data_8ZZ6 # # _entry.id 8ZZ6 ## _struct.entry_id 8ZZ6 _struct.title 'Serum Albumin Domain B Structure' _struct.pdbx_structure_determination_methodology integrative ## loop_ _audit_conform.dict_location _audit_conform.dict_name _audit_conform.dict_version https://mmcif.wwpdb.org/dictionaries/ascii/mmcif_ihm_ext.dic mmcif_ihm_ext.dic 1.27 http://mmcif.wwpdb.org/dictionaries/ascii/mmcif_pdbx_v50.dic mmcif_pdbx.dic 5.399 # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB-Dev PDBDEV_00000006 PDBDEV_00000006 ? PDB 8ZZ6 pdb_00008zz6 10.2210/pdb8zz6/pdb # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 8ZZ6 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2017-11-01 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2017-11-08 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _audit_author.name _audit_author.pdbx_ordinal "Belsom, A." 1 "Schneider, M." 2 "Fischer, L." 3 "Brock, O." 4 "Rappsilber, J." 5 ## loop_ _software.pdbx_ordinal _software.name _software.classification _software.version _software.type _software.location 1 "Rosetta MBS" "Model Building" ? program https://compbio.robotics.tu-berlin.de/rbo_aleph 2 EPC-map "Contact Predictor" ? program https://compbio.robotics.tu-berlin.de/epsilon ## _citation.id 1 _citation.title "Serum Albumin Domain Structures in Human Blood Serum by Mass Spectrometry and Computational Biology" _citation.journal_abbrev "Mol Cell Proteomics" _citation.journal_volume 15 _citation.page_first 1105 _citation.page_last 1116 _citation.year 2016 _citation.pdbx_database_id_PubMed 26385339 _citation.pdbx_database_id_DOI 10.1074/mcp.M115.048504 ## loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal 1 "Belsom, A." 1 1 "Schneider, M." 2 1 "Fischer, L." 3 1 "Brock, O." 4 1 "Rappsilber, J." 5 ## loop_ _chem_comp.id _chem_comp.type MET "L-peptide linking" ASN "L-peptide linking" VAL "L-peptide linking" THR "L-peptide linking" PRO "L-peptide linking" LEU "L-peptide linking" ASP "L-peptide linking" GLU "L-peptide linking" GLN "L-peptide linking" TRP "L-peptide linking" LYS "L-peptide linking" SER "L-peptide linking" ILE "L-peptide linking" PHE "L-peptide linking" GLY "L-peptide linking" ARG "L-peptide linking" TYR "L-peptide linking" ALA "L-peptide linking" HIS "L-peptide linking" CYS "L-peptide linking" UNK other ## _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description HSA_B _entity.formula_weight ? _entity.pdbx_number_of_molecules 1 _entity.details ? ## loop_ _struct_ref.id _struct_ref.entity_id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_align_begin _struct_ref.pdbx_seq_one_letter_code _struct_ref.details 1 1 UNP ALBU_HUMAN P02768 226 . 'Albumin Homo sapiens (Human)' # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.seq_align_beg _struct_ref_seq.seq_align_end _struct_ref_seq.db_align_beg _struct_ref_seq.db_align_end 1 1 1 189 226 414 ## _entity_poly.entity_id 1 _entity_poly.type polypeptide(L) _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_strand_id A _entity_poly.pdbx_seq_one_letter_code SLQKFGERAFKAWAVARLSQRFPKAEFAEVSKLVTDLTKVHTECCHGDLLECADDRADLAKYICENQDSISSKLKECCEKPLLEKSHCIAEVENDEMPADLPSLAADFVESKDVCKNYAEAKDVFLGMFLYEYARRHPDYSVVLLLRLAKTYETTLEKCCAAADPHECYAKVFDEFKPLVEEPQNLIKQ _entity_poly.pdbx_seq_one_letter_code_can SLQKFGERAFKAWAVARLSQRFPKAEFAEVSKLVTDLTKVHTECCHGDLLECADDRADLAKYICENQDSISSKLKECCEKPLLEKSHCIAEVENDEMPADLPSLAADFVESKDVCKNYAEAKDVFLGMFLYEYARRHPDYSVVLLLRLAKTYETTLEKCCAAADPHECYAKVFDEFKPLVEEPQNLIKQ ## loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 SER . 1 2 LEU . 1 3 GLN . 1 4 LYS . 1 5 PHE . 1 6 GLY . 1 7 GLU . 1 8 ARG . 1 9 ALA . 1 10 PHE . 1 11 LYS . 1 12 ALA . 1 13 TRP . 1 14 ALA . 1 15 VAL . 1 16 ALA . 1 17 ARG . 1 18 LEU . 1 19 SER . 1 20 GLN . 1 21 ARG . 1 22 PHE . 1 23 PRO . 1 24 LYS . 1 25 ALA . 1 26 GLU . 1 27 PHE . 1 28 ALA . 1 29 GLU . 1 30 VAL . 1 31 SER . 1 32 LYS . 1 33 LEU . 1 34 VAL . 1 35 THR . 1 36 ASP . 1 37 LEU . 1 38 THR . 1 39 LYS . 1 40 VAL . 1 41 HIS . 1 42 THR . 1 43 GLU . 1 44 CYS . 1 45 CYS . 1 46 HIS . 1 47 GLY . 1 48 ASP . 1 49 LEU . 1 50 LEU . 1 51 GLU . 1 52 CYS . 1 53 ALA . 1 54 ASP . 1 55 ASP . 1 56 ARG . 1 57 ALA . 1 58 ASP . 1 59 LEU . 1 60 ALA . 1 61 LYS . 1 62 TYR . 1 63 ILE . 1 64 CYS . 1 65 GLU . 1 66 ASN . 1 67 GLN . 1 68 ASP . 1 69 SER . 1 70 ILE . 1 71 SER . 1 72 SER . 1 73 LYS . 1 74 LEU . 1 75 LYS . 1 76 GLU . 1 77 CYS . 1 78 CYS . 1 79 GLU . 1 80 LYS . 1 81 PRO . 1 82 LEU . 1 83 LEU . 1 84 GLU . 1 85 LYS . 1 86 SER . 1 87 HIS . 1 88 CYS . 1 89 ILE . 1 90 ALA . 1 91 GLU . 1 92 VAL . 1 93 GLU . 1 94 ASN . 1 95 ASP . 1 96 GLU . 1 97 MET . 1 98 PRO . 1 99 ALA . 1 100 ASP . 1 101 LEU . 1 102 PRO . 1 103 SER . 1 104 LEU . 1 105 ALA . 1 106 ALA . 1 107 ASP . 1 108 PHE . 1 109 VAL . 1 110 GLU . 1 111 SER . 1 112 LYS . 1 113 ASP . 1 114 VAL . 1 115 CYS . 1 116 LYS . 1 117 ASN . 1 118 TYR . 1 119 ALA . 1 120 GLU . 1 121 ALA . 1 122 LYS . 1 123 ASP . 1 124 VAL . 1 125 PHE . 1 126 LEU . 1 127 GLY . 1 128 MET . 1 129 PHE . 1 130 LEU . 1 131 TYR . 1 132 GLU . 1 133 TYR . 1 134 ALA . 1 135 ARG . 1 136 ARG . 1 137 HIS . 1 138 PRO . 1 139 ASP . 1 140 TYR . 1 141 SER . 1 142 VAL . 1 143 VAL . 1 144 LEU . 1 145 LEU . 1 146 LEU . 1 147 ARG . 1 148 LEU . 1 149 ALA . 1 150 LYS . 1 151 THR . 1 152 TYR . 1 153 GLU . 1 154 THR . 1 155 THR . 1 156 LEU . 1 157 GLU . 1 158 LYS . 1 159 CYS . 1 160 CYS . 1 161 ALA . 1 162 ALA . 1 163 ALA . 1 164 ASP . 1 165 PRO . 1 166 HIS . 1 167 GLU . 1 168 CYS . 1 169 TYR . 1 170 ALA . 1 171 LYS . 1 172 VAL . 1 173 PHE . 1 174 ASP . 1 175 GLU . 1 176 PHE . 1 177 LYS . 1 178 PRO . 1 179 LEU . 1 180 VAL . 1 181 GLU . 1 182 GLU . 1 183 PRO . 1 184 GLN . 1 185 ASN . 1 186 LEU . 1 187 ILE . 1 188 LYS . 1 189 GLN . ## _struct_asym.id A _struct_asym.entity_id 1 _struct_asym.details HSA_B ## loop_ _atom_type.symbol C N O H S ## loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 SER 1 1 1 SER SER A . n A 1 2 LEU 2 2 2 LEU LEU A . n A 1 3 GLN 3 3 3 GLN GLN A . n A 1 4 LYS 4 4 4 LYS LYS A . n A 1 5 PHE 5 5 5 PHE PHE A . n A 1 6 GLY 6 6 6 GLY GLY A . n A 1 7 GLU 7 7 7 GLU GLU A . n A 1 8 ARG 8 8 8 ARG ARG A . n A 1 9 ALA 9 9 9 ALA ALA A . n A 1 10 PHE 10 10 10 PHE PHE A . n A 1 11 LYS 11 11 11 LYS LYS A . n A 1 12 ALA 12 12 12 ALA ALA A . n A 1 13 TRP 13 13 13 TRP TRP A . n A 1 14 ALA 14 14 14 ALA ALA A . n A 1 15 VAL 15 15 15 VAL VAL A . n A 1 16 ALA 16 16 16 ALA ALA A . n A 1 17 ARG 17 17 17 ARG ARG A . n A 1 18 LEU 18 18 18 LEU LEU A . n A 1 19 SER 19 19 19 SER SER A . n A 1 20 GLN 20 20 20 GLN GLN A . n A 1 21 ARG 21 21 21 ARG ARG A . n A 1 22 PHE 22 22 22 PHE PHE A . n A 1 23 PRO 23 23 23 PRO PRO A . n A 1 24 LYS 24 24 24 LYS LYS A . n A 1 25 ALA 25 25 25 ALA ALA A . n A 1 26 GLU 26 26 26 GLU GLU A . n A 1 27 PHE 27 27 27 PHE PHE A . n A 1 28 ALA 28 28 28 ALA ALA A . n A 1 29 GLU 29 29 29 GLU GLU A . n A 1 30 VAL 30 30 30 VAL VAL A . n A 1 31 SER 31 31 31 SER SER A . n A 1 32 LYS 32 32 32 LYS LYS A . n A 1 33 LEU 33 33 33 LEU LEU A . n A 1 34 VAL 34 34 34 VAL VAL A . n A 1 35 THR 35 35 35 THR THR A . n A 1 36 ASP 36 36 36 ASP ASP A . n A 1 37 LEU 37 37 37 LEU LEU A . n A 1 38 THR 38 38 38 THR THR A . n A 1 39 LYS 39 39 39 LYS LYS A . n A 1 40 VAL 40 40 40 VAL VAL A . n A 1 41 HIS 41 41 41 HIS HIS A . n A 1 42 THR 42 42 42 THR THR A . n A 1 43 GLU 43 43 43 GLU GLU A . n A 1 44 CYS 44 44 44 CYS CYS A . n A 1 45 CYS 45 45 45 CYS CYS A . n A 1 46 HIS 46 46 46 HIS HIS A . n A 1 47 GLY 47 47 47 GLY GLY A . n A 1 48 ASP 48 48 48 ASP ASP A . n A 1 49 LEU 49 49 49 LEU LEU A . n A 1 50 LEU 50 50 50 LEU LEU A . n A 1 51 GLU 51 51 51 GLU GLU A . n A 1 52 CYS 52 52 52 CYS CYS A . n A 1 53 ALA 53 53 53 ALA ALA A . n A 1 54 ASP 54 54 54 ASP ASP A . n A 1 55 ASP 55 55 55 ASP ASP A . n A 1 56 ARG 56 56 56 ARG ARG A . n A 1 57 ALA 57 57 57 ALA ALA A . n A 1 58 ASP 58 58 58 ASP ASP A . n A 1 59 LEU 59 59 59 LEU LEU A . n A 1 60 ALA 60 60 60 ALA ALA A . n A 1 61 LYS 61 61 61 LYS LYS A . n A 1 62 TYR 62 62 62 TYR TYR A . n A 1 63 ILE 63 63 63 ILE ILE A . n A 1 64 CYS 64 64 64 CYS CYS A . n A 1 65 GLU 65 65 65 GLU GLU A . n A 1 66 ASN 66 66 66 ASN ASN A . n A 1 67 GLN 67 67 67 GLN GLN A . n A 1 68 ASP 68 68 68 ASP ASP A . n A 1 69 SER 69 69 69 SER SER A . n A 1 70 ILE 70 70 70 ILE ILE A . n A 1 71 SER 71 71 71 SER SER A . n A 1 72 SER 72 72 72 SER SER A . n A 1 73 LYS 73 73 73 LYS LYS A . n A 1 74 LEU 74 74 74 LEU LEU A . n A 1 75 LYS 75 75 75 LYS LYS A . n A 1 76 GLU 76 76 76 GLU GLU A . n A 1 77 CYS 77 77 77 CYS CYS A . n A 1 78 CYS 78 78 78 CYS CYS A . n A 1 79 GLU 79 79 79 GLU GLU A . n A 1 80 LYS 80 80 80 LYS LYS A . n A 1 81 PRO 81 81 81 PRO PRO A . n A 1 82 LEU 82 82 82 LEU LEU A . n A 1 83 LEU 83 83 83 LEU LEU A . n A 1 84 GLU 84 84 84 GLU GLU A . n A 1 85 LYS 85 85 85 LYS LYS A . n A 1 86 SER 86 86 86 SER SER A . n A 1 87 HIS 87 87 87 HIS HIS A . n A 1 88 CYS 88 88 88 CYS CYS A . n A 1 89 ILE 89 89 89 ILE ILE A . n A 1 90 ALA 90 90 90 ALA ALA A . n A 1 91 GLU 91 91 91 GLU GLU A . n A 1 92 VAL 92 92 92 VAL VAL A . n A 1 93 GLU 93 93 93 GLU GLU A . n A 1 94 ASN 94 94 94 ASN ASN A . n A 1 95 ASP 95 95 95 ASP ASP A . n A 1 96 GLU 96 96 96 GLU GLU A . n A 1 97 MET 97 97 97 MET MET A . n A 1 98 PRO 98 98 98 PRO PRO A . n A 1 99 ALA 99 99 99 ALA ALA A . n A 1 100 ASP 100 100 100 ASP ASP A . n A 1 101 LEU 101 101 101 LEU LEU A . n A 1 102 PRO 102 102 102 PRO PRO A . n A 1 103 SER 103 103 103 SER SER A . n A 1 104 LEU 104 104 104 LEU LEU A . n A 1 105 ALA 105 105 105 ALA ALA A . n A 1 106 ALA 106 106 106 ALA ALA A . n A 1 107 ASP 107 107 107 ASP ASP A . n A 1 108 PHE 108 108 108 PHE PHE A . n A 1 109 VAL 109 109 109 VAL VAL A . n A 1 110 GLU 110 110 110 GLU GLU A . n A 1 111 SER 111 111 111 SER SER A . n A 1 112 LYS 112 112 112 LYS LYS A . n A 1 113 ASP 113 113 113 ASP ASP A . n A 1 114 VAL 114 114 114 VAL VAL A . n A 1 115 CYS 115 115 115 CYS CYS A . n A 1 116 LYS 116 116 116 LYS LYS A . n A 1 117 ASN 117 117 117 ASN ASN A . n A 1 118 TYR 118 118 118 TYR TYR A . n A 1 119 ALA 119 119 119 ALA ALA A . n A 1 120 GLU 120 120 120 GLU GLU A . n A 1 121 ALA 121 121 121 ALA ALA A . n A 1 122 LYS 122 122 122 LYS LYS A . n A 1 123 ASP 123 123 123 ASP ASP A . n A 1 124 VAL 124 124 124 VAL VAL A . n A 1 125 PHE 125 125 125 PHE PHE A . n A 1 126 LEU 126 126 126 LEU LEU A . n A 1 127 GLY 127 127 127 GLY GLY A . n A 1 128 MET 128 128 128 MET MET A . n A 1 129 PHE 129 129 129 PHE PHE A . n A 1 130 LEU 130 130 130 LEU LEU A . n A 1 131 TYR 131 131 131 TYR TYR A . n A 1 132 GLU 132 132 132 GLU GLU A . n A 1 133 TYR 133 133 133 TYR TYR A . n A 1 134 ALA 134 134 134 ALA ALA A . n A 1 135 ARG 135 135 135 ARG ARG A . n A 1 136 ARG 136 136 136 ARG ARG A . n A 1 137 HIS 137 137 137 HIS HIS A . n A 1 138 PRO 138 138 138 PRO PRO A . n A 1 139 ASP 139 139 139 ASP ASP A . n A 1 140 TYR 140 140 140 TYR TYR A . n A 1 141 SER 141 141 141 SER SER A . n A 1 142 VAL 142 142 142 VAL VAL A . n A 1 143 VAL 143 143 143 VAL VAL A . n A 1 144 LEU 144 144 144 LEU LEU A . n A 1 145 LEU 145 145 145 LEU LEU A . n A 1 146 LEU 146 146 146 LEU LEU A . n A 1 147 ARG 147 147 147 ARG ARG A . n A 1 148 LEU 148 148 148 LEU LEU A . n A 1 149 ALA 149 149 149 ALA ALA A . n A 1 150 LYS 150 150 150 LYS LYS A . n A 1 151 THR 151 151 151 THR THR A . n A 1 152 TYR 152 152 152 TYR TYR A . n A 1 153 GLU 153 153 153 GLU GLU A . n A 1 154 THR 154 154 154 THR THR A . n A 1 155 THR 155 155 155 THR THR A . n A 1 156 LEU 156 156 156 LEU LEU A . n A 1 157 GLU 157 157 157 GLU GLU A . n A 1 158 LYS 158 158 158 LYS LYS A . n A 1 159 CYS 159 159 159 CYS CYS A . n A 1 160 CYS 160 160 160 CYS CYS A . n A 1 161 ALA 161 161 161 ALA ALA A . n A 1 162 ALA 162 162 162 ALA ALA A . n A 1 163 ALA 163 163 163 ALA ALA A . n A 1 164 ASP 164 164 164 ASP ASP A . n A 1 165 PRO 165 165 165 PRO PRO A . n A 1 166 HIS 166 166 166 HIS HIS A . n A 1 167 GLU 167 167 167 GLU GLU A . n A 1 168 CYS 168 168 168 CYS CYS A . n A 1 169 TYR 169 169 169 TYR TYR A . n A 1 170 ALA 170 170 170 ALA ALA A . n A 1 171 LYS 171 171 171 LYS LYS A . n A 1 172 VAL 172 172 172 VAL VAL A . n A 1 173 PHE 173 173 173 PHE PHE A . n A 1 174 ASP 174 174 174 ASP ASP A . n A 1 175 GLU 175 175 175 GLU GLU A . n A 1 176 PHE 176 176 176 PHE PHE A . n A 1 177 LYS 177 177 177 LYS LYS A . n A 1 178 PRO 178 178 178 PRO PRO A . n A 1 179 LEU 179 179 179 LEU LEU A . n A 1 180 VAL 180 180 180 VAL VAL A . n A 1 181 GLU 181 181 181 GLU GLU A . n A 1 182 GLU 182 182 182 GLU GLU A . n A 1 183 PRO 183 183 183 PRO PRO A . n A 1 184 GLN 184 184 184 GLN GLN A . n A 1 185 ASN 185 185 185 ASN ASN A . n A 1 186 LEU 186 186 186 LEU LEU A . n A 1 187 ILE 187 187 187 ILE ILE A . n A 1 188 LYS 188 188 188 LYS LYS A . n A 1 189 GLN 189 189 189 GLN GLN A . n ## loop_ _ihm_entity_poly_segment.id _ihm_entity_poly_segment.entity_id _ihm_entity_poly_segment.seq_id_begin _ihm_entity_poly_segment.seq_id_end _ihm_entity_poly_segment.comp_id_begin _ihm_entity_poly_segment.comp_id_end 1 1 1 189 SER GLN # # loop_ _ihm_struct_assembly.id _ihm_struct_assembly.name _ihm_struct_assembly.description 1 'Complete assembly' ;Structure of human serum albumin domain B, obtained from purified samples in their native enviroment, elucidated using chemical crosslinking coupled with mass spectrometry (CXMS) experiments and computational biology algorithms. ; # # loop_ _ihm_struct_assembly_details.id _ihm_struct_assembly_details.assembly_id _ihm_struct_assembly_details.parent_assembly_id _ihm_struct_assembly_details.entity_description _ihm_struct_assembly_details.entity_id _ihm_struct_assembly_details.asym_id _ihm_struct_assembly_details.entity_poly_segment_id 1 1 1 HSA_B 1 A 1 # # loop_ _ihm_external_reference_info.reference_id _ihm_external_reference_info.reference_provider _ihm_external_reference_info.reference_type _ihm_external_reference_info.reference _ihm_external_reference_info.refers_to _ihm_external_reference_info.associated_url 1 Zenodo DOI 10.5281/zenodo.1035833 File https://zenodo.org/record/1035833/files/1ao6_domainB # # loop_ _ihm_external_files.id _ihm_external_files.reference_id _ihm_external_files.file_path _ihm_external_files.content_type _ihm_external_files.file_format _ihm_external_files.file_size_bytes _ihm_external_files.details 1 1 1ao6_domainB 'Input data or restraints' TXT . 'Predicted contacts generated by EPC-map for domain B' # # loop_ _ihm_dataset_list.id _ihm_dataset_list.data_type _ihm_dataset_list.database_hosted _ihm_dataset_list.details 1 'Crosslinking-MS data' YES . 2 'Predicted contacts' NO . # # loop_ _ihm_dataset_group.id _ihm_dataset_group.name _ihm_dataset_group.application _ihm_dataset_group.details 1 . . . # # loop_ _ihm_dataset_group_link.group_id _ihm_dataset_group_link.dataset_list_id 1 1 1 2 # # loop_ _ihm_dataset_external_reference.id _ihm_dataset_external_reference.dataset_list_id _ihm_dataset_external_reference.file_id 1 2 1 # # loop_ _ihm_dataset_related_db_reference.id _ihm_dataset_related_db_reference.dataset_list_id _ihm_dataset_related_db_reference.db_name _ihm_dataset_related_db_reference.accession_code _ihm_dataset_related_db_reference.version _ihm_dataset_related_db_reference.details 1 1 PRIDE PXD001692 . 'Protein Structure Determination in Biological Matrices by Mass Spectrometry and Computational Biology' # # loop_ _ihm_model_representation.id _ihm_model_representation.name _ihm_model_representation.details 1 . . # # loop_ _ihm_model_representation_details.id _ihm_model_representation_details.representation_id _ihm_model_representation_details.entity_id _ihm_model_representation_details.entity_description _ihm_model_representation_details.entity_asym_id _ihm_model_representation_details.entity_poly_segment_id _ihm_model_representation_details.model_object_primitive _ihm_model_representation_details.starting_model_id _ihm_model_representation_details.model_mode _ihm_model_representation_details.model_granularity _ihm_model_representation_details.model_object_count 1 1 1 HSA_B A 1 atomistic . rigid by-atom . # # loop_ _ihm_modeling_protocol.id _ihm_modeling_protocol.protocol_name _ihm_modeling_protocol.num_steps 1 'Model-based search (MBS)' 1 # # loop_ _ihm_modeling_protocol_details.id _ihm_modeling_protocol_details.protocol_id _ihm_modeling_protocol_details.step_id _ihm_modeling_protocol_details.struct_assembly_id _ihm_modeling_protocol_details.dataset_group_id _ihm_modeling_protocol_details.struct_assembly_description _ihm_modeling_protocol_details.step_name _ihm_modeling_protocol_details.step_method _ihm_modeling_protocol_details.num_models_begin _ihm_modeling_protocol_details.num_models_end _ihm_modeling_protocol_details.multi_scale_flag _ihm_modeling_protocol_details.multi_state_flag _ihm_modeling_protocol_details.ordered_flag _ihm_modeling_protocol_details.software_id _ihm_modeling_protocol_details.script_file_id 1 1 1 1 . 'All known components' 'Conformational search' 'Model-based search (MBS) in Rosetta' 0 5000 NO NO NO . . # # loop_ _ihm_modeling_post_process.id _ihm_modeling_post_process.protocol_id _ihm_modeling_post_process.analysis_id _ihm_modeling_post_process.step_id _ihm_modeling_post_process.type _ihm_modeling_post_process.feature _ihm_modeling_post_process.feature_name _ihm_modeling_post_process.num_models_begin _ihm_modeling_post_process.num_models_end _ihm_modeling_post_process.struct_assembly_id _ihm_modeling_post_process.dataset_group_id _ihm_modeling_post_process.software_id _ihm_modeling_post_process.script_file_id 1 1 1 1 filter energy/score "Rosetta energy" 5000 5 . . . . 2 1 1 2 rescore energy/score "GOAP (orientation-dependent all-atom statistical potential)" 5 5 . . . . # # loop_ _ihm_cross_link_list.id _ihm_cross_link_list.group_id _ihm_cross_link_list.entity_description_1 _ihm_cross_link_list.entity_id_1 _ihm_cross_link_list.seq_id_1 _ihm_cross_link_list.comp_id_1 _ihm_cross_link_list.entity_description_2 _ihm_cross_link_list.entity_id_2 _ihm_cross_link_list.seq_id_2 _ihm_cross_link_list.comp_id_2 _ihm_cross_link_list.linker_type _ihm_cross_link_list.dataset_list_id 1 1 HSA_B 1 118 TYR HSA_B 1 148 LEU sulfo-SDA 1 2 2 HSA_B 1 177 LYS HSA_B 1 137 HIS sulfo-SDA 1 3 3 HSA_B 1 8 ARG HSA_B 1 151 THR sulfo-SDA 1 4 4 HSA_B 1 47 GLY HSA_B 1 35 THR sulfo-SDA 1 5 5 HSA_B 1 9 ALA HSA_B 1 150 LYS sulfo-SDA 1 6 6 HSA_B 1 174 ASP HSA_B 1 140 TYR sulfo-SDA 1 7 7 HSA_B 1 12 ALA HSA_B 1 31 SER sulfo-SDA 1 8 8 HSA_B 1 151 THR HSA_B 1 117 ASN sulfo-SDA 1 9 9 HSA_B 1 6 GLY HSA_B 1 152 TYR sulfo-SDA 1 10 10 HSA_B 1 177 LYS HSA_B 1 140 TYR sulfo-SDA 1 11 11 HSA_B 1 11 LYS HSA_B 1 152 TYR sulfo-SDA 1 12 12 HSA_B 1 150 LYS HSA_B 1 124 VAL sulfo-SDA 1 13 13 HSA_B 1 89 ILE HSA_B 1 72 SER sulfo-SDA 1 14 14 HSA_B 1 16 ALA HSA_B 1 152 TYR sulfo-SDA 1 15 15 HSA_B 1 122 LYS HSA_B 1 148 LEU sulfo-SDA 1 16 16 HSA_B 1 63 ILE HSA_B 1 39 LYS sulfo-SDA 1 17 17 HSA_B 1 155 THR HSA_B 1 117 ASN sulfo-SDA 1 18 18 HSA_B 1 155 THR HSA_B 1 124 VAL sulfo-SDA 1 19 19 HSA_B 1 172 VAL HSA_B 1 140 TYR sulfo-SDA 1 20 20 HSA_B 1 75 LYS HSA_B 1 91 GLU sulfo-SDA 1 21 21 HSA_B 1 48 ASP HSA_B 1 62 TYR sulfo-SDA 1 22 22 HSA_B 1 5 PHE HSA_B 1 150 LYS sulfo-SDA 1 23 23 HSA_B 1 156 LEU HSA_B 1 122 LYS sulfo-SDA 1 24 24 HSA_B 1 55 ASP HSA_B 1 38 THR sulfo-SDA 1 25 25 HSA_B 1 86 SER HSA_B 1 74 LEU sulfo-SDA 1 26 26 HSA_B 1 10 PHE HSA_B 1 35 THR sulfo-SDA 1 27 27 HSA_B 1 7 GLU HSA_B 1 151 THR sulfo-SDA 1 28 28 HSA_B 1 2 LEU HSA_B 1 39 LYS sulfo-SDA 1 29 29 HSA_B 1 145 LEU HSA_B 1 133 TYR sulfo-SDA 1 30 30 HSA_B 1 151 THR HSA_B 1 5 PHE sulfo-SDA 1 31 31 HSA_B 1 46 HIS HSA_B 1 62 TYR sulfo-SDA 1 32 32 HSA_B 1 149 ALA HSA_B 1 118 TYR sulfo-SDA 1 33 33 HSA_B 1 75 LYS HSA_B 1 92 VAL sulfo-SDA 1 34 34 HSA_B 1 5 PHE HSA_B 1 39 LYS sulfo-SDA 1 35 35 HSA_B 1 49 LEU HSA_B 1 61 LYS sulfo-SDA 1 36 36 HSA_B 1 11 LYS HSA_B 1 125 PHE sulfo-SDA 1 37 37 HSA_B 1 1 SER HSA_B 1 40 VAL sulfo-SDA 1 38 38 HSA_B 1 11 LYS HSA_B 1 33 LEU sulfo-SDA 1 39 39 HSA_B 1 149 ALA HSA_B 1 11 LYS sulfo-SDA 1 40 40 HSA_B 1 56 ARG HSA_B 1 1 SER sulfo-SDA 1 41 41 HSA_B 1 157 GLU HSA_B 1 122 LYS sulfo-SDA 1 42 42 HSA_B 1 93 GLU HSA_B 1 80 LYS sulfo-SDA 1 43 43 HSA_B 1 10 PHE HSA_B 1 150 LYS sulfo-SDA 1 44 44 HSA_B 1 11 LYS HSA_B 1 36 ASP sulfo-SDA 1 45 45 HSA_B 1 55 ASP HSA_B 1 35 THR sulfo-SDA 1 46 46 HSA_B 1 8 ARG HSA_B 1 150 LYS sulfo-SDA 1 47 47 HSA_B 1 86 SER HSA_B 1 113 ASP sulfo-SDA 1 48 48 HSA_B 1 150 LYS HSA_B 1 122 LYS sulfo-SDA 1 49 49 HSA_B 1 42 THR HSA_B 1 57 ALA sulfo-SDA 1 50 50 HSA_B 1 75 LYS HSA_B 1 93 GLU sulfo-SDA 1 51 51 HSA_B 1 62 TYR HSA_B 1 170 ALA sulfo-SDA 1 52 52 HSA_B 1 11 LYS HSA_B 1 148 LEU sulfo-SDA 1 53 53 HSA_B 1 151 THR HSA_B 1 122 LYS sulfo-SDA 1 54 54 HSA_B 1 87 HIS HSA_B 1 75 LYS sulfo-SDA 1 55 55 HSA_B 1 11 LYS HSA_B 1 153 GLU sulfo-SDA 1 56 56 HSA_B 1 89 ILE HSA_B 1 73 LYS sulfo-SDA 1 57 57 HSA_B 1 62 TYR HSA_B 1 33 LEU sulfo-SDA 1 58 58 HSA_B 1 6 GLY HSA_B 1 39 LYS sulfo-SDA 1 59 59 HSA_B 1 42 THR HSA_B 1 58 ASP sulfo-SDA 1 60 60 HSA_B 1 11 LYS HSA_B 1 35 THR sulfo-SDA 1 61 61 HSA_B 1 150 LYS HSA_B 1 6 GLY sulfo-SDA 1 62 62 HSA_B 1 87 HIS HSA_B 1 73 LYS sulfo-SDA 1 63 63 HSA_B 1 176 PHE HSA_B 1 141 SER sulfo-SDA 1 64 64 HSA_B 1 11 LYS HSA_B 1 38 THR sulfo-SDA 1 65 65 HSA_B 1 138 PRO HSA_B 1 4 LYS sulfo-SDA 1 66 66 HSA_B 1 177 LYS HSA_B 1 136 ARG sulfo-SDA 1 67 67 HSA_B 1 8 ARG HSA_B 1 152 TYR sulfo-SDA 1 68 68 HSA_B 1 149 ALA HSA_B 1 122 LYS sulfo-SDA 1 69 69 HSA_B 1 41 HIS HSA_B 1 1 SER sulfo-SDA 1 70 70 HSA_B 1 93 GLU HSA_B 1 72 SER sulfo-SDA 1 71 71 HSA_B 1 29 GLU HSA_B 1 62 TYR sulfo-SDA 1 72 72 HSA_B 1 152 TYR HSA_B 1 117 ASN sulfo-SDA 1 73 73 HSA_B 1 146 LEU HSA_B 1 133 TYR sulfo-SDA 1 74 74 HSA_B 1 49 LEU HSA_B 1 62 TYR sulfo-SDA 1 75 75 HSA_B 1 174 ASP HSA_B 1 141 SER sulfo-SDA 1 76 76 HSA_B 1 16 ALA HSA_B 1 150 LYS sulfo-SDA 1 77 77 HSA_B 1 32 LYS HSA_B 1 63 ILE sulfo-SDA 1 78 78 HSA_B 1 177 LYS HSA_B 1 189 GLN sulfo-SDA 1 79 79 HSA_B 1 90 ALA HSA_B 1 71 SER sulfo-SDA 1 80 80 HSA_B 1 22 PHE HSA_B 1 71 SER sulfo-SDA 1 81 81 HSA_B 1 140 TYR HSA_B 1 3 GLN sulfo-SDA 1 82 82 HSA_B 1 62 TYR HSA_B 1 165 PRO sulfo-SDA 1 83 83 HSA_B 1 51 GLU HSA_B 1 38 THR sulfo-SDA 1 84 84 HSA_B 1 172 VAL HSA_B 1 141 SER sulfo-SDA 1 85 85 HSA_B 1 177 LYS HSA_B 1 139 ASP sulfo-SDA 1 86 86 HSA_B 1 157 GLU HSA_B 1 118 TYR sulfo-SDA 1 87 87 HSA_B 1 96 GLU HSA_B 1 75 LYS sulfo-SDA 1 88 88 HSA_B 1 6 GLY HSA_B 1 151 THR sulfo-SDA 1 89 89 HSA_B 1 152 TYR HSA_B 1 119 ALA sulfo-SDA 1 90 90 HSA_B 1 177 LYS HSA_B 1 141 SER sulfo-SDA 1 91 91 HSA_B 1 7 GLU HSA_B 1 150 LYS sulfo-SDA 1 92 92 HSA_B 1 50 LEU HSA_B 1 62 TYR sulfo-SDA 1 93 93 HSA_B 1 177 LYS HSA_B 1 142 VAL sulfo-SDA 1 94 94 HSA_B 1 31 SER HSA_B 1 63 ILE sulfo-SDA 1 95 95 HSA_B 1 173 PHE HSA_B 1 141 SER sulfo-SDA 1 96 96 HSA_B 1 43 GLU HSA_B 1 62 TYR sulfo-SDA 1 97 97 HSA_B 1 13 TRP HSA_B 1 1 SER sulfo-SDA 1 98 98 HSA_B 1 154 THR HSA_B 1 117 ASN sulfo-SDA 1 99 99 HSA_B 1 87 HIS HSA_B 1 69 SER sulfo-SDA 1 100 100 HSA_B 1 62 TYR HSA_B 1 32 LYS sulfo-SDA 1 101 101 HSA_B 1 48 ASP HSA_B 1 35 THR sulfo-SDA 1 102 102 HSA_B 1 95 ASP HSA_B 1 80 LYS sulfo-SDA 1 103 103 HSA_B 1 7 GLU HSA_B 1 39 LYS sulfo-SDA 1 104 104 HSA_B 1 43 GLU HSA_B 1 61 LYS sulfo-SDA 1 105 105 HSA_B 1 32 LYS HSA_B 1 5 PHE sulfo-SDA 1 106 106 HSA_B 1 11 LYS HSA_B 1 31 SER sulfo-SDA 1 107 107 HSA_B 1 176 PHE HSA_B 1 140 TYR sulfo-SDA 1 # # loop_ _ihm_cross_link_restraint.id _ihm_cross_link_restraint.group_id _ihm_cross_link_restraint.entity_id_1 _ihm_cross_link_restraint.asym_id_1 _ihm_cross_link_restraint.seq_id_1 _ihm_cross_link_restraint.comp_id_1 _ihm_cross_link_restraint.entity_id_2 _ihm_cross_link_restraint.asym_id_2 _ihm_cross_link_restraint.seq_id_2 _ihm_cross_link_restraint.comp_id_2 _ihm_cross_link_restraint.atom_id_1 _ihm_cross_link_restraint.atom_id_2 _ihm_cross_link_restraint.restraint_type _ihm_cross_link_restraint.conditional_crosslink_flag _ihm_cross_link_restraint.model_granularity _ihm_cross_link_restraint.distance_threshold _ihm_cross_link_restraint.psi _ihm_cross_link_restraint.sigma_1 _ihm_cross_link_restraint.sigma_2 1 24 1 A 55 ASP 1 A 38 THR . . 'upper bound' . by-residue 20.000 0.200 0.000 0.000 2 25 1 A 86 SER 1 A 74 LEU . . 'upper bound' . by-residue 20.000 0.200 0.000 0.000 3 26 1 A 10 PHE 1 A 35 THR . . 'upper bound' . by-residue 20.000 0.200 0.000 0.000 4 27 1 A 7 GLU 1 A 151 THR . . 'upper bound' . by-residue 20.000 0.200 0.000 0.000 5 20 1 A 75 LYS 1 A 91 GLU . . 'upper bound' . by-residue 20.000 0.200 0.000 0.000 6 21 1 A 48 ASP 1 A 62 TYR . . 'upper bound' . by-residue 20.000 0.200 0.000 0.000 7 22 1 A 5 PHE 1 A 150 LYS . . 'upper bound' . by-residue 20.000 0.200 0.000 0.000 8 23 1 A 156 LEU 1 A 122 LYS . . 'upper bound' . by-residue 20.000 0.200 0.000 0.000 9 28 1 A 2 LEU 1 A 39 LYS . . 'upper bound' . by-residue 20.000 0.200 0.000 0.000 10 29 1 A 145 LEU 1 A 133 TYR . . 'upper bound' . by-residue 20.000 0.200 0.000 0.000 11 4 1 A 47 GLY 1 A 35 THR . . 'upper bound' . by-residue 20.000 0.200 0.000 0.000 12 8 1 A 151 THR 1 A 117 ASN . . 'upper bound' . by-residue 20.000 0.200 0.000 0.000 13 59 1 A 42 THR 1 A 58 ASP . . 'upper bound' . by-residue 20.000 0.200 0.000 0.000 14 58 1 A 6 GLY 1 A 39 LYS . . 'upper bound' . by-residue 20.000 0.200 0.000 0.000 15 55 1 A 11 LYS 1 A 153 GLU . . 'upper bound' . by-residue 20.000 0.200 0.000 0.000 16 54 1 A 87 HIS 1 A 75 LYS . . 'upper bound' . by-residue 20.000 0.200 0.000 0.000 17 57 1 A 62 TYR 1 A 33 LEU . . 'upper bound' . by-residue 20.000 0.200 0.000 0.000 18 56 1 A 89 ILE 1 A 73 LYS . . 'upper bound' . by-residue 20.000 0.200 0.000 0.000 19 51 1 A 62 TYR 1 A 170 ALA . . 'upper bound' . by-residue 20.000 0.200 0.000 0.000 20 50 1 A 75 LYS 1 A 93 GLU . . 'upper bound' . by-residue 20.000 0.200 0.000 0.000 21 53 1 A 151 THR 1 A 122 LYS . . 'upper bound' . by-residue 20.000 0.200 0.000 0.000 22 52 1 A 11 LYS 1 A 148 LEU . . 'upper bound' . by-residue 20.000 0.200 0.000 0.000 23 88 1 A 6 GLY 1 A 151 THR . . 'upper bound' . by-residue 20.000 0.200 0.000 0.000 24 89 1 A 152 TYR 1 A 119 ALA . . 'upper bound' . by-residue 20.000 0.200 0.000 0.000 25 82 1 A 62 TYR 1 A 165 PRO . . 'upper bound' . by-residue 20.000 0.200 0.000 0.000 26 83 1 A 51 GLU 1 A 38 THR . . 'upper bound' . by-residue 20.000 0.200 0.000 0.000 27 80 1 A 22 PHE 1 A 71 SER . . 'upper bound' . by-residue 20.000 0.200 0.000 0.000 28 81 1 A 140 TYR 1 A 3 GLN . . 'upper bound' . by-residue 20.000 0.200 0.000 0.000 29 86 1 A 157 GLU 1 A 118 TYR . . 'upper bound' . by-residue 20.000 0.200 0.000 0.000 30 87 1 A 96 GLU 1 A 75 LYS . . 'upper bound' . by-residue 20.000 0.200 0.000 0.000 31 84 1 A 172 VAL 1 A 141 SER . . 'upper bound' . by-residue 20.000 0.200 0.000 0.000 32 85 1 A 177 LYS 1 A 139 ASP . . 'upper bound' . by-residue 20.000 0.200 0.000 0.000 33 3 1 A 8 ARG 1 A 151 THR . . 'upper bound' . by-residue 20.000 0.200 0.000 0.000 34 7 1 A 12 ALA 1 A 31 SER . . 'upper bound' . by-residue 20.000 0.200 0.000 0.000 35 102 1 A 95 ASP 1 A 80 LYS . . 'upper bound' . by-residue 20.000 0.200 0.000 0.000 36 103 1 A 7 GLU 1 A 39 LYS . . 'upper bound' . by-residue 20.000 0.200 0.000 0.000 37 100 1 A 62 TYR 1 A 32 LYS . . 'upper bound' . by-residue 20.000 0.200 0.000 0.000 38 101 1 A 48 ASP 1 A 35 THR . . 'upper bound' . by-residue 20.000 0.200 0.000 0.000 39 106 1 A 11 LYS 1 A 31 SER . . 'upper bound' . by-residue 20.000 0.200 0.000 0.000 40 107 1 A 176 PHE 1 A 140 TYR . . 'upper bound' . by-residue 20.000 0.200 0.000 0.000 41 104 1 A 43 GLU 1 A 61 LYS . . 'upper bound' . by-residue 20.000 0.200 0.000 0.000 42 105 1 A 32 LYS 1 A 5 PHE . . 'upper bound' . by-residue 20.000 0.200 0.000 0.000 43 39 1 A 149 ALA 1 A 11 LYS . . 'upper bound' . by-residue 20.000 0.200 0.000 0.000 44 38 1 A 11 LYS 1 A 33 LEU . . 'upper bound' . by-residue 20.000 0.200 0.000 0.000 45 33 1 A 75 LYS 1 A 92 VAL . . 'upper bound' . by-residue 20.000 0.200 0.000 0.000 46 32 1 A 149 ALA 1 A 118 TYR . . 'upper bound' . by-residue 20.000 0.200 0.000 0.000 47 31 1 A 46 HIS 1 A 62 TYR . . 'upper bound' . by-residue 20.000 0.200 0.000 0.000 48 30 1 A 151 THR 1 A 5 PHE . . 'upper bound' . by-residue 20.000 0.200 0.000 0.000 49 37 1 A 1 SER 1 A 40 VAL . . 'upper bound' . by-residue 20.000 0.200 0.000 0.000 50 36 1 A 11 LYS 1 A 125 PHE . . 'upper bound' . by-residue 20.000 0.200 0.000 0.000 51 35 1 A 49 LEU 1 A 61 LYS . . 'upper bound' . by-residue 20.000 0.200 0.000 0.000 52 34 1 A 5 PHE 1 A 39 LYS . . 'upper bound' . by-residue 20.000 0.200 0.000 0.000 53 60 1 A 11 LYS 1 A 35 THR . . 'upper bound' . by-residue 20.000 0.200 0.000 0.000 54 61 1 A 150 LYS 1 A 6 GLY . . 'upper bound' . by-residue 20.000 0.200 0.000 0.000 55 62 1 A 87 HIS 1 A 73 LYS . . 'upper bound' . by-residue 20.000 0.200 0.000 0.000 56 63 1 A 176 PHE 1 A 141 SER . . 'upper bound' . by-residue 20.000 0.200 0.000 0.000 57 64 1 A 11 LYS 1 A 38 THR . . 'upper bound' . by-residue 20.000 0.200 0.000 0.000 58 65 1 A 138 PRO 1 A 4 LYS . . 'upper bound' . by-residue 20.000 0.200 0.000 0.000 59 66 1 A 177 LYS 1 A 136 ARG . . 'upper bound' . by-residue 20.000 0.200 0.000 0.000 60 67 1 A 8 ARG 1 A 152 TYR . . 'upper bound' . by-residue 20.000 0.200 0.000 0.000 61 68 1 A 149 ALA 1 A 122 LYS . . 'upper bound' . by-residue 20.000 0.200 0.000 0.000 62 69 1 A 41 HIS 1 A 1 SER . . 'upper bound' . by-residue 20.000 0.200 0.000 0.000 63 2 1 A 177 LYS 1 A 137 HIS . . 'upper bound' . by-residue 20.000 0.200 0.000 0.000 64 6 1 A 174 ASP 1 A 140 TYR . . 'upper bound' . by-residue 20.000 0.200 0.000 0.000 65 99 1 A 87 HIS 1 A 69 SER . . 'upper bound' . by-residue 20.000 0.200 0.000 0.000 66 98 1 A 154 THR 1 A 117 ASN . . 'upper bound' . by-residue 20.000 0.200 0.000 0.000 67 91 1 A 7 GLU 1 A 150 LYS . . 'upper bound' . by-residue 20.000 0.200 0.000 0.000 68 90 1 A 177 LYS 1 A 141 SER . . 'upper bound' . by-residue 20.000 0.200 0.000 0.000 69 93 1 A 177 LYS 1 A 142 VAL . . 'upper bound' . by-residue 20.000 0.200 0.000 0.000 70 92 1 A 50 LEU 1 A 62 TYR . . 'upper bound' . by-residue 20.000 0.200 0.000 0.000 71 95 1 A 173 PHE 1 A 141 SER . . 'upper bound' . by-residue 20.000 0.200 0.000 0.000 72 94 1 A 31 SER 1 A 63 ILE . . 'upper bound' . by-residue 20.000 0.200 0.000 0.000 73 97 1 A 13 TRP 1 A 1 SER . . 'upper bound' . by-residue 20.000 0.200 0.000 0.000 74 96 1 A 43 GLU 1 A 62 TYR . . 'upper bound' . by-residue 20.000 0.200 0.000 0.000 75 11 1 A 11 LYS 1 A 152 TYR . . 'upper bound' . by-residue 20.000 0.200 0.000 0.000 76 10 1 A 177 LYS 1 A 140 TYR . . 'upper bound' . by-residue 20.000 0.200 0.000 0.000 77 13 1 A 89 ILE 1 A 72 SER . . 'upper bound' . by-residue 20.000 0.200 0.000 0.000 78 12 1 A 150 LYS 1 A 124 VAL . . 'upper bound' . by-residue 20.000 0.200 0.000 0.000 79 15 1 A 122 LYS 1 A 148 LEU . . 'upper bound' . by-residue 20.000 0.200 0.000 0.000 80 14 1 A 16 ALA 1 A 152 TYR . . 'upper bound' . by-residue 20.000 0.200 0.000 0.000 81 17 1 A 155 THR 1 A 117 ASN . . 'upper bound' . by-residue 20.000 0.200 0.000 0.000 82 16 1 A 63 ILE 1 A 39 LYS . . 'upper bound' . by-residue 20.000 0.200 0.000 0.000 83 19 1 A 172 VAL 1 A 140 TYR . . 'upper bound' . by-residue 20.000 0.200 0.000 0.000 84 18 1 A 155 THR 1 A 124 VAL . . 'upper bound' . by-residue 20.000 0.200 0.000 0.000 85 48 1 A 150 LYS 1 A 122 LYS . . 'upper bound' . by-residue 20.000 0.200 0.000 0.000 86 49 1 A 42 THR 1 A 57 ALA . . 'upper bound' . by-residue 20.000 0.200 0.000 0.000 87 46 1 A 8 ARG 1 A 150 LYS . . 'upper bound' . by-residue 20.000 0.200 0.000 0.000 88 47 1 A 86 SER 1 A 113 ASP . . 'upper bound' . by-residue 20.000 0.200 0.000 0.000 89 44 1 A 11 LYS 1 A 36 ASP . . 'upper bound' . by-residue 20.000 0.200 0.000 0.000 90 45 1 A 55 ASP 1 A 35 THR . . 'upper bound' . by-residue 20.000 0.200 0.000 0.000 91 42 1 A 93 GLU 1 A 80 LYS . . 'upper bound' . by-residue 20.000 0.200 0.000 0.000 92 43 1 A 10 PHE 1 A 150 LYS . . 'upper bound' . by-residue 20.000 0.200 0.000 0.000 93 40 1 A 56 ARG 1 A 1 SER . . 'upper bound' . by-residue 20.000 0.200 0.000 0.000 94 41 1 A 157 GLU 1 A 122 LYS . . 'upper bound' . by-residue 20.000 0.200 0.000 0.000 95 1 1 A 118 TYR 1 A 148 LEU . . 'upper bound' . by-residue 20.000 0.200 0.000 0.000 96 5 1 A 9 ALA 1 A 150 LYS . . 'upper bound' . by-residue 20.000 0.200 0.000 0.000 97 9 1 A 6 GLY 1 A 152 TYR . . 'upper bound' . by-residue 20.000 0.200 0.000 0.000 98 77 1 A 32 LYS 1 A 63 ILE . . 'upper bound' . by-residue 20.000 0.200 0.000 0.000 99 76 1 A 16 ALA 1 A 150 LYS . . 'upper bound' . by-residue 20.000 0.200 0.000 0.000 100 75 1 A 174 ASP 1 A 141 SER . . 'upper bound' . by-residue 20.000 0.200 0.000 0.000 101 74 1 A 49 LEU 1 A 62 TYR . . 'upper bound' . by-residue 20.000 0.200 0.000 0.000 102 73 1 A 146 LEU 1 A 133 TYR . . 'upper bound' . by-residue 20.000 0.200 0.000 0.000 103 72 1 A 152 TYR 1 A 117 ASN . . 'upper bound' . by-residue 20.000 0.200 0.000 0.000 104 71 1 A 29 GLU 1 A 62 TYR . . 'upper bound' . by-residue 20.000 0.200 0.000 0.000 105 70 1 A 93 GLU 1 A 72 SER . . 'upper bound' . by-residue 20.000 0.200 0.000 0.000 106 79 1 A 90 ALA 1 A 71 SER . . 'upper bound' . by-residue 20.000 0.200 0.000 0.000 107 78 1 A 177 LYS 1 A 189 GLN . . 'upper bound' . by-residue 20.000 0.200 0.000 0.000 # # loop_ _ihm_predicted_contact_restraint.id _ihm_predicted_contact_restraint.group_id _ihm_predicted_contact_restraint.entity_id_1 _ihm_predicted_contact_restraint.asym_id_1 _ihm_predicted_contact_restraint.comp_id_1 _ihm_predicted_contact_restraint.seq_id_1 _ihm_predicted_contact_restraint.rep_atom_1 _ihm_predicted_contact_restraint.entity_id_2 _ihm_predicted_contact_restraint.asym_id_2 _ihm_predicted_contact_restraint.comp_id_2 _ihm_predicted_contact_restraint.seq_id_2 _ihm_predicted_contact_restraint.rep_atom_2 _ihm_predicted_contact_restraint.restraint_type _ihm_predicted_contact_restraint.distance_lower_limit _ihm_predicted_contact_restraint.distance_upper_limit _ihm_predicted_contact_restraint.probability _ihm_predicted_contact_restraint.model_granularity _ihm_predicted_contact_restraint.dataset_list_id _ihm_predicted_contact_restraint.software_id 1 . 1 A VAL 15 CB 1 A PHE 27 CB 'upper bound' . 8.000 1.000 by-feature 2 2 2 . 1 A CYS 64 CB 1 A CYS 88 CB 'upper bound' . 8.000 1.000 by-feature 2 2 3 . 1 A ALA 14 CB 1 A LEU 37 CB 'upper bound' . 8.000 1.000 by-feature 2 2 4 . 1 A THR 151 CB 1 A LEU 179 CB 'upper bound' . 8.000 1.000 by-feature 2 2 5 . 1 A CYS 64 CB 1 A CYS 78 CB 'upper bound' . 8.000 1.000 by-feature 2 2 6 . 1 A TYR 152 CB 1 A VAL 172 CB 'upper bound' . 8.000 1.000 by-feature 2 2 7 . 1 A LEU 156 CB 1 A TYR 169 CB 'upper bound' . 8.000 1.000 by-feature 2 2 8 . 1 A PHE 129 CB 1 A LEU 145 CB 'upper bound' . 8.000 1.000 by-feature 2 2 9 . 1 A CYS 159 CB 1 A VAL 172 CB 'upper bound' . 8.000 1.000 by-feature 2 2 10 . 1 A PHE 129 CB 1 A PHE 173 CB 'upper bound' . 8.000 1.000 by-feature 2 2 11 . 1 A ILE 63 CB 1 A ILE 89 CB 'upper bound' . 8.000 1.000 by-feature 2 2 12 . 1 A ALA 60 CB 1 A CYS 77 CB 'upper bound' . 8.000 1.000 by-feature 2 2 13 . 1 A TYR 118 CB 1 A LEU 156 CB 'upper bound' . 8.000 1.000 by-feature 2 2 14 . 1 A LEU 18 CB 1 A VAL 30 CB 'upper bound' . 8.000 1.000 by-feature 2 2 15 . 1 A LEU 126 CB 1 A TYR 152 CB 'upper bound' . 8.000 1.000 by-feature 2 2 16 . 1 A LEU 148 CB 1 A PHE 176 CB 'upper bound' . 8.000 1.000 by-feature 2 2 17 . 1 A CYS 159 CB 1 A LYS 171 CB 'upper bound' . 8.000 1.000 by-feature 2 2 18 . 1 A CYS 64 CB 1 A LYS 85 CB 'upper bound' . 8.000 1.000 by-feature 2 2 19 . 1 A VAL 40 CB 1 A ASP 55 CB 'upper bound' . 8.000 1.000 by-feature 2 2 20 . 1 A ALA 60 CB 1 A LEU 74 CB 'upper bound' . 8.000 1.000 by-feature 2 2 21 . 1 A VAL 15 CB 1 A VAL 30 CB 'upper bound' . 8.000 1.000 by-feature 2 2 22 . 1 A PHE 10 CB 1 A THR 38 CB 'upper bound' . 8.000 1.000 by-feature 2 2 23 . 1 A LEU 144 CB 1 A PRO 183 CB 'upper bound' . 8.000 1.000 by-feature 2 2 24 . 1 A ALA 14 CB 1 A THR 38 CB 'upper bound' . 8.000 1.000 by-feature 2 2 25 . 1 A ASN 94 CB 1 A ALA 106 CB 'upper bound' . 8.000 1.000 by-feature 2 2 26 . 1 A LEU 130 CB 1 A LEU 145 CB 'upper bound' . 8.000 1.000 by-feature 2 2 27 . 1 A PHE 129 CB 1 A LEU 156 CB 'upper bound' . 8.000 1.000 by-feature 2 2 28 . 1 A VAL 109 CB 1 A TYR 169 CB 'upper bound' . 8.000 1.000 by-feature 2 2 29 . 1 A GLY 127 CA 1 A ALA 149 CB 'upper bound' . 8.000 1.000 by-feature 2 2 30 . 1 A LYS 122 CB 1 A GLU 157 CB 'upper bound' . 8.000 1.000 by-feature 2 2 31 . 1 A CYS 115 CB 1 A CYS 159 CB 'upper bound' . 8.000 1.000 by-feature 2 2 32 . 1 A LEU 126 CB 1 A ALA 149 CB 'upper bound' . 8.000 1.000 by-feature 2 2 33 . 1 A HIS 46 CB 1 A TYR 62 CB 'upper bound' . 8.000 1.000 by-feature 2 2 34 . 1 A ALA 105 CB 1 A TYR 118 CB 'upper bound' . 8.000 1.000 by-feature 2 2 35 . 1 A ALA 60 CB 1 A VAL 92 CB 'upper bound' . 8.000 1.000 by-feature 2 2 36 . 1 A LEU 130 CB 1 A LEU 148 CB 'upper bound' . 8.000 1.000 by-feature 2 2 37 . 1 A TYR 133 CB 1 A VAL 180 CB 'upper bound' . 8.000 1.000 by-feature 2 2 38 . 1 A TYR 133 CB 1 A ALA 149 CB 'upper bound' . 8.000 1.000 by-feature 2 2 39 . 1 A PHE 125 CB 1 A GLU 153 CB 'upper bound' . 8.000 1.000 by-feature 2 2 40 . 1 A LEU 130 CB 1 A VAL 142 CB 'upper bound' . 8.000 1.000 by-feature 2 2 41 . 1 A ALA 60 CB 1 A ILE 89 CB 'upper bound' . 8.000 1.000 by-feature 2 2 42 . 1 A LEU 74 CB 1 A VAL 92 CB 'upper bound' . 8.000 1.000 by-feature 2 2 43 . 1 A PHE 10 CB 1 A HIS 41 CB 'upper bound' . 8.000 1.000 by-feature 2 2 44 . 1 A THR 155 CB 1 A PHE 176 CB 'upper bound' . 8.000 1.000 by-feature 2 2 45 . 1 A PHE 125 CB 1 A LEU 156 CB 'upper bound' . 8.000 1.000 by-feature 2 2 46 . 1 A HIS 137 CB 1 A VAL 180 CB 'upper bound' . 8.000 1.000 by-feature 2 2 47 . 1 A THR 155 CB 1 A GLU 175 CB 'upper bound' . 8.000 1.000 by-feature 2 2 48 . 1 A CYS 64 CB 1 A CYS 77 CB 'upper bound' . 8.000 1.000 by-feature 2 2 49 . 1 A ALA 60 CB 1 A SER 86 CB 'upper bound' . 8.000 1.000 by-feature 2 2 50 . 1 A GLU 76 CB 1 A ALA 90 CB 'upper bound' . 8.000 1.000 by-feature 2 2 51 . 1 A CYS 115 CB 1 A MET 128 CB 'upper bound' . 8.000 1.000 by-feature 2 2 52 . 1 A LYS 39 CB 1 A ASP 55 CB 'upper bound' . 8.000 1.000 by-feature 2 2 53 . 1 A LEU 18 CB 1 A LEU 33 CB 'upper bound' . 8.000 1.000 by-feature 2 2 54 . 1 A PHE 129 CB 1 A ALA 149 CB 'upper bound' . 8.000 1.000 by-feature 2 2 55 . 1 A LEU 130 CB 1 A LEU 146 CB 'upper bound' . 8.000 1.000 by-feature 2 2 56 . 1 A LEU 104 CB 1 A PHE 129 CB 'upper bound' . 8.000 1.000 by-feature 2 2 57 . 1 A LEU 37 CB 1 A LEU 49 CB 'upper bound' . 8.000 1.000 by-feature 2 2 58 . 1 A GLU 7 CB 1 A THR 38 CB 'upper bound' . 8.000 1.000 by-feature 2 2 59 . 1 A ALA 14 CB 1 A LEU 50 CB 'upper bound' . 8.000 1.000 by-feature 2 2 60 . 1 A VAL 15 CB 1 A SER 31 CB 'upper bound' . 8.000 1.000 by-feature 2 2 61 . 1 A LEU 126 CB 1 A LEU 156 CB 'upper bound' . 8.000 1.000 by-feature 2 2 62 . 1 A ALA 14 CB 1 A LEU 33 CB 'upper bound' . 8.000 1.000 by-feature 2 2 63 . 1 A LYS 11 CB 1 A THR 38 CB 'upper bound' . 8.000 1.000 by-feature 2 2 64 . 1 A VAL 40 CB 1 A ARG 56 CB 'upper bound' . 8.000 1.000 by-feature 2 2 65 . 1 A VAL 15 CB 1 A VAL 34 CB 'upper bound' . 8.000 1.000 by-feature 2 2 66 . 1 A LEU 18 CB 1 A VAL 34 CB 'upper bound' . 8.000 1.000 by-feature 2 2 67 . 1 A LEU 33 CB 1 A LEU 59 CB 'upper bound' . 8.000 1.000 by-feature 2 2 68 . 1 A THR 155 CB 1 A LEU 179 CB 'upper bound' . 8.000 1.000 by-feature 2 2 69 . 1 A LYS 73 CB 1 A VAL 92 CB 'upper bound' . 8.000 1.000 by-feature 2 2 70 . 1 A CYS 115 CB 1 A PRO 165 CB 'upper bound' . 8.000 1.000 by-feature 2 2 71 . 1 A ALA 60 CB 1 A CYS 78 CB 'upper bound' . 8.000 1.000 by-feature 2 2 72 . 1 A LEU 126 CB 1 A GLU 153 CB 'upper bound' . 8.000 1.000 by-feature 2 2 73 . 1 A ALA 14 CB 1 A VAL 34 CB 'upper bound' . 8.000 1.000 by-feature 2 2 74 . 1 A PHE 129 CB 1 A TYR 152 CB 'upper bound' . 8.000 1.000 by-feature 2 2 75 . 1 A TYR 133 CB 1 A LEU 145 CB 'upper bound' . 8.000 1.000 by-feature 2 2 76 . 1 A TYR 152 CB 1 A PHE 176 CB 'upper bound' . 8.000 1.000 by-feature 2 2 77 . 1 A THR 155 CB 1 A VAL 172 CB 'upper bound' . 8.000 1.000 by-feature 2 2 78 . 1 A ASP 36 CB 1 A LEU 59 CB 'upper bound' . 8.000 1.000 by-feature 2 2 79 . 1 A LEU 74 CB 1 A CYS 88 CB 'upper bound' . 8.000 1.000 by-feature 2 2 80 . 1 A VAL 109 CB 1 A VAL 124 CB 'upper bound' . 8.000 1.000 by-feature 2 2 81 . 1 A CYS 115 CB 1 A CYS 160 CB 'upper bound' . 8.000 1.000 by-feature 2 2 82 . 1 A LEU 130 CB 1 A TYR 152 CB 'upper bound' . 8.000 1.000 by-feature 2 2 83 . 1 A LYS 158 CB 1 A VAL 172 CB 'upper bound' . 8.000 1.000 by-feature 2 2 84 . 1 A LYS 112 CB 1 A PRO 165 CB 'upper bound' . 8.000 1.000 by-feature 2 2 85 . 1 A LEU 130 CB 1 A ALA 149 CB 'upper bound' . 8.000 1.000 by-feature 2 2 86 . 1 A ARG 56 CB 1 A VAL 92 CB 'upper bound' . 8.000 1.000 by-feature 2 2 87 . 1 A LYS 122 CB 1 A LEU 156 CB 'upper bound' . 8.000 1.000 by-feature 2 2 88 . 1 A TYR 133 CB 1 A LEU 148 CB 'upper bound' . 8.000 1.000 by-feature 2 2 89 . 1 A LEU 148 CB 1 A VAL 180 CB 'upper bound' . 8.000 1.000 by-feature 2 2 90 . 1 A LEU 148 CB 1 A LEU 179 CB 'upper bound' . 8.000 1.000 by-feature 2 2 91 . 1 A CYS 77 CB 1 A ILE 89 CB 'upper bound' . 8.000 1.000 by-feature 2 2 92 . 1 A LEU 101 CB 1 A TYR 118 CB 'upper bound' . 8.000 1.000 by-feature 2 2 93 . 1 A LEU 156 CB 1 A VAL 172 CB 'upper bound' . 8.000 1.000 by-feature 2 2 94 . 1 A LYS 11 CB 1 A VAL 34 CB 'upper bound' . 8.000 1.000 by-feature 2 2 95 . 1 A LYS 122 CB 1 A GLU 153 CB 'upper bound' . 8.000 1.000 by-feature 2 2 # # loop_ _ihm_model_list.model_id _ihm_model_list.model_name _ihm_model_list.assembly_id _ihm_model_list.protocol_id _ihm_model_list.representation_id 1 'Best scoring model (domain B)' 1 1 1 2 '2nd best scoring model (domain B)' 1 1 1 3 '3rd best scoring model (domain B)' 1 1 1 4 '4th best scoring model (domain B)' 1 1 1 5 '5th best scoring model (domain B)' 1 1 1 # # _ihm_model_representative.id 1 _ihm_model_representative.model_group_id 1 _ihm_model_representative.model_id 1 _ihm_model_representative.selection_criteria "best scoring model" # # loop_ _ihm_model_group.id _ihm_model_group.name _ihm_model_group.details 1 'Domain B' . # # loop_ _ihm_model_group_link.group_id _ihm_model_group_link.model_id 1 1 1 2 1 3 1 4 1 5 # # loop_ ##