data_8Z4A # _entry.id 8Z4A # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.403 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 8Z4A pdb_00008z4a 10.2210/pdb8z4a/pdb WWPDB D_1300044764 ? ? BMRB 51791 ? 10.13018/BMR51791 # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2025-04-23 _pdbx_audit_revision_history.part_number ? # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr . _pdbx_database_status.entry_id 8Z4A _pdbx_database_status.recvd_initial_deposition_date 2024-04-17 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs . _pdbx_database_status.status_code_nmr_data REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _pdbx_database_related.db_name _pdbx_database_related.details _pdbx_database_related.db_id _pdbx_database_related.content_type BMRB 'Chemical shift of DRB7.2M' 51790 unspecified BMRB . 51791 unspecified # _pdbx_contact_author.id 4 _pdbx_contact_author.email mvdesh@ccmb.res.in _pdbx_contact_author.name_first Mandar _pdbx_contact_author.name_last Deshmukh _pdbx_contact_author.name_mi V _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0003-2447-9725 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Deshmukh, M.V.' 1 0000-0003-2447-9725 'Paturi, S.' 2 0000-0003-2468-8383 'Patra, D.' 3 0000-0002-4427-7357 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Elife _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2050-084X _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'The mechanism of DRB7.2:DRB4 mediated sequestering of endogenous inverted-repeat dsRNA precursors in plants' _citation.year 2025 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.7554/elife.105762.1 _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Paturi, S.' 1 ? primary 'Patra, D.' 2 ? primary 'Behera, P.C.' 3 ? primary 'Aute, R.' 4 ? primary 'Waghela, N.' 5 ? primary 'Kinatukara, P.' 6 ? primary 'Deshmukh, M.V.' 7 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Double-stranded RNA-binding protein 4' _entity.formula_weight 8268.510 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'dsRNA-binding protein 4,AtDRB4' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code METSSCVVDESEKKKLIMGTGHLSIPTGQHVVCRPWNPEITLPQDAEMLFRDDKFIAYRLVKPLEHHHHHH _entity_poly.pdbx_seq_one_letter_code_can METSSCVVDESEKKKLIMGTGHLSIPTGQHVVCRPWNPEITLPQDAEMLFRDDKFIAYRLVKPLEHHHHHH _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLU n 1 3 THR n 1 4 SER n 1 5 SER n 1 6 CYS n 1 7 VAL n 1 8 VAL n 1 9 ASP n 1 10 GLU n 1 11 SER n 1 12 GLU n 1 13 LYS n 1 14 LYS n 1 15 LYS n 1 16 LEU n 1 17 ILE n 1 18 MET n 1 19 GLY n 1 20 THR n 1 21 GLY n 1 22 HIS n 1 23 LEU n 1 24 SER n 1 25 ILE n 1 26 PRO n 1 27 THR n 1 28 GLY n 1 29 GLN n 1 30 HIS n 1 31 VAL n 1 32 VAL n 1 33 CYS n 1 34 ARG n 1 35 PRO n 1 36 TRP n 1 37 ASN n 1 38 PRO n 1 39 GLU n 1 40 ILE n 1 41 THR n 1 42 LEU n 1 43 PRO n 1 44 GLN n 1 45 ASP n 1 46 ALA n 1 47 GLU n 1 48 MET n 1 49 LEU n 1 50 PHE n 1 51 ARG n 1 52 ASP n 1 53 ASP n 1 54 LYS n 1 55 PHE n 1 56 ILE n 1 57 ALA n 1 58 TYR n 1 59 ARG n 1 60 LEU n 1 61 VAL n 1 62 LYS n 1 63 PRO n 1 64 LEU n 1 65 GLU n 1 66 HIS n 1 67 HIS n 1 68 HIS n 1 69 HIS n 1 70 HIS n 1 71 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 71 _entity_src_gen.gene_src_common_name 'thale cress' _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene DBR4 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Arabidopsis thaliana' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 3702 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET30a _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 293 ? ? ? A . n A 1 2 GLU 2 294 ? ? ? A . n A 1 3 THR 3 295 ? ? ? A . n A 1 4 SER 4 296 ? ? ? A . n A 1 5 SER 5 297 ? ? ? A . n A 1 6 CYS 6 298 ? ? ? A . n A 1 7 VAL 7 299 ? ? ? A . n A 1 8 VAL 8 300 ? ? ? A . n A 1 9 ASP 9 301 ? ? ? A . n A 1 10 GLU 10 302 ? ? ? A . n A 1 11 SER 11 303 ? ? ? A . n A 1 12 GLU 12 304 ? ? ? A . n A 1 13 LYS 13 305 ? ? ? A . n A 1 14 LYS 14 306 ? ? ? A . n A 1 15 LYS 15 307 ? ? ? A . n A 1 16 LEU 16 308 ? ? ? A . n A 1 17 ILE 17 309 ? ? ? A . n A 1 18 MET 18 310 ? ? ? A . n A 1 19 GLY 19 311 ? ? ? A . n A 1 20 THR 20 312 ? ? ? A . n A 1 21 GLY 21 313 ? ? ? A . n A 1 22 HIS 22 314 ? ? ? A . n A 1 23 LEU 23 315 ? ? ? A . n A 1 24 SER 24 316 ? ? ? A . n A 1 25 ILE 25 317 317 ILE ILE A . n A 1 26 PRO 26 318 318 PRO PRO A . n A 1 27 THR 27 319 319 THR THR A . n A 1 28 GLY 28 320 320 GLY GLY A . n A 1 29 GLN 29 321 321 GLN GLN A . n A 1 30 HIS 30 322 322 HIS HIS A . n A 1 31 VAL 31 323 323 VAL VAL A . n A 1 32 VAL 32 324 324 VAL VAL A . n A 1 33 CYS 33 325 325 CYS CYS A . n A 1 34 ARG 34 326 326 ARG ARG A . n A 1 35 PRO 35 327 327 PRO PRO A . n A 1 36 TRP 36 328 328 TRP TRP A . n A 1 37 ASN 37 329 329 ASN ASN A . n A 1 38 PRO 38 330 330 PRO PRO A . n A 1 39 GLU 39 331 331 GLU GLU A . n A 1 40 ILE 40 332 332 ILE ILE A . n A 1 41 THR 41 333 333 THR THR A . n A 1 42 LEU 42 334 334 LEU LEU A . n A 1 43 PRO 43 335 335 PRO PRO A . n A 1 44 GLN 44 336 336 GLN GLN A . n A 1 45 ASP 45 337 337 ASP ASP A . n A 1 46 ALA 46 338 338 ALA ALA A . n A 1 47 GLU 47 339 339 GLU GLU A . n A 1 48 MET 48 340 340 MET MET A . n A 1 49 LEU 49 341 341 LEU LEU A . n A 1 50 PHE 50 342 342 PHE PHE A . n A 1 51 ARG 51 343 343 ARG ARG A . n A 1 52 ASP 52 344 344 ASP ASP A . n A 1 53 ASP 53 345 345 ASP ASP A . n A 1 54 LYS 54 346 346 LYS LYS A . n A 1 55 PHE 55 347 347 PHE PHE A . n A 1 56 ILE 56 348 348 ILE ILE A . n A 1 57 ALA 57 349 349 ALA ALA A . n A 1 58 TYR 58 350 350 TYR TYR A . n A 1 59 ARG 59 351 351 ARG ARG A . n A 1 60 LEU 60 352 352 LEU LEU A . n A 1 61 VAL 61 353 353 VAL VAL A . n A 1 62 LYS 62 354 ? ? ? A . n A 1 63 PRO 63 355 ? ? ? A . n A 1 64 LEU 64 356 ? ? ? A . n A 1 65 GLU 65 357 ? ? ? A . n A 1 66 HIS 66 358 ? ? ? A . n A 1 67 HIS 67 359 ? ? ? A . n A 1 68 HIS 68 360 ? ? ? A . n A 1 69 HIS 69 361 ? ? ? A . n A 1 70 HIS 70 362 ? ? ? A . n A 1 71 HIS 71 363 ? ? ? A . n # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 8Z4A _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 8Z4A _struct.title 'Solution Structure of DRB4 C-terminal domain, DRB4D3' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 8Z4A _struct_keywords.text 'DRB4, DRB7.2, RNAi, endo-IR pathway, gene regulation, noncoding RNA, PLANT PROTEIN' _struct_keywords.pdbx_keywords 'PLANT PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code DRB4_ARATH _struct_ref.pdbx_db_accession Q8H1D4 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ETSSCVVDESEKKKLIMGTGHLSIPTGQHVVCRPWNPEITLPQDAEMLFRDDKFIAYRLVKP _struct_ref.pdbx_align_begin 294 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 8Z4A _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 63 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q8H1D4 _struct_ref_seq.db_align_beg 294 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 355 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 294 _struct_ref_seq.pdbx_auth_seq_align_end 355 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 8Z4A MET A 1 ? UNP Q8H1D4 ? ? 'initiating methionine' 293 1 1 8Z4A LEU A 64 ? UNP Q8H1D4 ? ? 'expression tag' 356 2 1 8Z4A GLU A 65 ? UNP Q8H1D4 ? ? 'expression tag' 357 3 1 8Z4A HIS A 66 ? UNP Q8H1D4 ? ? 'expression tag' 358 4 1 8Z4A HIS A 67 ? UNP Q8H1D4 ? ? 'expression tag' 359 5 1 8Z4A HIS A 68 ? UNP Q8H1D4 ? ? 'expression tag' 360 6 1 8Z4A HIS A 69 ? UNP Q8H1D4 ? ? 'expression tag' 361 7 1 8Z4A HIS A 70 ? UNP Q8H1D4 ? ? 'expression tag' 362 8 1 8Z4A HIS A 71 ? UNP Q8H1D4 ? ? 'expression tag' 363 9 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'NMR Distance Restraints' _pdbx_struct_assembly_auth_evidence.details 'not applicable' # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0 _pdbx_struct_oper_list.matrix[1][2] 0.0 _pdbx_struct_oper_list.matrix[1][3] 0.0 _pdbx_struct_oper_list.vector[1] 0.0 _pdbx_struct_oper_list.matrix[2][1] 0.0 _pdbx_struct_oper_list.matrix[2][2] 1.0 _pdbx_struct_oper_list.matrix[2][3] 0.0 _pdbx_struct_oper_list.vector[2] 0.0 _pdbx_struct_oper_list.matrix[3][1] 0.0 _pdbx_struct_oper_list.matrix[3][2] 0.0 _pdbx_struct_oper_list.matrix[3][3] 1.0 _pdbx_struct_oper_list.vector[3] 0.0 # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 3 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 HIS A 30 ? PRO A 35 ? HIS A 322 PRO A 327 AA1 2 PHE A 55 ? LEU A 60 ? PHE A 347 LEU A 352 AA1 3 ALA A 46 ? ARG A 51 ? ALA A 338 ARG A 343 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N VAL A 32 ? N VAL A 324 O TYR A 58 ? O TYR A 350 AA1 2 3 O ARG A 59 ? O ARG A 351 N GLU A 47 ? N GLU A 339 # _pdbx_entry_details.entry_id 8Z4A _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 3 ASP A 344 ? ? -134.85 -151.87 2 3 LYS A 346 ? ? -120.40 -50.52 3 6 ASP A 344 ? ? -137.22 -153.53 # _pdbx_nmr_ensemble.entry_id 8Z4A _pdbx_nmr_ensemble.conformers_calculated_total_number 5000 _pdbx_nmr_ensemble.conformers_submitted_total_number 10 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 8Z4A _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system _pdbx_nmr_sample_details.label _pdbx_nmr_sample_details.type _pdbx_nmr_sample_details.details 1 '400 uM U-[13C,15N],2H[~90%] DRB4D3, 90% H2O/10% D2O' '90% H2O/10% D2O' 'U-[13C,15N],2H[~90%]' solution 'U-[13C,15N],2H[~90%] DRB4D3 : 2H[~ 90%] DRB7.2M' 2 '400 uM U-[13C,15N],2H[~50%] DRB4D3, 90% H2O/10% D2O' '90% H2O/10% D2O' 'U-[13C,15N],2H[~50%]' solution 'U-[13C,15N],2H[~50%] DRB4D3 : 2H[~ 90%] DRB7.2M' # loop_ _pdbx_nmr_exptl_sample.solution_id _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling 1 DRB4D3 400 ? uM 'U-[13C,15N],2H[~90%]' 2 DRB4D3 400 ? uM 'U-[13C,15N],2H[~50%]' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure_units bar _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 150 _pdbx_nmr_exptl_sample_conditions.details ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_err ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units mM _pdbx_nmr_exptl_sample_conditions.label 1 _pdbx_nmr_exptl_sample_conditions.pH_err ? _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 '2D 1H-15N TROSY' 1 isotropic 2 1 1 '3D HNCO' 1 isotropic 3 1 1 '3D HN(CA)CO' 1 isotropic 4 1 1 '3D HN(COCA)CB' 1 isotropic 5 1 1 '3D HNCACB' 1 isotropic 19 1 1 '3D HN(CO)CA' 1 isotropic 18 1 1 '3D HNCA' 1 isotropic 17 1 2 '3D H(CCO)NH TOCSY' 1 isotropic 16 1 2 '3D (H)C(CO)NH TOCSY' 1 isotropic 15 1 1 '3D 1H-13C HSQC' 1 isotropic 14 1 1 '3D 1H-15N NOESY-HSQC' 1 isotropic # _pdbx_nmr_refine.entry_id 8Z4A _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 2 # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 'chemical shift assignment' CARA ? 'Keller and Wuthrich' 2 'structure calculation' Rosetta ? 'Raman et al. Science (2010), 927(5968):1014-1018' 3 refinement Rosetta ? 'Raman et al. Science (2010), 927(5968):1014-1018' 4 'peak picking' CARA ? 'Keller and Wuthrich' 5 'data analysis' TopSpin ? 'Bruker Biospin' 6 collection TopSpin ? 'Bruker Biospin' # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 293 ? A MET 1 2 1 Y 1 A GLU 294 ? A GLU 2 3 1 Y 1 A THR 295 ? A THR 3 4 1 Y 1 A SER 296 ? A SER 4 5 1 Y 1 A SER 297 ? A SER 5 6 1 Y 1 A CYS 298 ? A CYS 6 7 1 Y 1 A VAL 299 ? A VAL 7 8 1 Y 1 A VAL 300 ? A VAL 8 9 1 Y 1 A ASP 301 ? A ASP 9 10 1 Y 1 A GLU 302 ? A GLU 10 11 1 Y 1 A SER 303 ? A SER 11 12 1 Y 1 A GLU 304 ? A GLU 12 13 1 Y 1 A LYS 305 ? A LYS 13 14 1 Y 1 A LYS 306 ? A LYS 14 15 1 Y 1 A LYS 307 ? A LYS 15 16 1 Y 1 A LEU 308 ? A LEU 16 17 1 Y 1 A ILE 309 ? A ILE 17 18 1 Y 1 A MET 310 ? A MET 18 19 1 Y 1 A GLY 311 ? A GLY 19 20 1 Y 1 A THR 312 ? A THR 20 21 1 Y 1 A GLY 313 ? A GLY 21 22 1 Y 1 A HIS 314 ? A HIS 22 23 1 Y 1 A LEU 315 ? A LEU 23 24 1 Y 1 A SER 316 ? A SER 24 25 1 Y 1 A LYS 354 ? A LYS 62 26 1 Y 1 A PRO 355 ? A PRO 63 27 1 Y 1 A LEU 356 ? A LEU 64 28 1 Y 1 A GLU 357 ? A GLU 65 29 1 Y 1 A HIS 358 ? A HIS 66 30 1 Y 1 A HIS 359 ? A HIS 67 31 1 Y 1 A HIS 360 ? A HIS 68 32 1 Y 1 A HIS 361 ? A HIS 69 33 1 Y 1 A HIS 362 ? A HIS 70 34 1 Y 1 A HIS 363 ? A HIS 71 35 2 Y 1 A MET 293 ? A MET 1 36 2 Y 1 A GLU 294 ? A GLU 2 37 2 Y 1 A THR 295 ? A THR 3 38 2 Y 1 A SER 296 ? A SER 4 39 2 Y 1 A SER 297 ? A SER 5 40 2 Y 1 A CYS 298 ? A CYS 6 41 2 Y 1 A VAL 299 ? A VAL 7 42 2 Y 1 A VAL 300 ? A VAL 8 43 2 Y 1 A ASP 301 ? A ASP 9 44 2 Y 1 A GLU 302 ? A GLU 10 45 2 Y 1 A SER 303 ? A SER 11 46 2 Y 1 A GLU 304 ? A GLU 12 47 2 Y 1 A LYS 305 ? A LYS 13 48 2 Y 1 A LYS 306 ? A LYS 14 49 2 Y 1 A LYS 307 ? A LYS 15 50 2 Y 1 A LEU 308 ? A LEU 16 51 2 Y 1 A ILE 309 ? A ILE 17 52 2 Y 1 A MET 310 ? A MET 18 53 2 Y 1 A GLY 311 ? A GLY 19 54 2 Y 1 A THR 312 ? A THR 20 55 2 Y 1 A GLY 313 ? A GLY 21 56 2 Y 1 A HIS 314 ? A HIS 22 57 2 Y 1 A LEU 315 ? A LEU 23 58 2 Y 1 A SER 316 ? A SER 24 59 2 Y 1 A LYS 354 ? A LYS 62 60 2 Y 1 A PRO 355 ? A PRO 63 61 2 Y 1 A LEU 356 ? A LEU 64 62 2 Y 1 A GLU 357 ? A GLU 65 63 2 Y 1 A HIS 358 ? A HIS 66 64 2 Y 1 A HIS 359 ? A HIS 67 65 2 Y 1 A HIS 360 ? A HIS 68 66 2 Y 1 A HIS 361 ? A HIS 69 67 2 Y 1 A HIS 362 ? A HIS 70 68 2 Y 1 A HIS 363 ? A HIS 71 69 3 Y 1 A MET 293 ? A MET 1 70 3 Y 1 A GLU 294 ? A GLU 2 71 3 Y 1 A THR 295 ? A THR 3 72 3 Y 1 A SER 296 ? A SER 4 73 3 Y 1 A SER 297 ? A SER 5 74 3 Y 1 A CYS 298 ? A CYS 6 75 3 Y 1 A VAL 299 ? A VAL 7 76 3 Y 1 A VAL 300 ? A VAL 8 77 3 Y 1 A ASP 301 ? A ASP 9 78 3 Y 1 A GLU 302 ? A GLU 10 79 3 Y 1 A SER 303 ? A SER 11 80 3 Y 1 A GLU 304 ? A GLU 12 81 3 Y 1 A LYS 305 ? A LYS 13 82 3 Y 1 A LYS 306 ? A LYS 14 83 3 Y 1 A LYS 307 ? A LYS 15 84 3 Y 1 A LEU 308 ? A LEU 16 85 3 Y 1 A ILE 309 ? A ILE 17 86 3 Y 1 A MET 310 ? A MET 18 87 3 Y 1 A GLY 311 ? A GLY 19 88 3 Y 1 A THR 312 ? A THR 20 89 3 Y 1 A GLY 313 ? A GLY 21 90 3 Y 1 A HIS 314 ? A HIS 22 91 3 Y 1 A LEU 315 ? A LEU 23 92 3 Y 1 A SER 316 ? A SER 24 93 3 Y 1 A LYS 354 ? A LYS 62 94 3 Y 1 A PRO 355 ? A PRO 63 95 3 Y 1 A LEU 356 ? A LEU 64 96 3 Y 1 A GLU 357 ? A GLU 65 97 3 Y 1 A HIS 358 ? A HIS 66 98 3 Y 1 A HIS 359 ? A HIS 67 99 3 Y 1 A HIS 360 ? A HIS 68 100 3 Y 1 A HIS 361 ? A HIS 69 101 3 Y 1 A HIS 362 ? A HIS 70 102 3 Y 1 A HIS 363 ? A HIS 71 103 4 Y 1 A MET 293 ? A MET 1 104 4 Y 1 A GLU 294 ? A GLU 2 105 4 Y 1 A THR 295 ? A THR 3 106 4 Y 1 A SER 296 ? A SER 4 107 4 Y 1 A SER 297 ? A SER 5 108 4 Y 1 A CYS 298 ? A CYS 6 109 4 Y 1 A VAL 299 ? A VAL 7 110 4 Y 1 A VAL 300 ? A VAL 8 111 4 Y 1 A ASP 301 ? A ASP 9 112 4 Y 1 A GLU 302 ? A GLU 10 113 4 Y 1 A SER 303 ? A SER 11 114 4 Y 1 A GLU 304 ? A GLU 12 115 4 Y 1 A LYS 305 ? A LYS 13 116 4 Y 1 A LYS 306 ? A LYS 14 117 4 Y 1 A LYS 307 ? A LYS 15 118 4 Y 1 A LEU 308 ? A LEU 16 119 4 Y 1 A ILE 309 ? A ILE 17 120 4 Y 1 A MET 310 ? A MET 18 121 4 Y 1 A GLY 311 ? A GLY 19 122 4 Y 1 A THR 312 ? A THR 20 123 4 Y 1 A GLY 313 ? A GLY 21 124 4 Y 1 A HIS 314 ? A HIS 22 125 4 Y 1 A LEU 315 ? A LEU 23 126 4 Y 1 A SER 316 ? A SER 24 127 4 Y 1 A LYS 354 ? A LYS 62 128 4 Y 1 A PRO 355 ? A PRO 63 129 4 Y 1 A LEU 356 ? A LEU 64 130 4 Y 1 A GLU 357 ? A GLU 65 131 4 Y 1 A HIS 358 ? A HIS 66 132 4 Y 1 A HIS 359 ? A HIS 67 133 4 Y 1 A HIS 360 ? A HIS 68 134 4 Y 1 A HIS 361 ? A HIS 69 135 4 Y 1 A HIS 362 ? A HIS 70 136 4 Y 1 A HIS 363 ? A HIS 71 137 5 Y 1 A MET 293 ? A MET 1 138 5 Y 1 A GLU 294 ? A GLU 2 139 5 Y 1 A THR 295 ? A THR 3 140 5 Y 1 A SER 296 ? A SER 4 141 5 Y 1 A SER 297 ? A SER 5 142 5 Y 1 A CYS 298 ? A CYS 6 143 5 Y 1 A VAL 299 ? A VAL 7 144 5 Y 1 A VAL 300 ? A VAL 8 145 5 Y 1 A ASP 301 ? A ASP 9 146 5 Y 1 A GLU 302 ? A GLU 10 147 5 Y 1 A SER 303 ? A SER 11 148 5 Y 1 A GLU 304 ? A GLU 12 149 5 Y 1 A LYS 305 ? A LYS 13 150 5 Y 1 A LYS 306 ? A LYS 14 151 5 Y 1 A LYS 307 ? A LYS 15 152 5 Y 1 A LEU 308 ? A LEU 16 153 5 Y 1 A ILE 309 ? A ILE 17 154 5 Y 1 A MET 310 ? A MET 18 155 5 Y 1 A GLY 311 ? A GLY 19 156 5 Y 1 A THR 312 ? A THR 20 157 5 Y 1 A GLY 313 ? A GLY 21 158 5 Y 1 A HIS 314 ? A HIS 22 159 5 Y 1 A LEU 315 ? A LEU 23 160 5 Y 1 A SER 316 ? A SER 24 161 5 Y 1 A LYS 354 ? A LYS 62 162 5 Y 1 A PRO 355 ? A PRO 63 163 5 Y 1 A LEU 356 ? A LEU 64 164 5 Y 1 A GLU 357 ? A GLU 65 165 5 Y 1 A HIS 358 ? A HIS 66 166 5 Y 1 A HIS 359 ? A HIS 67 167 5 Y 1 A HIS 360 ? A HIS 68 168 5 Y 1 A HIS 361 ? A HIS 69 169 5 Y 1 A HIS 362 ? A HIS 70 170 5 Y 1 A HIS 363 ? A HIS 71 171 6 Y 1 A MET 293 ? A MET 1 172 6 Y 1 A GLU 294 ? A GLU 2 173 6 Y 1 A THR 295 ? A THR 3 174 6 Y 1 A SER 296 ? A SER 4 175 6 Y 1 A SER 297 ? A SER 5 176 6 Y 1 A CYS 298 ? A CYS 6 177 6 Y 1 A VAL 299 ? A VAL 7 178 6 Y 1 A VAL 300 ? A VAL 8 179 6 Y 1 A ASP 301 ? A ASP 9 180 6 Y 1 A GLU 302 ? A GLU 10 181 6 Y 1 A SER 303 ? A SER 11 182 6 Y 1 A GLU 304 ? A GLU 12 183 6 Y 1 A LYS 305 ? A LYS 13 184 6 Y 1 A LYS 306 ? A LYS 14 185 6 Y 1 A LYS 307 ? A LYS 15 186 6 Y 1 A LEU 308 ? A LEU 16 187 6 Y 1 A ILE 309 ? A ILE 17 188 6 Y 1 A MET 310 ? A MET 18 189 6 Y 1 A GLY 311 ? A GLY 19 190 6 Y 1 A THR 312 ? A THR 20 191 6 Y 1 A GLY 313 ? A GLY 21 192 6 Y 1 A HIS 314 ? A HIS 22 193 6 Y 1 A LEU 315 ? A LEU 23 194 6 Y 1 A SER 316 ? A SER 24 195 6 Y 1 A LYS 354 ? A LYS 62 196 6 Y 1 A PRO 355 ? A PRO 63 197 6 Y 1 A LEU 356 ? A LEU 64 198 6 Y 1 A GLU 357 ? A GLU 65 199 6 Y 1 A HIS 358 ? A HIS 66 200 6 Y 1 A HIS 359 ? A HIS 67 201 6 Y 1 A HIS 360 ? A HIS 68 202 6 Y 1 A HIS 361 ? A HIS 69 203 6 Y 1 A HIS 362 ? A HIS 70 204 6 Y 1 A HIS 363 ? A HIS 71 205 7 Y 1 A MET 293 ? A MET 1 206 7 Y 1 A GLU 294 ? A GLU 2 207 7 Y 1 A THR 295 ? A THR 3 208 7 Y 1 A SER 296 ? A SER 4 209 7 Y 1 A SER 297 ? A SER 5 210 7 Y 1 A CYS 298 ? A CYS 6 211 7 Y 1 A VAL 299 ? A VAL 7 212 7 Y 1 A VAL 300 ? A VAL 8 213 7 Y 1 A ASP 301 ? A ASP 9 214 7 Y 1 A GLU 302 ? A GLU 10 215 7 Y 1 A SER 303 ? A SER 11 216 7 Y 1 A GLU 304 ? A GLU 12 217 7 Y 1 A LYS 305 ? A LYS 13 218 7 Y 1 A LYS 306 ? A LYS 14 219 7 Y 1 A LYS 307 ? A LYS 15 220 7 Y 1 A LEU 308 ? A LEU 16 221 7 Y 1 A ILE 309 ? A ILE 17 222 7 Y 1 A MET 310 ? A MET 18 223 7 Y 1 A GLY 311 ? A GLY 19 224 7 Y 1 A THR 312 ? A THR 20 225 7 Y 1 A GLY 313 ? A GLY 21 226 7 Y 1 A HIS 314 ? A HIS 22 227 7 Y 1 A LEU 315 ? A LEU 23 228 7 Y 1 A SER 316 ? A SER 24 229 7 Y 1 A LYS 354 ? A LYS 62 230 7 Y 1 A PRO 355 ? A PRO 63 231 7 Y 1 A LEU 356 ? A LEU 64 232 7 Y 1 A GLU 357 ? A GLU 65 233 7 Y 1 A HIS 358 ? A HIS 66 234 7 Y 1 A HIS 359 ? A HIS 67 235 7 Y 1 A HIS 360 ? A HIS 68 236 7 Y 1 A HIS 361 ? A HIS 69 237 7 Y 1 A HIS 362 ? A HIS 70 238 7 Y 1 A HIS 363 ? A HIS 71 239 8 Y 1 A MET 293 ? A MET 1 240 8 Y 1 A GLU 294 ? A GLU 2 241 8 Y 1 A THR 295 ? A THR 3 242 8 Y 1 A SER 296 ? A SER 4 243 8 Y 1 A SER 297 ? A SER 5 244 8 Y 1 A CYS 298 ? A CYS 6 245 8 Y 1 A VAL 299 ? A VAL 7 246 8 Y 1 A VAL 300 ? A VAL 8 247 8 Y 1 A ASP 301 ? A ASP 9 248 8 Y 1 A GLU 302 ? A GLU 10 249 8 Y 1 A SER 303 ? A SER 11 250 8 Y 1 A GLU 304 ? A GLU 12 251 8 Y 1 A LYS 305 ? A LYS 13 252 8 Y 1 A LYS 306 ? A LYS 14 253 8 Y 1 A LYS 307 ? A LYS 15 254 8 Y 1 A LEU 308 ? A LEU 16 255 8 Y 1 A ILE 309 ? A ILE 17 256 8 Y 1 A MET 310 ? A MET 18 257 8 Y 1 A GLY 311 ? A GLY 19 258 8 Y 1 A THR 312 ? A THR 20 259 8 Y 1 A GLY 313 ? A GLY 21 260 8 Y 1 A HIS 314 ? A HIS 22 261 8 Y 1 A LEU 315 ? A LEU 23 262 8 Y 1 A SER 316 ? A SER 24 263 8 Y 1 A LYS 354 ? A LYS 62 264 8 Y 1 A PRO 355 ? A PRO 63 265 8 Y 1 A LEU 356 ? A LEU 64 266 8 Y 1 A GLU 357 ? A GLU 65 267 8 Y 1 A HIS 358 ? A HIS 66 268 8 Y 1 A HIS 359 ? A HIS 67 269 8 Y 1 A HIS 360 ? A HIS 68 270 8 Y 1 A HIS 361 ? A HIS 69 271 8 Y 1 A HIS 362 ? A HIS 70 272 8 Y 1 A HIS 363 ? A HIS 71 273 9 Y 1 A MET 293 ? A MET 1 274 9 Y 1 A GLU 294 ? A GLU 2 275 9 Y 1 A THR 295 ? A THR 3 276 9 Y 1 A SER 296 ? A SER 4 277 9 Y 1 A SER 297 ? A SER 5 278 9 Y 1 A CYS 298 ? A CYS 6 279 9 Y 1 A VAL 299 ? A VAL 7 280 9 Y 1 A VAL 300 ? A VAL 8 281 9 Y 1 A ASP 301 ? A ASP 9 282 9 Y 1 A GLU 302 ? A GLU 10 283 9 Y 1 A SER 303 ? A SER 11 284 9 Y 1 A GLU 304 ? A GLU 12 285 9 Y 1 A LYS 305 ? A LYS 13 286 9 Y 1 A LYS 306 ? A LYS 14 287 9 Y 1 A LYS 307 ? A LYS 15 288 9 Y 1 A LEU 308 ? A LEU 16 289 9 Y 1 A ILE 309 ? A ILE 17 290 9 Y 1 A MET 310 ? A MET 18 291 9 Y 1 A GLY 311 ? A GLY 19 292 9 Y 1 A THR 312 ? A THR 20 293 9 Y 1 A GLY 313 ? A GLY 21 294 9 Y 1 A HIS 314 ? A HIS 22 295 9 Y 1 A LEU 315 ? A LEU 23 296 9 Y 1 A SER 316 ? A SER 24 297 9 Y 1 A LYS 354 ? A LYS 62 298 9 Y 1 A PRO 355 ? A PRO 63 299 9 Y 1 A LEU 356 ? A LEU 64 300 9 Y 1 A GLU 357 ? A GLU 65 301 9 Y 1 A HIS 358 ? A HIS 66 302 9 Y 1 A HIS 359 ? A HIS 67 303 9 Y 1 A HIS 360 ? A HIS 68 304 9 Y 1 A HIS 361 ? A HIS 69 305 9 Y 1 A HIS 362 ? A HIS 70 306 9 Y 1 A HIS 363 ? A HIS 71 307 10 Y 1 A MET 293 ? A MET 1 308 10 Y 1 A GLU 294 ? A GLU 2 309 10 Y 1 A THR 295 ? A THR 3 310 10 Y 1 A SER 296 ? A SER 4 311 10 Y 1 A SER 297 ? A SER 5 312 10 Y 1 A CYS 298 ? A CYS 6 313 10 Y 1 A VAL 299 ? A VAL 7 314 10 Y 1 A VAL 300 ? A VAL 8 315 10 Y 1 A ASP 301 ? A ASP 9 316 10 Y 1 A GLU 302 ? A GLU 10 317 10 Y 1 A SER 303 ? A SER 11 318 10 Y 1 A GLU 304 ? A GLU 12 319 10 Y 1 A LYS 305 ? A LYS 13 320 10 Y 1 A LYS 306 ? A LYS 14 321 10 Y 1 A LYS 307 ? A LYS 15 322 10 Y 1 A LEU 308 ? A LEU 16 323 10 Y 1 A ILE 309 ? A ILE 17 324 10 Y 1 A MET 310 ? A MET 18 325 10 Y 1 A GLY 311 ? A GLY 19 326 10 Y 1 A THR 312 ? A THR 20 327 10 Y 1 A GLY 313 ? A GLY 21 328 10 Y 1 A HIS 314 ? A HIS 22 329 10 Y 1 A LEU 315 ? A LEU 23 330 10 Y 1 A SER 316 ? A SER 24 331 10 Y 1 A LYS 354 ? A LYS 62 332 10 Y 1 A PRO 355 ? A PRO 63 333 10 Y 1 A LEU 356 ? A LEU 64 334 10 Y 1 A GLU 357 ? A GLU 65 335 10 Y 1 A HIS 358 ? A HIS 66 336 10 Y 1 A HIS 359 ? A HIS 67 337 10 Y 1 A HIS 360 ? A HIS 68 338 10 Y 1 A HIS 361 ? A HIS 69 339 10 Y 1 A HIS 362 ? A HIS 70 340 10 Y 1 A HIS 363 ? A HIS 71 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 ILE N N N N 158 ILE CA C N S 159 ILE C C N N 160 ILE O O N N 161 ILE CB C N S 162 ILE CG1 C N N 163 ILE CG2 C N N 164 ILE CD1 C N N 165 ILE OXT O N N 166 ILE H H N N 167 ILE H2 H N N 168 ILE HA H N N 169 ILE HB H N N 170 ILE HG12 H N N 171 ILE HG13 H N N 172 ILE HG21 H N N 173 ILE HG22 H N N 174 ILE HG23 H N N 175 ILE HD11 H N N 176 ILE HD12 H N N 177 ILE HD13 H N N 178 ILE HXT H N N 179 LEU N N N N 180 LEU CA C N S 181 LEU C C N N 182 LEU O O N N 183 LEU CB C N N 184 LEU CG C N N 185 LEU CD1 C N N 186 LEU CD2 C N N 187 LEU OXT O N N 188 LEU H H N N 189 LEU H2 H N N 190 LEU HA H N N 191 LEU HB2 H N N 192 LEU HB3 H N N 193 LEU HG H N N 194 LEU HD11 H N N 195 LEU HD12 H N N 196 LEU HD13 H N N 197 LEU HD21 H N N 198 LEU HD22 H N N 199 LEU HD23 H N N 200 LEU HXT H N N 201 LYS N N N N 202 LYS CA C N S 203 LYS C C N N 204 LYS O O N N 205 LYS CB C N N 206 LYS CG C N N 207 LYS CD C N N 208 LYS CE C N N 209 LYS NZ N N N 210 LYS OXT O N N 211 LYS H H N N 212 LYS H2 H N N 213 LYS HA H N N 214 LYS HB2 H N N 215 LYS HB3 H N N 216 LYS HG2 H N N 217 LYS HG3 H N N 218 LYS HD2 H N N 219 LYS HD3 H N N 220 LYS HE2 H N N 221 LYS HE3 H N N 222 LYS HZ1 H N N 223 LYS HZ2 H N N 224 LYS HZ3 H N N 225 LYS HXT H N N 226 MET N N N N 227 MET CA C N S 228 MET C C N N 229 MET O O N N 230 MET CB C N N 231 MET CG C N N 232 MET SD S N N 233 MET CE C N N 234 MET OXT O N N 235 MET H H N N 236 MET H2 H N N 237 MET HA H N N 238 MET HB2 H N N 239 MET HB3 H N N 240 MET HG2 H N N 241 MET HG3 H N N 242 MET HE1 H N N 243 MET HE2 H N N 244 MET HE3 H N N 245 MET HXT H N N 246 PHE N N N N 247 PHE CA C N S 248 PHE C C N N 249 PHE O O N N 250 PHE CB C N N 251 PHE CG C Y N 252 PHE CD1 C Y N 253 PHE CD2 C Y N 254 PHE CE1 C Y N 255 PHE CE2 C Y N 256 PHE CZ C Y N 257 PHE OXT O N N 258 PHE H H N N 259 PHE H2 H N N 260 PHE HA H N N 261 PHE HB2 H N N 262 PHE HB3 H N N 263 PHE HD1 H N N 264 PHE HD2 H N N 265 PHE HE1 H N N 266 PHE HE2 H N N 267 PHE HZ H N N 268 PHE HXT H N N 269 PRO N N N N 270 PRO CA C N S 271 PRO C C N N 272 PRO O O N N 273 PRO CB C N N 274 PRO CG C N N 275 PRO CD C N N 276 PRO OXT O N N 277 PRO H H N N 278 PRO HA H N N 279 PRO HB2 H N N 280 PRO HB3 H N N 281 PRO HG2 H N N 282 PRO HG3 H N N 283 PRO HD2 H N N 284 PRO HD3 H N N 285 PRO HXT H N N 286 SER N N N N 287 SER CA C N S 288 SER C C N N 289 SER O O N N 290 SER CB C N N 291 SER OG O N N 292 SER OXT O N N 293 SER H H N N 294 SER H2 H N N 295 SER HA H N N 296 SER HB2 H N N 297 SER HB3 H N N 298 SER HG H N N 299 SER HXT H N N 300 THR N N N N 301 THR CA C N S 302 THR C C N N 303 THR O O N N 304 THR CB C N R 305 THR OG1 O N N 306 THR CG2 C N N 307 THR OXT O N N 308 THR H H N N 309 THR H2 H N N 310 THR HA H N N 311 THR HB H N N 312 THR HG1 H N N 313 THR HG21 H N N 314 THR HG22 H N N 315 THR HG23 H N N 316 THR HXT H N N 317 TRP N N N N 318 TRP CA C N S 319 TRP C C N N 320 TRP O O N N 321 TRP CB C N N 322 TRP CG C Y N 323 TRP CD1 C Y N 324 TRP CD2 C Y N 325 TRP NE1 N Y N 326 TRP CE2 C Y N 327 TRP CE3 C Y N 328 TRP CZ2 C Y N 329 TRP CZ3 C Y N 330 TRP CH2 C Y N 331 TRP OXT O N N 332 TRP H H N N 333 TRP H2 H N N 334 TRP HA H N N 335 TRP HB2 H N N 336 TRP HB3 H N N 337 TRP HD1 H N N 338 TRP HE1 H N N 339 TRP HE3 H N N 340 TRP HZ2 H N N 341 TRP HZ3 H N N 342 TRP HH2 H N N 343 TRP HXT H N N 344 TYR N N N N 345 TYR CA C N S 346 TYR C C N N 347 TYR O O N N 348 TYR CB C N N 349 TYR CG C Y N 350 TYR CD1 C Y N 351 TYR CD2 C Y N 352 TYR CE1 C Y N 353 TYR CE2 C Y N 354 TYR CZ C Y N 355 TYR OH O N N 356 TYR OXT O N N 357 TYR H H N N 358 TYR H2 H N N 359 TYR HA H N N 360 TYR HB2 H N N 361 TYR HB3 H N N 362 TYR HD1 H N N 363 TYR HD2 H N N 364 TYR HE1 H N N 365 TYR HE2 H N N 366 TYR HH H N N 367 TYR HXT H N N 368 VAL N N N N 369 VAL CA C N S 370 VAL C C N N 371 VAL O O N N 372 VAL CB C N N 373 VAL CG1 C N N 374 VAL CG2 C N N 375 VAL OXT O N N 376 VAL H H N N 377 VAL H2 H N N 378 VAL HA H N N 379 VAL HB H N N 380 VAL HG11 H N N 381 VAL HG12 H N N 382 VAL HG13 H N N 383 VAL HG21 H N N 384 VAL HG22 H N N 385 VAL HG23 H N N 386 VAL HXT H N N 387 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 ILE N CA sing N N 150 ILE N H sing N N 151 ILE N H2 sing N N 152 ILE CA C sing N N 153 ILE CA CB sing N N 154 ILE CA HA sing N N 155 ILE C O doub N N 156 ILE C OXT sing N N 157 ILE CB CG1 sing N N 158 ILE CB CG2 sing N N 159 ILE CB HB sing N N 160 ILE CG1 CD1 sing N N 161 ILE CG1 HG12 sing N N 162 ILE CG1 HG13 sing N N 163 ILE CG2 HG21 sing N N 164 ILE CG2 HG22 sing N N 165 ILE CG2 HG23 sing N N 166 ILE CD1 HD11 sing N N 167 ILE CD1 HD12 sing N N 168 ILE CD1 HD13 sing N N 169 ILE OXT HXT sing N N 170 LEU N CA sing N N 171 LEU N H sing N N 172 LEU N H2 sing N N 173 LEU CA C sing N N 174 LEU CA CB sing N N 175 LEU CA HA sing N N 176 LEU C O doub N N 177 LEU C OXT sing N N 178 LEU CB CG sing N N 179 LEU CB HB2 sing N N 180 LEU CB HB3 sing N N 181 LEU CG CD1 sing N N 182 LEU CG CD2 sing N N 183 LEU CG HG sing N N 184 LEU CD1 HD11 sing N N 185 LEU CD1 HD12 sing N N 186 LEU CD1 HD13 sing N N 187 LEU CD2 HD21 sing N N 188 LEU CD2 HD22 sing N N 189 LEU CD2 HD23 sing N N 190 LEU OXT HXT sing N N 191 LYS N CA sing N N 192 LYS N H sing N N 193 LYS N H2 sing N N 194 LYS CA C sing N N 195 LYS CA CB sing N N 196 LYS CA HA sing N N 197 LYS C O doub N N 198 LYS C OXT sing N N 199 LYS CB CG sing N N 200 LYS CB HB2 sing N N 201 LYS CB HB3 sing N N 202 LYS CG CD sing N N 203 LYS CG HG2 sing N N 204 LYS CG HG3 sing N N 205 LYS CD CE sing N N 206 LYS CD HD2 sing N N 207 LYS CD HD3 sing N N 208 LYS CE NZ sing N N 209 LYS CE HE2 sing N N 210 LYS CE HE3 sing N N 211 LYS NZ HZ1 sing N N 212 LYS NZ HZ2 sing N N 213 LYS NZ HZ3 sing N N 214 LYS OXT HXT sing N N 215 MET N CA sing N N 216 MET N H sing N N 217 MET N H2 sing N N 218 MET CA C sing N N 219 MET CA CB sing N N 220 MET CA HA sing N N 221 MET C O doub N N 222 MET C OXT sing N N 223 MET CB CG sing N N 224 MET CB HB2 sing N N 225 MET CB HB3 sing N N 226 MET CG SD sing N N 227 MET CG HG2 sing N N 228 MET CG HG3 sing N N 229 MET SD CE sing N N 230 MET CE HE1 sing N N 231 MET CE HE2 sing N N 232 MET CE HE3 sing N N 233 MET OXT HXT sing N N 234 PHE N CA sing N N 235 PHE N H sing N N 236 PHE N H2 sing N N 237 PHE CA C sing N N 238 PHE CA CB sing N N 239 PHE CA HA sing N N 240 PHE C O doub N N 241 PHE C OXT sing N N 242 PHE CB CG sing N N 243 PHE CB HB2 sing N N 244 PHE CB HB3 sing N N 245 PHE CG CD1 doub Y N 246 PHE CG CD2 sing Y N 247 PHE CD1 CE1 sing Y N 248 PHE CD1 HD1 sing N N 249 PHE CD2 CE2 doub Y N 250 PHE CD2 HD2 sing N N 251 PHE CE1 CZ doub Y N 252 PHE CE1 HE1 sing N N 253 PHE CE2 CZ sing Y N 254 PHE CE2 HE2 sing N N 255 PHE CZ HZ sing N N 256 PHE OXT HXT sing N N 257 PRO N CA sing N N 258 PRO N CD sing N N 259 PRO N H sing N N 260 PRO CA C sing N N 261 PRO CA CB sing N N 262 PRO CA HA sing N N 263 PRO C O doub N N 264 PRO C OXT sing N N 265 PRO CB CG sing N N 266 PRO CB HB2 sing N N 267 PRO CB HB3 sing N N 268 PRO CG CD sing N N 269 PRO CG HG2 sing N N 270 PRO CG HG3 sing N N 271 PRO CD HD2 sing N N 272 PRO CD HD3 sing N N 273 PRO OXT HXT sing N N 274 SER N CA sing N N 275 SER N H sing N N 276 SER N H2 sing N N 277 SER CA C sing N N 278 SER CA CB sing N N 279 SER CA HA sing N N 280 SER C O doub N N 281 SER C OXT sing N N 282 SER CB OG sing N N 283 SER CB HB2 sing N N 284 SER CB HB3 sing N N 285 SER OG HG sing N N 286 SER OXT HXT sing N N 287 THR N CA sing N N 288 THR N H sing N N 289 THR N H2 sing N N 290 THR CA C sing N N 291 THR CA CB sing N N 292 THR CA HA sing N N 293 THR C O doub N N 294 THR C OXT sing N N 295 THR CB OG1 sing N N 296 THR CB CG2 sing N N 297 THR CB HB sing N N 298 THR OG1 HG1 sing N N 299 THR CG2 HG21 sing N N 300 THR CG2 HG22 sing N N 301 THR CG2 HG23 sing N N 302 THR OXT HXT sing N N 303 TRP N CA sing N N 304 TRP N H sing N N 305 TRP N H2 sing N N 306 TRP CA C sing N N 307 TRP CA CB sing N N 308 TRP CA HA sing N N 309 TRP C O doub N N 310 TRP C OXT sing N N 311 TRP CB CG sing N N 312 TRP CB HB2 sing N N 313 TRP CB HB3 sing N N 314 TRP CG CD1 doub Y N 315 TRP CG CD2 sing Y N 316 TRP CD1 NE1 sing Y N 317 TRP CD1 HD1 sing N N 318 TRP CD2 CE2 doub Y N 319 TRP CD2 CE3 sing Y N 320 TRP NE1 CE2 sing Y N 321 TRP NE1 HE1 sing N N 322 TRP CE2 CZ2 sing Y N 323 TRP CE3 CZ3 doub Y N 324 TRP CE3 HE3 sing N N 325 TRP CZ2 CH2 doub Y N 326 TRP CZ2 HZ2 sing N N 327 TRP CZ3 CH2 sing Y N 328 TRP CZ3 HZ3 sing N N 329 TRP CH2 HH2 sing N N 330 TRP OXT HXT sing N N 331 TYR N CA sing N N 332 TYR N H sing N N 333 TYR N H2 sing N N 334 TYR CA C sing N N 335 TYR CA CB sing N N 336 TYR CA HA sing N N 337 TYR C O doub N N 338 TYR C OXT sing N N 339 TYR CB CG sing N N 340 TYR CB HB2 sing N N 341 TYR CB HB3 sing N N 342 TYR CG CD1 doub Y N 343 TYR CG CD2 sing Y N 344 TYR CD1 CE1 sing Y N 345 TYR CD1 HD1 sing N N 346 TYR CD2 CE2 doub Y N 347 TYR CD2 HD2 sing N N 348 TYR CE1 CZ doub Y N 349 TYR CE1 HE1 sing N N 350 TYR CE2 CZ sing Y N 351 TYR CE2 HE2 sing N N 352 TYR CZ OH sing N N 353 TYR OH HH sing N N 354 TYR OXT HXT sing N N 355 VAL N CA sing N N 356 VAL N H sing N N 357 VAL N H2 sing N N 358 VAL CA C sing N N 359 VAL CA CB sing N N 360 VAL CA HA sing N N 361 VAL C O doub N N 362 VAL C OXT sing N N 363 VAL CB CG1 sing N N 364 VAL CB CG2 sing N N 365 VAL CB HB sing N N 366 VAL CG1 HG11 sing N N 367 VAL CG1 HG12 sing N N 368 VAL CG1 HG13 sing N N 369 VAL CG2 HG21 sing N N 370 VAL CG2 HG22 sing N N 371 VAL CG2 HG23 sing N N 372 VAL OXT HXT sing N N 373 # _pdbx_audit_support.funding_organization 'Council of Scientific & Industrial Research (CSIR)' _pdbx_audit_support.country India _pdbx_audit_support.grant_number MLP0161 _pdbx_audit_support.ordinal 1 # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model 'AVANCE NEO' _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 600 _pdbx_nmr_spectrometer.details ? # _atom_sites.entry_id 8Z4A _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C H N O S # loop_ #