data_9A1H # _entry.id 9A1H # _struct.entry_id 9A1H _struct.pdbx_CASP_flag . _struct.pdbx_descriptor . _struct.pdbx_details . _struct.pdbx_model_details . _struct.pdbx_model_type_details . _struct.title 'Integrative structural model of alpha-synuclein compact states bound to membrane mimics' _struct.pdbx_structure_determination_methodology integrative # loop_ _audit_conform.dict_location _audit_conform.dict_name _audit_conform.dict_version https://mmcif.wwpdb.org/dictionaries/ascii/mmcif_ihm_ext.dic mmcif_ihm_ext.dic 1.26 http://mmcif.wwpdb.org/dictionaries/ascii/mmcif_pdbx_v50.dic mmcif_pdbx.dic 5.395 # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB-Dev PDBDEV_00000089 PDBDEV_00000089 ? PDB 9A1H pdb_00009a1h 10.2210/pdb9a1h/pdb # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 9A1H _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2021-07-28 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2023-04-28 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _atom_type.symbol C H N O S # loop_ _audit_author.name _audit_author.pdbx_ordinal "Schwarz, Thomas C." 1 "Beier, Andreas" 2 "Ledolter, Karin" 3 "Gossenreiter, Thomas" 4 "Hofurthner, Theresa" 5 "Hartl, Markus" 6 "Baker, Terry S." 7 "Taylor, Richard J." 8 "Konrat, Robert" 9 # loop_ _chem_comp.formula _chem_comp.formula_weight _chem_comp.id _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.type "C3 H7 N O2" 89.094 ALA . ALANINE . "L-peptide linking" "C4 H8 N2 O3" 132.119 ASN . ASPARAGINE . "L-peptide linking" "C4 H7 N O4" 133.103 ASP . "ASPARTIC ACID" . "L-peptide linking" "C3 H7 N O2 S" 121.154 CYS . CYSTEINE . "L-peptide linking" "C5 H10 N2 O3" 146.146 GLN . GLUTAMINE . "L-peptide linking" "C5 H9 N O4" 147.13 GLU . "GLUTAMIC ACID" . "L-peptide linking" "C2 H5 N O2" 75.067 GLY . GLYCINE . "peptide linking" "C6 H10 N3 O2 1" 156.165 HIS . HISTIDINE . "L-peptide linking" "C6 H13 N O2" 131.175 ILE . ISOLEUCINE . "L-peptide linking" "C6 H13 N O2" 131.175 LEU . LEUCINE . "L-peptide linking" "C6 H15 N2 O2 1" 147.198 LYS . LYSINE . "L-peptide linking" "C5 H11 N O2 S" 149.208 MET . METHIONINE . "L-peptide linking" "C9 H11 N O2" 165.192 PHE . PHENYLALANINE . "L-peptide linking" "C5 H9 N O2" 115.132 PRO . PROLINE . "L-peptide linking" "C3 H7 N O3" 105.093 SER . SERINE . "L-peptide linking" "C4 H9 N O3" 119.12 THR . THREONINE . "L-peptide linking" "C9 H11 N O3" 181.191 TYR . TYROSINE . "L-peptide linking" "C5 H11 N O2" 117.148 VAL . VALINE . "L-peptide linking" # loop_ _citation.country _citation.id _citation.journal_abbrev _citation.journal_id_ASTM _citation.journal_id_CSD _citation.journal_id_ISSN _citation.journal_issue _citation.journal_volume _citation.page_first _citation.page_last _citation.pdbx_database_id_DOI _citation.pdbx_database_id_PubMed _citation.title _citation.year . 1 "Proc. Natl. Acad. Sci. U. S. A." . . . 15 120 e2201910120 e2201910120 10.1073/pnas.2201910120 37027427 "High-resolution structural information of membrane-bound alpha-synuclein provides insight into the MoA of the anti-Parkinson drug UCB0599" 2023 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal 1 "Schwarz, Thomas C." 1 1 "Beier, Andreas" 2 1 "Ledolter, Karin" 3 1 "Gossenreiter, Thomas" 4 1 "Hofurthner, Theresa" 5 1 "Hartl, Markus" 6 1 "Baker, Terry S." 7 1 "Taylor, Richard J." 8 1 "Konrat, Robert" 9 # loop_ _entity.details _entity.formula_weight _entity.id _entity.pdbx_description _entity.pdbx_number_of_molecules _entity.src_method _entity.type . 13048.554 1 alpha-synuclein 1 man polymer # loop_ _entity_name_com.entity_id _entity_name_com.name 1 alpha-synuclein # loop_ _entity_poly.entity_id _entity_poly.nstd_chirality _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_sequence_evidence_code _entity_poly.pdbx_strand_id _entity_poly.type 1 . no no MDVFMKGLSKAKEGVVAACEKTKQGVAEAAGKTKEGVLYVGCKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKCVEGAGSIAAATGFVKKDQLGKNCEGAPQE MDVFMKGLSKAKEGVVAACEKTKQGVAEAAGKTKEGVLYVGCKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKCVEGAGSIAAATGFVKKDQLGKNCEGAPQE . A polypeptide(L) # loop_ _entity_poly_seq.entity_id _entity_poly_seq.hetero _entity_poly_seq.mon_id _entity_poly_seq.num 1 . MET 1 1 . ASP 2 1 . VAL 3 1 . PHE 4 1 . MET 5 1 . LYS 6 1 . GLY 7 1 . LEU 8 1 . SER 9 1 . LYS 10 1 . ALA 11 1 . LYS 12 1 . GLU 13 1 . GLY 14 1 . VAL 15 1 . VAL 16 1 . ALA 17 1 . ALA 18 1 . CYS 19 1 . GLU 20 1 . LYS 21 1 . THR 22 1 . LYS 23 1 . GLN 24 1 . GLY 25 1 . VAL 26 1 . ALA 27 1 . GLU 28 1 . ALA 29 1 . ALA 30 1 . GLY 31 1 . LYS 32 1 . THR 33 1 . LYS 34 1 . GLU 35 1 . GLY 36 1 . VAL 37 1 . LEU 38 1 . TYR 39 1 . VAL 40 1 . GLY 41 1 . CYS 42 1 . LYS 43 1 . THR 44 1 . LYS 45 1 . GLU 46 1 . GLY 47 1 . VAL 48 1 . VAL 49 1 . HIS 50 1 . GLY 51 1 . VAL 52 1 . ALA 53 1 . THR 54 1 . VAL 55 1 . ALA 56 1 . GLU 57 1 . LYS 58 1 . THR 59 1 . LYS 60 1 . GLU 61 1 . GLN 62 1 . VAL 63 1 . THR 64 1 . ASN 65 1 . VAL 66 1 . GLY 67 1 . GLY 68 1 . ALA 69 1 . VAL 70 1 . VAL 71 1 . THR 72 1 . GLY 73 1 . VAL 74 1 . THR 75 1 . ALA 76 1 . VAL 77 1 . ALA 78 1 . GLN 79 1 . LYS 80 1 . CYS 81 1 . VAL 82 1 . GLU 83 1 . GLY 84 1 . ALA 85 1 . GLY 86 1 . SER 87 1 . ILE 88 1 . ALA 89 1 . ALA 90 1 . ALA 91 1 . THR 92 1 . GLY 93 1 . PHE 94 1 . VAL 95 1 . LYS 96 1 . LYS 97 1 . ASP 98 1 . GLN 99 1 . LEU 100 1 . GLY 101 1 . LYS 102 1 . ASN 103 1 . CYS 104 1 . GLU 105 1 . GLY 106 1 . ALA 107 1 . PRO 108 1 . GLN 109 1 . GLU 110 # loop_ _ihm_chemical_component_descriptor.auth_name _ihm_chemical_component_descriptor.chemical_name _ihm_chemical_component_descriptor.common_name _ihm_chemical_component_descriptor.details _ihm_chemical_component_descriptor.id _ihm_chemical_component_descriptor.inchi _ihm_chemical_component_descriptor.inchi_key _ihm_chemical_component_descriptor.smiles _ihm_chemical_component_descriptor.smiles_canonical MTSL (1-Oxyl-2,2,5,5-tetramethylpyrroline-3-methyl)methanethiosulfonate MTSL "Paramagnetic spin probe" 1 1S/C10H18NO3S2/c1-9(2)6-8(7-15-16(5,13)14)10(3,4)11(9)12/h6H,7H2,1-5H3 BLSCGBLQCTWVPO-UHFFFAOYSA-N . CC1(C=C(C(N1[O])(C)C)CSS(=O)(=O)C)C EDC 1-Ethyl-3-(3-dimethylaminopropyl)carbodiimide EDC "Zero-length cross linker" 2 1S/C8H17N3/c1-4-9-8-10-6-5-7-11(2)3/h4-7H2,1-3H3 LMDZBCPBFSXMTL-UHFFFAOYSA-N . CCN=C=NCCCN(C)C # loop_ _ihm_cross_link_list.comp_id_1 _ihm_cross_link_list.comp_id_2 _ihm_cross_link_list.dataset_list_id _ihm_cross_link_list.details _ihm_cross_link_list.entity_description_1 _ihm_cross_link_list.entity_description_2 _ihm_cross_link_list.entity_id_1 _ihm_cross_link_list.entity_id_2 _ihm_cross_link_list.group_id _ihm_cross_link_list.id _ihm_cross_link_list.linker_chem_comp_descriptor_id _ihm_cross_link_list.linker_type _ihm_cross_link_list.seq_id_1 _ihm_cross_link_list.seq_id_2 GLU LYS 1 . . . 1 1 1 1 2 EDC 57 96 GLU LYS 1 . . . 1 1 1 2 2 EDC 57 97 GLU LYS 1 . . . 1 1 1 3 2 EDC 61 97 LYS GLU 1 . . . 1 1 2 4 2 EDC 10 57 GLU LYS 1 . . . 1 1 2 5 2 EDC 13 60 GLU LYS 1 . . . 1 1 3 6 2 EDC 28 45 # loop_ _ihm_cross_link_restraint.asym_id_1 _ihm_cross_link_restraint.asym_id_2 _ihm_cross_link_restraint.atom_id_1 _ihm_cross_link_restraint.atom_id_2 _ihm_cross_link_restraint.comp_id_1 _ihm_cross_link_restraint.comp_id_2 _ihm_cross_link_restraint.conditional_crosslink_flag _ihm_cross_link_restraint.distance_threshold _ihm_cross_link_restraint.entity_id_1 _ihm_cross_link_restraint.entity_id_2 _ihm_cross_link_restraint.group_id _ihm_cross_link_restraint.id _ihm_cross_link_restraint.model_granularity _ihm_cross_link_restraint.pseudo_site_flag _ihm_cross_link_restraint.psi _ihm_cross_link_restraint.restraint_type _ihm_cross_link_restraint.seq_id_1 _ihm_cross_link_restraint.seq_id_2 _ihm_cross_link_restraint.sigma_1 _ihm_cross_link_restraint.sigma_2 A B . . GLU LYS ANY 3 1 1 1 1 by-residue No . harmonic 57 96 . . B A . . GLU LYS ANY 3 1 1 1 2 by-residue No . harmonic 57 96 . . A B . . GLU LYS ANY 3 1 1 2 3 by-residue No . harmonic 57 97 . . B A . . GLU LYS ANY 3 1 1 2 4 by-residue No . harmonic 57 97 . . A B . . GLU LYS ANY 3 1 1 3 5 by-residue No . harmonic 61 97 . . B A . . GLU LYS ANY 3 1 1 3 6 by-residue No . harmonic 61 97 . . A B . . LYS GLU ANY 3 1 1 4 7 by-residue No . harmonic 10 57 . . B A . . LYS GLU ANY 3 1 1 4 8 by-residue No . harmonic 10 57 . . A B . . GLU LYS ANY 3 1 1 5 9 by-residue No . harmonic 13 60 . . B A . . GLU LYS ANY 3 1 1 5 10 by-residue No . harmonic 13 60 . . A B . . GLU LYS ANY 3 1 1 6 11 by-residue No . harmonic 28 45 . . B A . . GLU LYS ANY 3 1 1 6 12 by-residue No . harmonic 28 45 . . # loop_ _ihm_dataset_group.application _ihm_dataset_group.details _ihm_dataset_group.id _ihm_dataset_group.name restraint . 1 "Simulated annealing restraints" # loop_ _ihm_dataset_group_link.dataset_list_id _ihm_dataset_group_link.group_id 1 1 2 1 # loop_ _ihm_dataset_list.data_type _ihm_dataset_list.database_hosted _ihm_dataset_list.details _ihm_dataset_list.id "Crosslinking-MS data" YES . 1 "NMR data" YES . 2 # loop_ _ihm_dataset_related_db_reference.accession_code _ihm_dataset_related_db_reference.dataset_list_id _ihm_dataset_related_db_reference.db_name _ihm_dataset_related_db_reference.details _ihm_dataset_related_db_reference.id _ihm_dataset_related_db_reference.version PXD027349 1 PRIDE . 1 . 50996 2 BMRB . 2 . # loop_ _ihm_entity_poly_segment.comp_id_begin _ihm_entity_poly_segment.comp_id_end _ihm_entity_poly_segment.entity_id _ihm_entity_poly_segment.id _ihm_entity_poly_segment.seq_id_begin _ihm_entity_poly_segment.seq_id_end MET GLU 1 1 1 110 # loop_ _ihm_model_group.details _ihm_model_group.id _ihm_model_group.name "Dimer models generated by incorporating CX-MS restraints" 1 Dimers "Monomer models generated by PRE, PRI and dihedral restraints" 2 Monomers # loop_ _ihm_model_group_link.group_id _ihm_model_group_link.model_id 1 1 1 2 2 3 2 4 2 5 # loop_ _ihm_model_list.assembly_id _ihm_model_list.model_id _ihm_model_list.model_name _ihm_model_list.protocol_id _ihm_model_list.representation_id 1 1 . 1 1 1 2 . 1 1 1 3 . 1 1 1 4 . 1 1 1 5 . 1 1 # loop_ _ihm_model_representation.details _ihm_model_representation.id _ihm_model_representation.name . 1 . # loop_ _ihm_model_representation_details.description _ihm_model_representation_details.entity_asym_id _ihm_model_representation_details.entity_description _ihm_model_representation_details.entity_id _ihm_model_representation_details.entity_poly_segment_id _ihm_model_representation_details.id _ihm_model_representation_details.model_granularity _ihm_model_representation_details.model_mode _ihm_model_representation_details.model_object_count _ihm_model_representation_details.model_object_primitive _ihm_model_representation_details.representation_id _ihm_model_representation_details.starting_model_id . A . 1 1 1 by-atom flexible . atomistic 1 . . B . 1 1 2 by-atom flexible . atomistic 1 . # loop_ _ihm_modeling_post_process.analysis_id _ihm_modeling_post_process.dataset_group_id _ihm_modeling_post_process.details _ihm_modeling_post_process.feature _ihm_modeling_post_process.feature_name _ihm_modeling_post_process.id _ihm_modeling_post_process.num_models_begin _ihm_modeling_post_process.num_models_end _ihm_modeling_post_process.protocol_id _ihm_modeling_post_process.script_file_id _ihm_modeling_post_process.software_id _ihm_modeling_post_process.step_id _ihm_modeling_post_process.struct_assembly_id _ihm_modeling_post_process.type 1 1 . energy/score "total energy" 1 2700 100 1 . . 1 1 filter 1 1 . RMSD "CA rmsd" 2 100 3 1 . . 2 1 cluster 1 1 . energy/score "total energy" 3 1500 100 2 . . 1 1 filter 1 1 . RMSD "CA rmsd" 4 100 2 2 . . 2 1 cluster # loop_ _ihm_modeling_protocol.details _ihm_modeling_protocol.id _ihm_modeling_protocol.num_steps _ihm_modeling_protocol.protocol_name "Simulated annealing of monomer structures using PRE (Paramagnetic Relaxation Enhancement), PRI (Paramagnetic Relaxation Interference) and dihedral (via shift based Secondary Structure Propensity) restrains" 1 1 "Modeling of monomer structures based on intramolecular restraints" "Simulated annealing of pregenerated monomer structures with the addition of CX-MS data as intermolecular restraints" 2 1 "Modeling of dimers based on intermolecular restraints" # loop_ _ihm_modeling_protocol_details.dataset_group_id _ihm_modeling_protocol_details.description _ihm_modeling_protocol_details.ensemble_flag _ihm_modeling_protocol_details.id _ihm_modeling_protocol_details.multi_scale_flag _ihm_modeling_protocol_details.multi_state_flag _ihm_modeling_protocol_details.num_models_begin _ihm_modeling_protocol_details.num_models_end _ihm_modeling_protocol_details.ordered_flag _ihm_modeling_protocol_details.protocol_id _ihm_modeling_protocol_details.script_file_id _ihm_modeling_protocol_details.software_id _ihm_modeling_protocol_details.step_id _ihm_modeling_protocol_details.step_method _ihm_modeling_protocol_details.step_name _ihm_modeling_protocol_details.struct_assembly_description _ihm_modeling_protocol_details.struct_assembly_id 1 . YES 1 NO NO 0 2700 NO 1 . 1 1 "Simulated Annealing" "Simulated annealing of the monomer" Monomer 1 1 . YES 2 NO NO 3 1500 NO 2 . 1 1 "Simulated Annealing" "Simulated annealing of the dimer" Dimer 1 # loop_ _ihm_poly_probe_conjugate.ambiguous_stoichiometry_flag _ihm_poly_probe_conjugate.chem_comp_descriptor_id _ihm_poly_probe_conjugate.dataset_list_id _ihm_poly_probe_conjugate.details _ihm_poly_probe_conjugate.id _ihm_poly_probe_conjugate.position_id _ihm_poly_probe_conjugate.probe_id _ihm_poly_probe_conjugate.probe_stoichiometry . 1 2 . 1 1 1 . . 1 2 . 2 2 1 . . 1 2 . 3 3 1 . . 1 2 . 4 4 1 . # loop_ _ihm_poly_probe_position.comp_id _ihm_poly_probe_position.description _ihm_poly_probe_position.entity_description _ihm_poly_probe_position.entity_id _ihm_poly_probe_position.id _ihm_poly_probe_position.mod_res_chem_comp_descriptor_id _ihm_poly_probe_position.modification_flag _ihm_poly_probe_position.mut_res_chem_comp_id _ihm_poly_probe_position.mutation_flag _ihm_poly_probe_position.seq_id CYS "MTSL attached to Cystein sidechain" "MTSL attached to Cystein sidechain" 1 1 1 yes CYS yes 19 CYS "MTSL attached to Cystein sidechain" "MTSL attached to Cystein sidechain" 1 2 1 yes CYS yes 42 CYS "MTSL attached to Cystein sidechain" "MTSL attached to Cystein sidechain" 1 3 1 yes CYS yes 81 CYS "MTSL attached to Cystein sidechain" "MTSL attached to Cystein sidechain" 1 4 1 yes CYS yes 104 # loop_ _ihm_probe_list.probe_chem_comp_descriptor_id _ihm_probe_list.probe_id _ihm_probe_list.probe_link_type _ihm_probe_list.probe_name _ihm_probe_list.probe_origin _ihm_probe_list.reactive_probe_chem_comp_descriptor_id _ihm_probe_list.reactive_probe_flag _ihm_probe_list.reactive_probe_name 1 1 covalent MTSL extrinsic . . . 2 2 covalent EDC extrinsic . . . # loop_ _ihm_struct_assembly.description _ihm_struct_assembly.id _ihm_struct_assembly.name "Integrative structure of alpha-synuclein based on restraints dervied from chemical crosslinking data" 1 "Alpha-synuclein" # loop_ _ihm_struct_assembly_details.assembly_id _ihm_struct_assembly_details.asym_id _ihm_struct_assembly_details.entity_description _ihm_struct_assembly_details.entity_id _ihm_struct_assembly_details.entity_poly_segment_id _ihm_struct_assembly_details.id _ihm_struct_assembly_details.parent_assembly_id 1 A . 1 1 1 1 1 B . 1 1 2 1 # loop_ _software.citation_id _software.classification _software.description _software.location _software.name _software.pdbx_ordinal _software.type _software.version . "structure determination program" . https://nmr.cit.nih.gov/xplor-nih/ XPLOR-NIH 1 program 1.49 # loop_ _struct_asym.details _struct_asym.entity_id _struct_asym.id _struct_asym.pdbx_PDB_id _struct_asym.pdbx_alt_id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.pdbx_order _struct_asym.pdbx_type . 1 A . . . . . . . 1 B . . . . . . # loop_ _struct_ref.db_code _struct_ref.db_name _struct_ref.details _struct_ref.entity_id _struct_ref.id _struct_ref.pdbx_align_begin _struct_ref.pdbx_db_accession _struct_ref.pdbx_seq_one_letter_code SYUA_HUMAN UNP . 1 1 1 P37840 . # loop_ _struct_ref_seq.align_id _struct_ref_seq.db_align_beg _struct_ref_seq.db_align_end _struct_ref_seq.ref_id _struct_ref_seq.seq_align_beg _struct_ref_seq.seq_align_end 1 1 110 1 1 110 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.details _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_ordinal _struct_ref_seq_dif.seq_num 1 ALA . CYS 1 19 1 SER . CYS 2 42 1 THR . CYS 3 81 1 GLU . CYS 4 104 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id A 1 1 MET 1 1 MET MET A A 1 2 ASP 2 2 ASP ASP A A 1 3 VAL 3 3 VAL VAL A A 1 4 PHE 4 4 PHE PHE A A 1 5 MET 5 5 MET MET A A 1 6 LYS 6 6 LYS LYS A A 1 7 GLY 7 7 GLY GLY A A 1 8 LEU 8 8 LEU LEU A A 1 9 SER 9 9 SER SER A A 1 10 LYS 10 10 LYS LYS A A 1 11 ALA 11 11 ALA ALA A A 1 12 LYS 12 12 LYS LYS A A 1 13 GLU 13 13 GLU GLU A A 1 14 GLY 14 14 GLY GLY A A 1 15 VAL 15 15 VAL VAL A A 1 16 VAL 16 16 VAL VAL A A 1 17 ALA 17 17 ALA ALA A A 1 18 ALA 18 18 ALA ALA A A 1 19 CYS 19 19 CYS CYS A A 1 20 GLU 20 20 GLU GLU A A 1 21 LYS 21 21 LYS LYS A A 1 22 THR 22 22 THR THR A A 1 23 LYS 23 23 LYS LYS A A 1 24 GLN 24 24 GLN GLN A A 1 25 GLY 25 25 GLY GLY A A 1 26 VAL 26 26 VAL VAL A A 1 27 ALA 27 27 ALA ALA A A 1 28 GLU 28 28 GLU GLU A A 1 29 ALA 29 29 ALA ALA A A 1 30 ALA 30 30 ALA ALA A A 1 31 GLY 31 31 GLY GLY A A 1 32 LYS 32 32 LYS LYS A A 1 33 THR 33 33 THR THR A A 1 34 LYS 34 34 LYS LYS A A 1 35 GLU 35 35 GLU GLU A A 1 36 GLY 36 36 GLY GLY A A 1 37 VAL 37 37 VAL VAL A A 1 38 LEU 38 38 LEU LEU A A 1 39 TYR 39 39 TYR TYR A A 1 40 VAL 40 40 VAL VAL A A 1 41 GLY 41 41 GLY GLY A A 1 42 CYS 42 42 CYS CYS A A 1 43 LYS 43 43 LYS LYS A A 1 44 THR 44 44 THR THR A A 1 45 LYS 45 45 LYS LYS A A 1 46 GLU 46 46 GLU GLU A A 1 47 GLY 47 47 GLY GLY A A 1 48 VAL 48 48 VAL VAL A A 1 49 VAL 49 49 VAL VAL A A 1 50 HIS 50 50 HIS HIS A A 1 51 GLY 51 51 GLY GLY A A 1 52 VAL 52 52 VAL VAL A A 1 53 ALA 53 53 ALA ALA A A 1 54 THR 54 54 THR THR A A 1 55 VAL 55 55 VAL VAL A A 1 56 ALA 56 56 ALA ALA A A 1 57 GLU 57 57 GLU GLU A A 1 58 LYS 58 58 LYS LYS A A 1 59 THR 59 59 THR THR A A 1 60 LYS 60 60 LYS LYS A A 1 61 GLU 61 61 GLU GLU A A 1 62 GLN 62 62 GLN GLN A A 1 63 VAL 63 63 VAL VAL A A 1 64 THR 64 64 THR THR A A 1 65 ASN 65 65 ASN ASN A A 1 66 VAL 66 66 VAL VAL A A 1 67 GLY 67 67 GLY GLY A A 1 68 GLY 68 68 GLY GLY A A 1 69 ALA 69 69 ALA ALA A A 1 70 VAL 70 70 VAL VAL A A 1 71 VAL 71 71 VAL VAL A A 1 72 THR 72 72 THR THR A A 1 73 GLY 73 73 GLY GLY A A 1 74 VAL 74 74 VAL VAL A A 1 75 THR 75 75 THR THR A A 1 76 ALA 76 76 ALA ALA A A 1 77 VAL 77 77 VAL VAL A A 1 78 ALA 78 78 ALA ALA A A 1 79 GLN 79 79 GLN GLN A A 1 80 LYS 80 80 LYS LYS A A 1 81 CYS 81 81 CYS CYS A A 1 82 VAL 82 82 VAL VAL A A 1 83 GLU 83 83 GLU GLU A A 1 84 GLY 84 84 GLY GLY A A 1 85 ALA 85 85 ALA ALA A A 1 86 GLY 86 86 GLY GLY A A 1 87 SER 87 87 SER SER A A 1 88 ILE 88 88 ILE ILE A A 1 89 ALA 89 89 ALA ALA A A 1 90 ALA 90 90 ALA ALA A A 1 91 ALA 91 91 ALA ALA A A 1 92 THR 92 92 THR THR A A 1 93 GLY 93 93 GLY GLY A A 1 94 PHE 94 94 PHE PHE A A 1 95 VAL 95 95 VAL VAL A A 1 96 LYS 96 96 LYS LYS A A 1 97 LYS 97 97 LYS LYS A A 1 98 ASP 98 98 ASP ASP A A 1 99 GLN 99 99 GLN GLN A A 1 100 LEU 100 100 LEU LEU A A 1 101 GLY 101 101 GLY GLY A A 1 102 LYS 102 102 LYS LYS A A 1 103 ASN 103 103 ASN ASN A A 1 104 CYS 104 104 CYS CYS A A 1 105 GLU 105 105 GLU GLU A A 1 106 GLY 106 106 GLY GLY A A 1 107 ALA 107 107 ALA ALA A A 1 108 PRO 108 108 PRO PRO A A 1 109 GLN 109 109 GLN GLN A A 1 110 GLU 110 110 GLU GLU A B 1 1 MET 1 1 MET MET B B 1 2 ASP 2 2 ASP ASP B B 1 3 VAL 3 3 VAL VAL B B 1 4 PHE 4 4 PHE PHE B B 1 5 MET 5 5 MET MET B B 1 6 LYS 6 6 LYS LYS B B 1 7 GLY 7 7 GLY GLY B B 1 8 LEU 8 8 LEU LEU B B 1 9 SER 9 9 SER SER B B 1 10 LYS 10 10 LYS LYS B B 1 11 ALA 11 11 ALA ALA B B 1 12 LYS 12 12 LYS LYS B B 1 13 GLU 13 13 GLU GLU B B 1 14 GLY 14 14 GLY GLY B B 1 15 VAL 15 15 VAL VAL B B 1 16 VAL 16 16 VAL VAL B B 1 17 ALA 17 17 ALA ALA B B 1 18 ALA 18 18 ALA ALA B B 1 19 CYS 19 19 CYS CYS B B 1 20 GLU 20 20 GLU GLU B B 1 21 LYS 21 21 LYS LYS B B 1 22 THR 22 22 THR THR B B 1 23 LYS 23 23 LYS LYS B B 1 24 GLN 24 24 GLN GLN B B 1 25 GLY 25 25 GLY GLY B B 1 26 VAL 26 26 VAL VAL B B 1 27 ALA 27 27 ALA ALA B B 1 28 GLU 28 28 GLU GLU B B 1 29 ALA 29 29 ALA ALA B B 1 30 ALA 30 30 ALA ALA B B 1 31 GLY 31 31 GLY GLY B B 1 32 LYS 32 32 LYS LYS B B 1 33 THR 33 33 THR THR B B 1 34 LYS 34 34 LYS LYS B B 1 35 GLU 35 35 GLU GLU B B 1 36 GLY 36 36 GLY GLY B B 1 37 VAL 37 37 VAL VAL B B 1 38 LEU 38 38 LEU LEU B B 1 39 TYR 39 39 TYR TYR B B 1 40 VAL 40 40 VAL VAL B B 1 41 GLY 41 41 GLY GLY B B 1 42 CYS 42 42 CYS CYS B B 1 43 LYS 43 43 LYS LYS B B 1 44 THR 44 44 THR THR B B 1 45 LYS 45 45 LYS LYS B B 1 46 GLU 46 46 GLU GLU B B 1 47 GLY 47 47 GLY GLY B B 1 48 VAL 48 48 VAL VAL B B 1 49 VAL 49 49 VAL VAL B B 1 50 HIS 50 50 HIS HIS B B 1 51 GLY 51 51 GLY GLY B B 1 52 VAL 52 52 VAL VAL B B 1 53 ALA 53 53 ALA ALA B B 1 54 THR 54 54 THR THR B B 1 55 VAL 55 55 VAL VAL B B 1 56 ALA 56 56 ALA ALA B B 1 57 GLU 57 57 GLU GLU B B 1 58 LYS 58 58 LYS LYS B B 1 59 THR 59 59 THR THR B B 1 60 LYS 60 60 LYS LYS B B 1 61 GLU 61 61 GLU GLU B B 1 62 GLN 62 62 GLN GLN B B 1 63 VAL 63 63 VAL VAL B B 1 64 THR 64 64 THR THR B B 1 65 ASN 65 65 ASN ASN B B 1 66 VAL 66 66 VAL VAL B B 1 67 GLY 67 67 GLY GLY B B 1 68 GLY 68 68 GLY GLY B B 1 69 ALA 69 69 ALA ALA B B 1 70 VAL 70 70 VAL VAL B B 1 71 VAL 71 71 VAL VAL B B 1 72 THR 72 72 THR THR B B 1 73 GLY 73 73 GLY GLY B B 1 74 VAL 74 74 VAL VAL B B 1 75 THR 75 75 THR THR B B 1 76 ALA 76 76 ALA ALA B B 1 77 VAL 77 77 VAL VAL B B 1 78 ALA 78 78 ALA ALA B B 1 79 GLN 79 79 GLN GLN B B 1 80 LYS 80 80 LYS LYS B B 1 81 CYS 81 81 CYS CYS B B 1 82 VAL 82 82 VAL VAL B B 1 83 GLU 83 83 GLU GLU B B 1 84 GLY 84 84 GLY GLY B B 1 85 ALA 85 85 ALA ALA B B 1 86 GLY 86 86 GLY GLY B B 1 87 SER 87 87 SER SER B B 1 88 ILE 88 88 ILE ILE B B 1 89 ALA 89 89 ALA ALA B B 1 90 ALA 90 90 ALA ALA B B 1 91 ALA 91 91 ALA ALA B B 1 92 THR 92 92 THR THR B B 1 93 GLY 93 93 GLY GLY B B 1 94 PHE 94 94 PHE PHE B B 1 95 VAL 95 95 VAL VAL B B 1 96 LYS 96 96 LYS LYS B B 1 97 LYS 97 97 LYS LYS B B 1 98 ASP 98 98 ASP ASP B B 1 99 GLN 99 99 GLN GLN B B 1 100 LEU 100 100 LEU LEU B B 1 101 GLY 101 101 GLY GLY B B 1 102 LYS 102 102 LYS LYS B B 1 103 ASN 103 103 ASN ASN B B 1 104 CYS 104 104 CYS CYS B B 1 105 GLU 105 105 GLU GLU B B 1 106 GLY 106 106 GLY GLY B B 1 107 ALA 107 107 ALA ALA B B 1 108 PRO 108 108 PRO PRO B B 1 109 GLN 109 109 GLN GLN B B 1 110 GLU 110 110 GLU GLU B # # loop_ # #