28 HOH HOH A . E 3 HOH 24 424 34 HOH HOH A . E 3 HOH 25 425 27 HOH HOH A . E 3 HOH 26 426 7 HOH HOH A . E 3 HOH 27 427 13 HOH HOH A . E 3 HOH 28 428 38 HOH HOH A . E 3 HOH 29 429 44 HOH HOH A . E 3 HOH 30 430 63 HOH HOH A . E 3 HOH 31 431 55 HOH HOH A . E 3 HOH 32 432 24 HOH HOH A . E 3 HOH 33 433 16 HOH HOH A . E 3 HOH 34 434 35 HOH HOH A . E 3 HOH 35 435 8 HOH HOH A . E 3 HOH 36 436 53 HOH HOH A . E 3 HOH 37 437 41 HOH HOH A . E 3 HOH 38 438 19 HOH HOH A . E 3 HOH 39 439 42 HOH HOH A . E 3 HOH 40 440 52 HOH HOH A . E 3 HOH 41 441 25 HOH HOH A . E 3 HOH 42 442 30 HOH HOH A . E 3 HOH 43 443 17 HOH HOH A . E 3 HOH 44 444 39 HOH HOH A . E 3 HOH 45 445 5 HOH HOH A . E 3 HOH 46 446 54 HOH HOH A . E 3 HOH 47 447 64 HOH HOH A . E 3 HOH 48 448 14 HOH HOH A . E 3 HOH 49 449 62 HOH HOH A . E 3 HOH 50 450 45 HOH HOH A . E 3 HOH 51 451 51 HOH HOH A . E 3 HOH 52 452 3 HOH HOH A . E 3 HOH 53 453 10 HOH HOH A . E 3 HOH 54 454 48 HOH HOH A . E 3 HOH 55 455 21 HOH HOH A . E 3 HOH 56 456 50 HOH HOH A . E 3 HOH 57 457 49 HOH HOH A . E 3 HOH 58 458 43 HOH HOH A . E 3 HOH 59 459 22 HOH HOH A . E 3 HOH 60 460 60 HOH HOH A . E 3 HOH 61 461 32 HOH HOH A . E 3 HOH 62 462 65 HOH HOH A . E 3 HOH 63 463 61 HOH HOH A . E 3 HOH 64 464 59 HOH HOH A . E 3 HOH 65 465 58 HOH HOH A . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? '(1.20.1_4487: ???)' 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XSCALE ? ? ? . 2 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 120.00 _cell.angle_gamma_esd ? _cell.entry_id 8YZ7 _cell.details ? _cell.formula_units_Z ? _cell.length_a 87.170 _cell.length_a_esd ? _cell.length_b 87.170 _cell.length_b_esd ? _cell.length_c 61.640 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 6 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 8YZ7 _symmetry.cell_setting ? _symmetry.Int_Tables_number 154 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 32 2 1' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 8YZ7 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 3.07 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 59.97 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 6.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details 'Bis-Tris, KCl' _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 298 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER2 S 9M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2022-01-01 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9792 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SSRF BEAMLINE BL02U1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9792 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL02U1 _diffrn_source.pdbx_synchrotron_site SSRF # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 8YZ7 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.0 _reflns.d_resolution_low 30 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 18623 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.9 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 19.7 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 23.77 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.075 _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.9990000000000001 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs 0.073 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_CC_star _reflns_shell.pdbx_R_split _reflns_shell.percent_possible_all _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_percent_possible_ellipsoidal _reflns_shell.pdbx_percent_possible_spherical _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous _reflns_shell.pdbx_percent_possible_spherical_anomalous _reflns_shell.pdbx_redundancy_anomalous _reflns_shell.pdbx_CC_half_anomalous _reflns_shell.pdbx_absDiff_over_sigma_anomalous _reflns_shell.pdbx_percent_possible_anomalous 2.00 2.05 ? ? ? ? ? ? 1378 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 0.629 ? ? 1 1 0.981 ? ? ? ? 0.613 ? ? ? ? ? ? ? ? ? 2.05 2.11 ? ? ? ? ? ? 1315 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 0.629 ? ? 2 1 0.973 ? ? ? ? 0.613 ? ? ? ? ? ? ? ? ? 2.11 2.17 ? ? ? ? ? ? 1283 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 0.433 ? ? 3 1 0.985 ? ? ? ? 0.42100000000000004 ? ? ? ? ? ? ? ? ? 2.17 2.24 ? ? ? ? ? ? 1274 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 0.35100000000000003 ? ? 4 1 0.991 ? ? ? ? 0.342 ? ? ? ? ? ? ? ? ? 2.24 2.31 ? ? ? ? ? ? 1210 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 0.341 ? ? 5 1 0.988 ? ? ? ? 0.33299999999999996 ? ? ? ? ? ? ? ? ? 2.31 2.39 ? ? ? ? ? ? 1162 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 0.231 ? ? 6 1 0.995 ? ? ? ? 0.225 ? ? ? ? ? ? ? ? ? 2.39 2.48 ? ? ? ? ? ? 1156 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 0.18 ? ? 7 1 0.997 ? ? ? ? 0.17600000000000002 ? ? ? ? ? ? ? ? ? 2.48 2.58 ? ? ? ? ? ? 1068 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 0.156 ? ? 8 1 0.997 ? ? ? ? 0.152 ? ? ? ? ? ? ? ? ? 2.58 2.7 ? ? ? ? ? ? 1057 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 0.136 ? ? 9 1 0.997 ? ? ? ? 0.133 ? ? ? ? ? ? ? ? ? 2.70 2.83 ? ? ? ? ? ? 1006 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 0.11 ? ? 10 1 0.998 ? ? ? ? 0.107 ? ? ? ? ? ? ? ? ? 2.83 2.98 ? ? ? ? ? ? 975 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 0.092 ? ? 11 1 0.998 ? ? ? ? 0.09 ? ? ? ? ? ? ? ? ? 2.98 3.16 ? ? ? ? ? ? 892 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 0.077 ? ? 12 1 0.9990000000000001 ? ? ? ? 0.075 ? ? ? ? ? ? ? ? ? 3.16 3.38 ? ? ? ? ? ? 869 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 0.073 ? ? 13 1 0.998 ? ? ? ? 0.071 ? ? ? ? ? ? ? ? ? 3.38 3.65 ? ? ? ? ? ? 798 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 0.068 ? ? 14 1 0.9990000000000001 ? ? ? ? 0.066 ? ? ? ? ? ? ? ? ? 3.65 4.0 ? ? ? ? ? ? 749 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 0.067 ? ? 15 1 0.998 ? ? ? ? 0.065 ? ? ? ? ? ? ? ? ? 4.00 4.47 ? ? ? ? ? ? 666 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 0.061 ? ? 16 1 0.9990000000000001 ? ? ? ? 0.06 ? ? ? ? ? ? ? ? ? 4.47 5.16 ? ? ? ? ? ? 609 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 0.061 ? ? 17 1 0.9990000000000001 ? ? ? ? 0.059000000000000004 ? ? ? ? ? ? ? ? ? 5.16 6.32 ? ? ? ? ? ? 518 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 0.06 ? ? 18 1 0.9990000000000001 ? ? ? ? 0.057999999999999996 ? ? ? ? ? ? ? ? ? 6.32 8.94 ? ? ? ? ? ? 406 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 0.051 ? ? 19 1 0.9990000000000001 ? ? ? ? 0.05 ? ? ? ? ? ? ? ? ? 8.94 30 ? ? ? ? ? ? 232 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 0.054000000000000006 ? ? 20 1 0.9990000000000001 ? ? ? ? 0.052000000000000005 ? ? ? ? ? ? ? ? ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean ? _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 8YZ7 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.00 _refine.ls_d_res_low 30 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 18612 _refine.ls_number_reflns_R_free 984 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.91 _refine.ls_percent_reflns_R_free 5.29 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2037 _refine.ls_R_factor_R_free 0.2262 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2024 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.35 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 2ZCW _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.10 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 27.02 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.20 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 2.00 _refine_hist.d_res_low 30 _refine_hist.number_atoms_solvent 65 _refine_hist.number_atoms_total 1520 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 1452 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 3 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.006 ? ? ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.779 ? ? ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 10.656 ? 538 ? f_dihedral_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.047 ? 241 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.006 ? 255 ? f_plane_restr ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free _refine_ls_shell.R_factor_R_free 'X-RAY DIFFRACTION' 2.00 2.11 . . 143 2490 100.00 . . . . 0.2345 . . . . . . . . . . . 0.2471 'X-RAY DIFFRACTION' 2.11 2.24 . . 136 2482 100.00 . . . . 0.2082 . . . . . . . . . . . 0.2729 'X-RAY DIFFRACTION' 2.24 2.41 . . 122 2496 100.00 . . . . 0.2477 . . . . . . . . . . . 0.2755 'X-RAY DIFFRACTION' 2.41 2.65 . . 175 2466 100.00 . . . . 0.2516 . . . . . . . . . . . 0.2679 'X-RAY DIFFRACTION' 2.65 3.03 . . 145 2514 100.00 . . . . 0.2421 . . . . . . . . . . . 0.2990 'X-RAY DIFFRACTION' 3.04 3.82 . . 129 2536 100.00 . . . . 0.2005 . . . . . . . . . . . 0.2005 'X-RAY DIFFRACTION' 3.82 25.89 . . 134 2644 100.00 . . . . 0.1733 . . . . . . . . . . . 0.1953 # _struct.entry_id 8YZ7 _struct.title 'Crystal structure of DdrI, a CRP family protein from Deinococcus radiodurans' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 8YZ7 _struct_keywords.text 'DNA binding, gene regulation, TRANSCRIPTION' _struct_keywords.pdbx_keywords TRANSCRIPTION # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 2 ? E N N 3 ? # _struct_ref.id 1 _struct_ref.db_name PDB _struct_ref.db_code 8YZ7 _struct_ref.pdbx_db_accession 8YZ7 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 8YZ7 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 203 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession 8YZ7 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 203 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 203 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 3980 ? 1 MORE -26 ? 1 'SSA (A^2)' 17970 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 4_555 y,x,-z -0.5000000000 0.8660254038 0.0000000000 0.0000000000 0.8660254038 0.5000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 GLU A 65 ? GLY A 70 ? GLU A 65 GLY A 70 1 ? 6 HELX_P HELX_P2 AA2 SER A 94 ? LYS A 122 ? SER A 94 LYS A 122 1 ? 29 HELX_P HELX_P3 AA3 ARG A 123 ? LYS A 136 ? ARG A 123 LYS A 136 1 ? 14 HELX_P HELX_P4 AA4 THR A 154 ? GLY A 163 ? THR A 154 GLY A 163 1 ? 10 HELX_P HELX_P5 AA5 VAL A 165 ? GLU A 179 ? VAL A 165 GLU A 179 1 ? 15 HELX_P HELX_P6 AA6 ASP A 193 ? ALA A 202 ? ASP A 193 ALA A 202 1 ? 10 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? B K . K ? ? ? 1_555 E HOH . O ? ? A K 301 A HOH 445 1_555 ? ? ? ? ? ? ? 3.372 ? ? metalc2 metalc ? ? D K . K ? ? ? 1_555 E HOH . O ? ? A K 303 A HOH 404 1_555 ? ? ? ? ? ? ? 3.056 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 4 ? AA2 ? 4 ? AA3 ? 4 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel AA3 1 2 ? anti-parallel AA3 2 3 ? anti-parallel AA3 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ASP A 13 ? TYR A 17 ? ASP A 13 TYR A 17 AA1 2 SER A 83 ? ILE A 88 ? SER A 83 ILE A 88 AA1 3 LEU A 32 ? SER A 37 ? LEU A 32 SER A 37 AA1 4 TYR A 62 ? PHE A 63 ? TYR A 62 PHE A 63 AA2 1 VAL A 22 ? LEU A 24 ? VAL A 22 LEU A 24 AA2 2 PHE A 76 ? ALA A 79 ? PHE A 76 ALA A 79 AA2 3 VAL A 40 ? MET A 45 ? VAL A 40 MET A 45 AA2 4 GLY A 51 ? VAL A 57 ? GLY A 51 VAL A 57 AA3 1 ALA A 141 ? GLN A 143 ? ALA A 141 GLN A 143 AA3 2 THR A 149 ? TYR A 152 ? THR A 149 TYR A 152 AA3 3 LYS A 188 ? LEU A 191 ? LYS A 188 LEU A 191 AA3 4 ILE A 182 ? ALA A 184 ? ILE A 182 ALA A 184 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N ASP A 13 ? N ASP A 13 O VAL A 87 ? O VAL A 87 AA1 2 3 O ILE A 88 ? O ILE A 88 N LEU A 32 ? N LEU A 32 AA1 3 4 N TYR A 33 ? N TYR A 33 O PHE A 63 ? O PHE A 63 AA2 1 2 N ILE A 23 ? N ILE A 23 O ALA A 77 ? O ALA A 77 AA2 2 3 O PHE A 76 ? O PHE A 76 N HIS A 43 ? N HIS A 43 AA2 3 4 N VAL A 42 ? N VAL A 42 O LEU A 54 ? O LEU A 54 AA3 1 2 N THR A 142 ? N THR A 142 O MET A 150 ? O MET A 150 AA3 2 3 N THR A 149 ? N THR A 149 O LEU A 191 ? O LEU A 191 AA3 3 4 O THR A 190 ? O THR A 190 N SER A 183 ? N SER A 183 # _pdbx_entry_details.entry_id 8YZ7 _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest N _pdbx_entry_details.has_protein_modification ? # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id ASP _pdbx_validate_torsion.auth_asym_id A _pdbx_validate_torsion.auth_seq_id 30 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi -147.86 _pdbx_validate_torsion.psi -88.34 # _pdbx_refine_tls.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls.id 1 _pdbx_refine_tls.details ? _pdbx_refine_tls.method refined _pdbx_refine_tls.origin_x -8.821 _pdbx_refine_tls.origin_y -33.502 _pdbx_refine_tls.origin_z -9.543 _pdbx_refine_tls.T[1][1] 0.2505 _pdbx_refine_tls.T[2][2] 0.3147 _pdbx_refine_tls.T[3][3] 0.2914 _pdbx_refine_tls.T[1][2] 0.0063 _pdbx_refine_tls.T[1][3] -0.0114 _pdbx_refine_tls.T[2][3] 0.0595 _pdbx_refine_tls.L[1][1] 1.2114 _pdbx_refine_tls.L[2][2] 1.0610 _pdbx_refine_tls.L[3][3] 1.4875 _pdbx_refine_tls.L[1][2] -0.5616 _pdbx_refine_tls.L[1][3] -0.3249 _pdbx_refine_tls.L[2][3] 0.8168 _pdbx_refine_tls.S[1][1] 0.0101 _pdbx_refine_tls.S[2][2] -0.0909 _pdbx_refine_tls.S[3][3] 0.0000 _pdbx_refine_tls.S[1][2] 0.0245 _pdbx_refine_tls.S[1][3] 0.1485 _pdbx_refine_tls.S[2][3] -0.0002 _pdbx_refine_tls.S[2][1] -0.0502 _pdbx_refine_tls.S[3][1] -0.0195 _pdbx_refine_tls.S[3][2] 0.1453 # loop_ _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.selection_details _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.selection 'X-RAY DIFFRACTION' 1 1 A 301 A 303 '( CHAIN A AND ( RESID 301:303 OR RESID 401:465 ) )' ? ? ? ? ? 'X-RAY DIFFRACTION' 2 1 A 401 A 465 '( CHAIN A AND ( RESID 301:303 OR RESID 401:465 ) )' ? ? ? ? ? # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A THR 2 ? A THR 2 3 1 Y 1 A GLN 3 ? A GLN 3 4 1 Y 1 A THR 4 ? A THR 4 5 1 Y 1 A GLN 5 ? A GLN 5 6 1 Y 1 A THR 6 ? A THR 6 7 1 Y 1 A ALA 7 ? A ALA 7 8 1 Y 1 A ALA 8 ? A ALA 8 9 1 Y 1 A ARG 9 ? A ARG 9 10 1 Y 1 A THR 10 ? A THR 10 11 1 Y 1 A PHE 11 ? A PHE 11 12 1 Y 1 A ALA 203 ? A ALA 203 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 GLU N N N N 94 GLU CA C N S 95 GLU C C N N 96 GLU O O N N 97 GLU CB C N N 98 GLU CG C N N 99 GLU CD C N N 100 GLU OE1 O N N 101 GLU OE2 O N N 102 GLU OXT O N N 103 GLU H H N N 104 GLU H2 H N N 105 GLU HA H N N 106 GLU HB2 H N N 107 GLU HB3 H N N 108 GLU HG2 H N N 109 GLU HG3 H N N 110 GLU HE2 H N N 111 GLU HXT H N N 112 GLY N N N N 113 GLY CA C N N 114 GLY C C N N 115 GLY O O N N 116 GLY OXT O N N 117 GLY H H N N 118 GLY H2 H N N 119 GLY HA2 H N N 120 GLY HA3 H N N 121 GLY HXT H N N 122 HIS N N N N 123 HIS CA C N S 124 HIS C C N N 125 HIS O O N N 126 HIS CB C N N 127 HIS CG C Y N 128 HIS ND1 N Y N 129 HIS CD2 C Y N 130 HIS CE1 C Y N 131 HIS NE2 N Y N 132 HIS OXT O N N 133 HIS H H N N 134 HIS H2 H N N 135 HIS HA H N N 136 HIS HB2 H N N 137 HIS HB3 H N N 138 HIS HD1 H N N 139 HIS HD2 H N N 140 HIS HE1 H N N 141 HIS HE2 H N N 142 HIS HXT H N N 143 HOH O O N N 144 HOH H1 H N N 145 HOH H2 H N N 146 ILE N N N N 147 ILE CA C N S 148 ILE C C N N 149 ILE O O N N 150 ILE CB C N S 151 ILE CG1 C N N 152 ILE CG2 C N N 153 ILE CD1 C N N 154 ILE OXT O N N 155 ILE H H N N 156 ILE H2 H N N 157 ILE HA H N N 158 ILE HB H N N 159 ILE HG12 H N N 160 ILE HG13 H N N 161 ILE HG21 H N N 162 ILE HG22 H N N 163 ILE HG23 H N N 164 ILE HD11 H N N 165 ILE HD12 H N N 166 ILE HD13 H N N 167 ILE HXT H N N 168 K K K N N 169 LEU N N N N 170 LEU CA C N S 171 LEU C C N N 172 LEU O O N N 173 LEU CB C N N 174 LEU CG C N N 175 LEU CD1 C N N 176 LEU CD2 C N N 177 LEU OXT O N N 178 LEU H H N N 179 LEU H2 H N N 180 LEU HA H N N 181 LEU HB2 H N N 182 LEU HB3 H N N 183 LEU HG H N N 184 LEU HD11 H N N 185 LEU HD12 H N N 186 LEU HD13 H N N 187 LEU HD21 H N N 188 LEU HD22 H N N 189 LEU HD23 H N N 190 LEU HXT H N N 191 LYS N N N N 192 LYS CA C N S 193 LYS C C N N 194 LYS O O N N 195 LYS CB C N N 196 LYS CG C N N 197 LYS CD C N N 198 LYS CE C N N 199 LYS NZ N N N 200 LYS OXT O N N 201 LYS H H N N 202 LYS H2 H N N 203 LYS HA H N N 204 LYS HB2 H N N 205 LYS HB3 H N N 206 LYS HG2 H N N 207 LYS HG3 H N N 208 LYS HD2 H N N 209 LYS HD3 H N N 210 LYS HE2 H N N 211 LYS HE3 H N N 212 LYS HZ1 H N N 213 LYS HZ2 H N N 214 LYS HZ3 H N N 215 LYS HXT H N N 216 MET N N N N 217 MET CA C N S 218 MET C C N N 219 MET O O N N 220 MET CB C N N 221 MET CG C N N 222 MET SD S N N 223 MET CE C N N 224 MET OXT O N N 225 MET H H N N 226 MET H2 H N N 227 MET HA H N N 228 MET HB2 H N N 229 MET HB3 H N N 230 MET HG2 H N N 231 MET HG3 H N N 232 MET HE1 H N N 233 MET HE2 H N N 234 MET HE3 H N N 235 MET HXT H N N 236 PHE N N N N 237 PHE CA C N S 238 PHE C C N N 239 PHE O O N N 240 PHE CB C N N 241 PHE CG C Y N 242 PHE CD1 C Y N 243 PHE CD2 C Y N 244 PHE CE1 C Y N 245 PHE CE2 C Y N 246 PHE CZ C Y N 247 PHE OXT O N N 248 PHE H H N N 249 PHE H2 H N N 250 PHE HA H N N 251 PHE HB2 H N N 252 PHE HB3 H N N 253 PHE HD1 H N N 254 PHE HD2 H N N 255 PHE HE1 H N N 256 PHE HE2 H N N 257 PHE HZ H N N 258 PHE HXT H N N 259 PRO N N N N 260 PRO CA C N S 261 PRO C C N N 262 PRO O O N N 263 PRO CB C N N 264 PRO CG C N N 265 PRO CD C N N 266 PRO OXT O N N 267 PRO H H N N 268 PRO HA H N N 269 PRO HB2 H N N 270 PRO HB3 H N N 271 PRO HG2 H N N 272 PRO HG3 H N N 273 PRO HD2 H N N 274 PRO HD3 H N N 275 PRO HXT H N N 276 SER N N N N 277 SER CA C N S 278 SER C C N N 279 SER O O N N 280 SER CB C N N 281 SER OG O N N 282 SER OXT O N N 283 SER H H N N 284 SER H2 H N N 285 SER HA H N N 286 SER HB2 H N N 287 SER HB3 H N N 288 SER HG H N N 289 SER HXT H N N 290 THR N N N N 291 THR CA C N S 292 THR C C N N 293 THR O O N N 294 THR CB C N R 295 THR OG1 O N N 296 THR CG2 C N N 297 THR OXT O N N 298 THR H H N N 299 THR H2 H N N 300 THR HA H N N 301 THR HB H N N 302 THR HG1 H N N 303 THR HG21 H N N 304 THR HG22 H N N 305 THR HG23 H N N 306 THR HXT H N N 307 TYR N N N N 308 TYR CA C N S 309 TYR C C N N 310 TYR O O N N 311 TYR CB C N N 312 TYR CG C Y N 313 TYR CD1 C Y N 314 TYR CD2 C Y N 315 TYR CE1 C Y N 316 TYR CE2 C Y N 317 TYR CZ C Y N 318 TYR OH O N N 319 TYR OXT O N N 320 TYR H H N N 321 TYR H2 H N N 322 TYR HA H N N 323 TYR HB2 H N N 324 TYR HB3 H N N 325 TYR HD1 H N N 326 TYR HD2 H N N 327 TYR HE1 H N N 328 TYR HE2 H N N 329 TYR HH H N N 330 TYR HXT H N N 331 VAL N N N N 332 VAL CA C N S 333 VAL C C N N 334 VAL O O N N 335 VAL CB C N N 336 VAL CG1 C N N 337 VAL CG2 C N N 338 VAL OXT O N N 339 VAL H H N N 340 VAL H2 H N N 341 VAL HA H N N 342 VAL HB H N N 343 VAL HG11 H N N 344 VAL HG12 H N N 345 VAL HG13 H N N 346 VAL HG21 H N N 347 VAL HG22 H N N 348 VAL HG23 H N N 349 VAL HXT H N N 350 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 HIS N CA sing N N 116 HIS N H sing N N 117 HIS N H2 sing N N 118 HIS CA C sing N N 119 HIS CA CB sing N N 120 HIS CA HA sing N N 121 HIS C O doub N N 122 HIS C OXT sing N N 123 HIS CB CG sing N N 124 HIS CB HB2 sing N N 125 HIS CB HB3 sing N N 126 HIS CG ND1 sing Y N 127 HIS CG CD2 doub Y N 128 HIS ND1 CE1 doub Y N 129 HIS ND1 HD1 sing N N 130 HIS CD2 NE2 sing Y N 131 HIS CD2 HD2 sing N N 132 HIS CE1 NE2 sing Y N 133 HIS CE1 HE1 sing N N 134 HIS NE2 HE2 sing N N 135 HIS OXT HXT sing N N 136 HOH O H1 sing N N 137 HOH O H2 sing N N 138 ILE N CA sing N N 139 ILE N H sing N N 140 ILE N H2 sing N N 141 ILE CA C sing N N 142 ILE CA CB sing N N 143 ILE CA HA sing N N 144 ILE C O doub N N 145 ILE C OXT sing N N 146 ILE CB CG1 sing N N 147 ILE CB CG2 sing N N 148 ILE CB HB sing N N 149 ILE CG1 CD1 sing N N 150 ILE CG1 HG12 sing N N 151 ILE CG1 HG13 sing N N 152 ILE CG2 HG21 sing N N 153 ILE CG2 HG22 sing N N 154 ILE CG2 HG23 sing N N 155 ILE CD1 HD11 sing N N 156 ILE CD1 HD12 sing N N 157 ILE CD1 HD13 sing N N 158 ILE OXT HXT sing N N 159 LEU N CA sing N N 160 LEU N H sing N N 161 LEU N H2 sing N N 162 LEU CA C sing N N 163 LEU CA CB sing N N 164 LEU CA HA sing N N 165 LEU C O doub N N 166 LEU C OXT sing N N 167 LEU CB CG sing N N 168 LEU CB HB2 sing N N 169 LEU CB HB3 sing N N 170 LEU CG CD1 sing N N 171 LEU CG CD2 sing N N 172 LEU CG HG sing N N 173 LEU CD1 HD11 sing N N 174 LEU CD1 HD12 sing N N 175 LEU CD1 HD13 sing N N 176 LEU CD2 HD21 sing N N 177 LEU CD2 HD22 sing N N 178 LEU CD2 HD23 sing N N 179 LEU OXT HXT sing N N 180 LYS N CA sing N N 181 LYS N H sing N N 182 LYS N H2 sing N N 183 LYS CA C sing N N 184 LYS CA CB sing N N 185 LYS CA HA sing N N 186 LYS C O doub N N 187 LYS C OXT sing N N 188 LYS CB CG sing N N 189 LYS CB HB2 sing N N 190 LYS CB HB3 sing N N 191 LYS CG CD sing N N 192 LYS CG HG2 sing N N 193 LYS CG HG3 sing N N 194 LYS CD CE sing N N 195 LYS CD HD2 sing N N 196 LYS CD HD3 sing N N 197 LYS CE NZ sing N N 198 LYS CE HE2 sing N N 199 LYS CE HE3 sing N N 200 LYS NZ HZ1 sing N N 201 LYS NZ HZ2 sing N N 202 LYS NZ HZ3 sing N N 203 LYS OXT HXT sing N N 204 MET N CA sing N N 205 MET N H sing N N 206 MET N H2 sing N N 207 MET CA C sing N N 208 MET CA CB sing N N 209 MET CA HA sing N N 210 MET C O doub N N 211 MET C OXT sing N N 212 MET CB CG sing N N 213 MET CB HB2 sing N N 214 MET CB HB3 sing N N 215 MET CG SD sing N N 216 MET CG HG2 sing N N 217 MET CG HG3 sing N N 218 MET SD CE sing N N 219 MET CE HE1 sing N N 220 MET CE HE2 sing N N 221 MET CE HE3 sing N N 222 MET OXT HXT sing N N 223 PHE N CA sing N N 224 PHE N H sing N N 225 PHE N H2 sing N N 226 PHE CA C sing N N 227 PHE CA CB sing N N 228 PHE CA HA sing N N 229 PHE C O doub N N 230 PHE C OXT sing N N 231 PHE CB CG sing N N 232 PHE CB HB2 sing N N 233 PHE CB HB3 sing N N 234 PHE CG CD1 doub Y N 235 PHE CG CD2 sing Y N 236 PHE CD1 CE1 sing Y N 237 PHE CD1 HD1 sing N N 238 PHE CD2 CE2 doub Y N 239 PHE CD2 HD2 sing N N 240 PHE CE1 CZ doub Y N 241 PHE CE1 HE1 sing N N 242 PHE CE2 CZ sing Y N 243 PHE CE2 HE2 sing N N 244 PHE CZ HZ sing N N 245 PHE OXT HXT sing N N 246 PRO N CA sing N N 247 PRO N CD sing N N 248 PRO N H sing N N 249 PRO CA C sing N N 250 PRO CA CB sing N N 251 PRO CA HA sing N N 252 PRO C O doub N N 253 PRO C OXT sing N N 254 PRO CB CG sing N N 255 PRO CB HB2 sing N N 256 PRO CB HB3 sing N N 257 PRO CG CD sing N N 258 PRO CG HG2 sing N N 259 PRO CG HG3 sing N N 260 PRO CD HD2 sing N N 261 PRO CD HD3 sing N N 262 PRO OXT HXT sing N N 263 SER N CA sing N N 264 SER N H sing N N 265 SER N H2 sing N N 266 SER CA C sing N N 267 SER CA CB sing N N 268 SER CA HA sing N N 269 SER C O doub N N 270 SER C OXT sing N N 271 SER CB OG sing N N 272 SER CB HB2 sing N N 273 SER CB HB3 sing N N 274 SER OG HG sing N N 275 SER OXT HXT sing N N 276 THR N CA sing N N 277 THR N H sing N N 278 THR N H2 sing N N 279 THR CA C sing N N 280 THR CA CB sing N N 281 THR CA HA sing N N 282 THR C O doub N N 283 THR C OXT sing N N 284 THR CB OG1 sing N N 285 THR CB CG2 sing N N 286 THR CB HB sing N N 287 THR OG1 HG1 sing N N 288 THR CG2 HG21 sing N N 289 THR CG2 HG22 sing N N 290 THR CG2 HG23 sing N N 291 THR OXT HXT sing N N 292 TYR N CA sing N N 293 TYR N H sing N N 294 TYR N H2 sing N N 295 TYR CA C sing N N 296 TYR CA CB sing N N 297 TYR CA HA sing N N 298 TYR C O doub N N 299 TYR C OXT sing N N 300 TYR CB CG sing N N 301 TYR CB HB2 sing N N 302 TYR CB HB3 sing N N 303 TYR CG CD1 doub Y N 304 TYR CG CD2 sing Y N 305 TYR CD1 CE1 sing Y N 306 TYR CD1 HD1 sing N N 307 TYR CD2 CE2 doub Y N 308 TYR CD2 HD2 sing N N 309 TYR CE1 CZ doub Y N 310 TYR CE1 HE1 sing N N 311 TYR CE2 CZ sing Y N 312 TYR CE2 HE2 sing N N 313 TYR CZ OH sing N N 314 TYR OH HH sing N N 315 TYR OXT HXT sing N N 316 VAL N CA sing N N 317 VAL N H sing N N 318 VAL N H2 sing N N 319 VAL CA C sing N N 320 VAL CA CB sing N N 321 VAL CA HA sing N N 322 VAL C O doub N N 323 VAL C OXT sing N N 324 VAL CB CG1 sing N N 325 VAL CB CG2 sing N N 326 VAL CB HB sing N N 327 VAL CG1 HG11 sing N N 328 VAL CG1 HG12 sing N N 329 VAL CG1 HG13 sing N N 330 VAL CG2 HG21 sing N N 331 VAL CG2 HG22 sing N N 332 VAL CG2 HG23 sing N N 333 VAL OXT HXT sing N N 334 # _pdbx_audit_support.funding_organization 'National Natural Science Foundation of China (NSFC)' _pdbx_audit_support.country China _pdbx_audit_support.grant_number 32222001 _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 2ZCW _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 8YZ7 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 0.011472 _atom_sites.fract_transf_matrix[1][2] 0.006623 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.013247 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.016223 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C K N O S # loop_