data_9A2E # _entry.id 9A2E # loop_ _atom_type.symbol C H N O S # loop_ _audit_author.name _audit_author.pdbx_ordinal "Hamilton, G." 1 " Saikia, N." 2 " Basak, S." 3 " Welcome, F. S." 4 " Wu, F." 5 " Kubiak, J." 6 " Zhang, C." 7 " Hao, Y." 8 " Seidel, C. A. M." 9 " Ding, F." 10 " Sanabria, H." 11 " Bowen, M. E." 12 # loop_ _audit_conform.dict_location _audit_conform.dict_name _audit_conform.dict_version https://mmcif.wwpdb.org/dictionaries/ascii/mmcif_ihm_ext.dic mmcif_ihm_ext.dic 1.27 http://mmcif.wwpdb.org/dictionaries/ascii/mmcif_pdbx_v50.dic mmcif_pdbx.dic 5.399 # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB-Dev PDBDEV_00000161 PDBDEV_00000161 ? PDB 9A2E pdb_00009a2e 10.2210/pdb9a2e/pdb # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 9A2E _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2022-09-08 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2022-10-28 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _chem_comp.formula _chem_comp.formula_weight _chem_comp.id _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.type "C3 H7 N O2" 89.094 ALA . ALANINE . "L-peptide linking" "C6 H15 N4 O2 1" 175.212 ARG . ARGININE . "L-peptide linking" "C4 H8 N2 O3" 132.119 ASN . ASPARAGINE . "L-peptide linking" "C4 H7 N O4" 133.103 ASP . "ASPARTIC ACID" . "L-peptide linking" "C3 H7 N O2 S" 121.154 CYS . CYSTEINE . "L-peptide linking" "C5 H10 N2 O3" 146.146 GLN . GLUTAMINE . "L-peptide linking" "C5 H9 N O4" 147.13 GLU . "GLUTAMIC ACID" . "L-peptide linking" "C2 H5 N O2" 75.067 GLY . GLYCINE . "peptide linking" "C6 H10 N3 O2 1" 156.165 HIS . HISTIDINE . "L-peptide linking" "C6 H13 N O2" 131.175 ILE . ISOLEUCINE . "L-peptide linking" "C6 H13 N O2" 131.175 LEU . LEUCINE . "L-peptide linking" "C6 H15 N2 O2 1" 147.198 LYS . LYSINE . "L-peptide linking" "C5 H11 N O2 S" 149.208 MET . METHIONINE . "L-peptide linking" "C9 H11 N O2" 165.192 PHE . PHENYLALANINE . "L-peptide linking" "C5 H9 N O2" 115.132 PRO . PROLINE . "L-peptide linking" "C3 H7 N O3" 105.093 SER . SERINE . "L-peptide linking" "C4 H9 N O3" 119.12 THR . THREONINE . "L-peptide linking" "C11 H12 N2 O2" 204.229 TRP . TRYPTOPHAN . "L-peptide linking" "C9 H11 N O3" 181.191 TYR . TYROSINE . "L-peptide linking" "C5 H11 N O2" 117.148 VAL . VALINE . "L-peptide linking" # loop_ _citation.country _citation.id _citation.journal_abbrev _citation.journal_id_ASTM _citation.journal_id_CSD _citation.journal_id_ISSN _citation.journal_issue _citation.journal_volume _citation.page_first _citation.page_last _citation.pdbx_database_id_DOI _citation.pdbx_database_id_PubMed _citation.title _citation.year . 1 eLife . . . . . . . 10.7554/eLife.77242 36069777 "Fuzzy Supertertiary Interactions within PSD-95 Enable Ligand Binding" 2022 . 2 . . . . . . . . 10.1016/j.bpj.2018.11.1815 . "Automated and optimally FRET-assisted structural modeling" . # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal 1 "Hamilton, G." 1 1 " Saikia, N." 2 1 " Basak, S." 3 1 " Welcome, F. S." 4 1 " Wu, F." 5 1 " Kubiak, J." 6 1 " Zhang, C." 7 1 " Hao, Y." 8 1 " Seidel, C. A. M." 9 1 " Ding, F." 10 1 " Sanabria, H." 11 1 " Bowen, M. E." 12 2 "Dimura, M." 13 2 "Peulen, T.-O." 14 2 "Sanabria, H." 15 2 "Rodnin, D." 16 2 "Hemmen, K." 17 2 "Hanke, C.A." 18 2 "Seidel, C.A.M." 19 2 "Gohlke, H." 20 # loop_ _entity.details _entity.formula_weight _entity.id _entity.pdbx_description _entity.pdbx_number_of_molecules _entity.src_method _entity.type . 10563.502 1 "Postsynaptic density protein 95 (PSD95) PDZ3 domain" 1 MAN polymer . 43615.76 2 "Postsynaptic density protein 95 (PSD95) SH3-GuK Domain" 1 MAN polymer . 93630.28 3 "Postsynaptic density protein 95 (PSD95) Wild-Type" 1 MAN polymer # loop_ _entity_poly.entity_id _entity_poly.nstd_chirality _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_sequence_evidence_code _entity_poly.pdbx_strand_id _entity_poly.type 1 . NO NO RIVIHRGSTGLGFNIVGGEDGEGIFISFILAGGPADLSGELRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVTIIAQYKPEEYS RIVIHRGSTGLGFNIVGGEDGEGIFISFILAGGPADLSGELRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVTIIAQYKPEEYS . . polypeptide(L) 2 . NO NO RFEAKIHDLREQLMNSSLGSGTASLRSNPKRGFYIRALFDYDKTKDCGFLSQALSFRFGDVLHVIDASDEEWWQARRVHSDSETDDIGFIPSKRRVERREWSRLKAKDWGSSSGSQGREDSVLSYETVTQMEVHYARPIIILGPTKDRANDDLLSEFPDKFGSCVPHTTRPKREYEIDGRDYHFVSSREKMEKDIQAHKFIEAGQYNSHLYGTSVQSVREVAEQGKHCILDVSANAVRRLQAAHLHPIAIFIRPRSLENVLEINKRITEEQARKAFDRATKLEQEFTECFSAIVEGDSFEEIYHKVKRVIEDLSGPYIWVPARERL RFEAKIHDLREQLMNSSLGSGTASLRSNPKRGFYIRALFDYDKTKDCGFLSQALSFRFGDVLHVIDASDEEWWQARRVHSDSETDDIGFIPSKRRVERREWSRLKAKDWGSSSGSQGREDSVLSYETVTQMEVHYARPIIILGPTKDRANDDLLSEFPDKFGSCVPHTTRPKREYEIDGRDYHFVSSREKMEKDIQAHKFIEAGQYNSHLYGTSVQSVREVAEQGKHCILDVSANAVRRLQAAHLHPIAIFIRPRSLENVLEINKRITEEQARKAFDRATKLEQEFTECFSAIVEGDSFEEIYHKVKRVIEDLSGPYIWVPARERL . . polypeptide(L) 3 . NO NO MDCLCIVTTKKYRYQDEDTPPLEHSPAHLPNQANSPPVIVNTDTLEAPGYELQVNGTEGEMEYEEITLERGNSGLGFSIAGGTDNPHIGDDPSIFITKIIPGGAAAQDGRLRVNDSILFVNEVDVREVTHSAAVEALKEAGSIVRLYVMRRKPPAEKVMEIKLIKGPKGLGFSIAGGVGNQHIPGDNSIYVTKIIEGGAAHKDGRLQIGDKILAVNSVGLEDVMHEDAVAALKNTYDVVYLKVAKPSNAYLSDSYAPPDITTSYSQHLDNEISHSSYLGTDYPTAMTPTSPRRYSPVAKDLLGEEDIPREPRRIVIHRGSTGLGFNIVGGEDGEGIFISFILAGGPADLSGELRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVTIIAQYKPEEYSRFEAKIHDLREQLMNSSLGSGTASLRSNPKRGFYIRALFDYDKTKDCGFLSQALSFRFGDVLHVIDASDEEWWQARRVHSDSETDDIGFIPSKRRVERREWSRLKAKDWGSSSGSQGREDSVLSYETVTQMEVHYARPIIILGPTKDRANDDLLSEFPDKFGSCVPHTTRPKREYEIDGRDYHFVSSREKMEKDIQAHKFIEAGQYNSHLYGTSVQSVREVAEQGKHCILDVSANAVRRLQAAHLHPIAIFIRPRSLENVLEINKRITEEQARKAFDRATKLEQEFTECFSAIVEGDSFEEIYHKVKRVIEDLSGPYIWVPARERL MDCLCIVTTKKYRYQDEDTPPLEHSPAHLPNQANSPPVIVNTDTLEAPGYELQVNGTEGEMEYEEITLERGNSGLGFSIAGGTDNPHIGDDPSIFITKIIPGGAAAQDGRLRVNDSILFVNEVDVREVTHSAAVEALKEAGSIVRLYVMRRKPPAEKVMEIKLIKGPKGLGFSIAGGVGNQHIPGDNSIYVTKIIEGGAAHKDGRLQIGDKILAVNSVGLEDVMHEDAVAALKNTYDVVYLKVAKPSNAYLSDSYAPPDITTSYSQHLDNEISHSSYLGTDYPTAMTPTSPRRYSPVAKDLLGEEDIPREPRRIVIHRGSTGLGFNIVGGEDGEGIFISFILAGGPADLSGELRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVTIIAQYKPEEYSRFEAKIHDLREQLMNSSLGSGTASLRSNPKRGFYIRALFDYDKTKDCGFLSQALSFRFGDVLHVIDASDEEWWQARRVHSDSETDDIGFIPSKRRVERREWSRLKAKDWGSSSGSQGREDSVLSYETVTQMEVHYARPIIILGPTKDRANDDLLSEFPDKFGSCVPHTTRPKREYEIDGRDYHFVSSREKMEKDIQAHKFIEAGQYNSHLYGTSVQSVREVAEQGKHCILDVSANAVRRLQAAHLHPIAIFIRPRSLENVLEINKRITEEQARKAFDRATKLEQEFTECFSAIVEGDSFEEIYHKVKRVIEDLSGPYIWVPARERL . A polypeptide(L) # loop_ _entity_poly_seq.entity_id _entity_poly_seq.hetero _entity_poly_seq.mon_id _entity_poly_seq.num 1 . ARG 1 1 . ILE 2 1 . VAL 3 1 . ILE 4 1 . HIS 5 1 . ARG 6 1 . GLY 7 1 . SER 8 1 . THR 9 1 . GLY 10 1 . LEU 11 1 . GLY 12 1 . PHE 13 1 . ASN 14 1 . ILE 15 1 . VAL 16 1 . GLY 17 1 . GLY 18 1 . GLU 19 1 . ASP 20 1 . GLY 21 1 . GLU 22 1 . GLY 23 1 . ILE 24 1 . PHE 25 1 . ILE 26 1 . SER 27 1 . PHE 28 1 . ILE 29 1 . LEU 30 1 . ALA 31 1 . GLY 32 1 . GLY 33 1 . PRO 34 1 . ALA 35 1 . ASP 36 1 . LEU 37 1 . SER 38 1 . GLY 39 1 . GLU 40 1 . LEU 41 1 . ARG 42 1 . LYS 43 1 . GLY 44 1 . ASP 45 1 . GLN 46 1 . ILE 47 1 . LEU 48 1 . SER 49 1 . VAL 50 1 . ASN 51 1 . GLY 52 1 . VAL 53 1 . ASP 54 1 . LEU 55 1 . ARG 56 1 . ASN 57 1 . ALA 58 1 . SER 59 1 . HIS 60 1 . GLU 61 1 . GLN 62 1 . ALA 63 1 . ALA 64 1 . ILE 65 1 . ALA 66 1 . LEU 67 1 . LYS 68 1 . ASN 69 1 . ALA 70 1 . GLY 71 1 . GLN 72 1 . THR 73 1 . VAL 74 1 . THR 75 1 . ILE 76 1 . ILE 77 1 . ALA 78 1 . GLN 79 1 . TYR 80 1 . LYS 81 1 . PRO 82 1 . GLU 83 1 . GLU 84 1 . TYR 85 1 . SER 86 2 . ARG 1 2 . PHE 2 2 . GLU 3 2 . ALA 4 2 . LYS 5 2 . ILE 6 2 . HIS 7 2 . ASP 8 2 . LEU 9 2 . ARG 10 2 . GLU 11 2 . GLN 12 2 . LEU 13 2 . MET 14 2 . ASN 15 2 . SER 16 2 . SER 17 2 . LEU 18 2 . GLY 19 2 . SER 20 2 . GLY 21 2 . THR 22 2 . ALA 23 2 . SER 24 2 . LEU 25 2 . ARG 26 2 . SER 27 2 . ASN 28 2 . PRO 29 2 . LYS 30 2 . ARG 31 2 . GLY 32 2 . PHE 33 2 . TYR 34 2 . ILE 35 2 . ARG 36 2 . ALA 37 2 . LEU 38 2 . PHE 39 2 . ASP 40 2 . TYR 41 2 . ASP 42 2 . LYS 43 2 . THR 44 2 . LYS 45 2 . ASP 46 2 . CYS 47 2 . GLY 48 2 . PHE 49 2 . LEU 50 2 . SER 51 2 . GLN 52 2 . ALA 53 2 . LEU 54 2 . SER 55 2 . PHE 56 2 . ARG 57 2 . PHE 58 2 . GLY 59 2 . ASP 60 2 . VAL 61 2 . LEU 62 2 . HIS 63 2 . VAL 64 2 . ILE 65 2 . ASP 66 2 . ALA 67 2 . SER 68 2 . ASP 69 2 . GLU 70 2 . GLU 71 2 . TRP 72 2 . TRP 73 2 . GLN 74 2 . ALA 75 2 . ARG 76 2 . ARG 77 2 . VAL 78 2 . HIS 79 2 . SER 80 2 . ASP 81 2 . SER 82 2 . GLU 83 2 . THR 84 2 . ASP 85 2 . ASP 86 2 . ILE 87 2 . GLY 88 2 . PHE 89 2 . ILE 90 2 . PRO 91 2 . SER 92 2 . LYS 93 2 . ARG 94 2 . ARG 95 2 . VAL 96 2 . GLU 97 2 . ARG 98 2 . ARG 99 2 . GLU 100 2 . TRP 101 2 . SER 102 2 . ARG 103 2 . LEU 104 2 . LYS 105 2 . ALA 106 2 . LYS 107 2 . ASP 108 2 . TRP 109 2 . GLY 110 2 . SER 111 2 . SER 112 2 . SER 113 2 . GLY 114 2 . SER 115 2 . GLN 116 2 . GLY 117 2 . ARG 118 2 . GLU 119 2 . ASP 120 2 . SER 121 2 . VAL 122 2 . LEU 123 2 . SER 124 2 . TYR 125 2 . GLU 126 2 . THR 127 2 . VAL 128 2 . THR 129 2 . GLN 130 2 . MET 131 2 . GLU 132 2 . VAL 133 2 . HIS 134 2 . TYR 135 2 . ALA 136 2 . ARG 137 2 . PRO 138 2 . ILE 139 2 . ILE 140 2 . ILE 141 2 . LEU 142 2 . GLY 143 2 . PRO 144 2 . THR 145 2 . LYS 146 2 . ASP 147 2 . ARG 148 2 . ALA 149 2 . ASN 150 2 . ASP 151 2 . ASP 152 2 . LEU 153 2 . LEU 154 2 . SER 155 2 . GLU 156 2 . PHE 157 2 . PRO 158 2 . ASP 159 2 . LYS 160 2 . PHE 161 2 . GLY 162 2 . SER 163 2 . CYS 164 2 . VAL 165 2 . PRO 166 2 . HIS 167 2 . THR 168 2 . THR 169 2 . ARG 170 2 . PRO 171 2 . LYS 172 2 . ARG 173 2 . GLU 174 2 . TYR 175 2 . GLU 176 2 . ILE 177 2 . ASP 178 2 . GLY 179 2 . ARG 180 2 . ASP 181 2 . TYR 182 2 . HIS 183 2 . PHE 184 2 . VAL 185 2 . SER 186 2 . SER 187 2 . ARG 188 2 . GLU 189 2 . LYS 190 2 . MET 191 2 . GLU 192 2 . LYS 193 2 . ASP 194 2 . ILE 195 2 . GLN 196 2 . ALA 197 2 . HIS 198 2 . LYS 199 2 . PHE 200 2 . ILE 201 2 . GLU 202 2 . ALA 203 2 . GLY 204 2 . GLN 205 2 . TYR 206 2 . ASN 207 2 . SER 208 2 . HIS 209 2 . LEU 210 2 . TYR 211 2 . GLY 212 2 . THR 213 2 . SER 214 2 . VAL 215 2 . GLN 216 2 . SER 217 2 . VAL 218 2 . ARG 219 2 . GLU 220 2 . VAL 221 2 . ALA 222 2 . GLU 223 2 . GLN 224 2 . GLY 225 2 . LYS 226 2 . HIS 227 2 . CYS 228 2 . ILE 229 2 . LEU 230 2 . ASP 231 2 . VAL 232 2 . SER 233 2 . ALA 234 2 . ASN 235 2 . ALA 236 2 . VAL 237 2 . ARG 238 2 . ARG 239 2 . LEU 240 2 . GLN 241 2 . ALA 242 2 . ALA 243 2 . HIS 244 2 . LEU 245 2 . HIS 246 2 . PRO 247 2 . ILE 248 2 . ALA 249 2 . ILE 250 2 . PHE 251 2 . ILE 252 2 . ARG 253 2 . PRO 254 2 . ARG 255 2 . SER 256 2 . LEU 257 2 . GLU 258 2 . ASN 259 2 . VAL 260 2 . LEU 261 2 . GLU 262 2 . ILE 263 2 . ASN 264 2 . LYS 265 2 . ARG 266 2 . ILE 267 2 . THR 268 2 . GLU 269 2 . GLU 270 2 . GLN 271 2 . ALA 272 2 . ARG 273 2 . LYS 274 2 . ALA 275 2 . PHE 276 2 . ASP 277 2 . ARG 278 2 . ALA 279 2 . THR 280 2 . LYS 281 2 . LEU 282 2 . GLU 283 2 . GLN 284 2 . GLU 285 2 . PHE 286 2 . THR 287 2 . GLU 288 2 . CYS 289 2 . PHE 290 2 . SER 291 2 . ALA 292 2 . ILE 293 2 . VAL 294 2 . GLU 295 2 . GLY 296 2 . ASP 297 2 . SER 298 2 . PHE 299 2 . GLU 300 2 . GLU 301 2 . ILE 302 2 . TYR 303 2 . HIS 304 2 . LYS 305 2 . VAL 306 2 . LYS 307 2 . ARG 308 2 . VAL 309 2 . ILE 310 2 . GLU 311 2 . ASP 312 2 . LEU 313 2 . SER 314 2 . GLY 315 2 . PRO 316 2 . TYR 317 2 . ILE 318 2 . TRP 319 2 . VAL 320 2 . PRO 321 2 . ALA 322 2 . ARG 323 2 . GLU 324 2 . ARG 325 2 . LEU 326 3 . MET 1 3 . ASP 2 3 . CYS 3 3 . LEU 4 3 . CYS 5 3 . ILE 6 3 . VAL 7 3 . THR 8 3 . THR 9 3 . LYS 10 3 . LYS 11 3 . TYR 12 3 . ARG 13 3 . TYR 14 3 . GLN 15 3 . ASP 16 3 . GLU 17 3 . ASP 18 3 . THR 19 3 . PRO 20 3 . PRO 21 3 . LEU 22 3 . GLU 23 3 . HIS 24 3 . SER 25 3 . PRO 26 3 . ALA 27 3 . HIS 28 3 . LEU 29 3 . PRO 30 3 . ASN 31 3 . GLN 32 3 . ALA 33 3 . ASN 34 3 . SER 35 3 . PRO 36 3 . PRO 37 3 . VAL 38 3 . ILE 39 3 . VAL 40 3 . ASN 41 3 . THR 42 3 . ASP 43 3 . THR 44 3 . LEU 45 3 . GLU 46 3 . ALA 47 3 . PRO 48 3 . GLY 49 3 . TYR 50 3 . GLU 51 3 . LEU 52 3 . GLN 53 3 . VAL 54 3 . ASN 55 3 . GLY 56 3 . THR 57 3 . GLU 58 3 . GLY 59 3 . GLU 60 3 . MET 61 3 . GLU 62 3 . TYR 63 3 . GLU 64 3 . GLU 65 3 . ILE 66 3 . THR 67 3 . LEU 68 3 . GLU 69 3 . ARG 70 3 . GLY 71 3 . ASN 72 3 . SER 73 3 . GLY 74 3 . LEU 75 3 . GLY 76 3 . PHE 77 3 . SER 78 3 . ILE 79 3 . ALA 80 3 . GLY 81 3 . GLY 82 3 . THR 83 3 . ASP 84 3 . ASN 85 3 . PRO 86 3 . HIS 87 3 . ILE 88 3 . GLY 89 3 . ASP 90 3 . ASP 91 3 . PRO 92 3 . SER 93 3 . ILE 94 3 . PHE 95 3 . ILE 96 3 . THR 97 3 . LYS 98 3 . ILE 99 3 . ILE 100 3 . PRO 101 3 . GLY 102 3 . GLY 103 3 . ALA 104 3 . ALA 105 3 . ALA 106 3 . GLN 107 3 . ASP 108 3 . GLY 109 3 . ARG 110 3 . LEU 111 3 . ARG 112 3 . VAL 113 3 . ASN 114 3 . ASP 115 3 . SER 116 3 . ILE 117 3 . LEU 118 3 . PHE 119 3 . VAL 120 3 . ASN 121 3 . GLU 122 3 . VAL 123 3 . ASP 124 3 . VAL 125 3 . ARG 126 3 . GLU 127 3 . VAL 128 3 . THR 129 3 . HIS 130 3 . SER 131 3 . ALA 132 3 . ALA 133 3 . VAL 134 3 . GLU 135 3 . ALA 136 3 . LEU 137 3 . LYS 138 3 . GLU 139 3 . ALA 140 3 . GLY 141 3 . SER 142 3 . ILE 143 3 . VAL 144 3 . ARG 145 3 . LEU 146 3 . TYR 147 3 . VAL 148 3 . MET 149 3 . ARG 150 3 . ARG 151 3 . LYS 152 3 . PRO 153 3 . PRO 154 3 . ALA 155 3 . GLU 156 3 . LYS 157 3 . VAL 158 3 . MET 159 3 . GLU 160 3 . ILE 161 3 . LYS 162 3 . LEU 163 3 . ILE 164 3 . LYS 165 3 . GLY 166 3 . PRO 167 3 . LYS 168 3 . GLY 169 3 . LEU 170 3 . GLY 171 3 . PHE 172 3 . SER 173 3 . ILE 174 3 . ALA 175 3 . GLY 176 3 . GLY 177 3 . VAL 178 3 . GLY 179 3 . ASN 180 3 . GLN 181 3 . HIS 182 3 . ILE 183 3 . PRO 184 3 . GLY 185 3 . ASP 186 3 . ASN 187 3 . SER 188 3 . ILE 189 3 . TYR 190 3 . VAL 191 3 . THR 192 3 . LYS 193 3 . ILE 194 3 . ILE 195 3 . GLU 196 3 . GLY 197 3 . GLY 198 3 . ALA 199 3 . ALA 200 3 . HIS 201 3 . LYS 202 3 . ASP 203 3 . GLY 204 3 . ARG 205 3 . LEU 206 3 . GLN 207 3 . ILE 208 3 . GLY 209 3 . ASP 210 3 . LYS 211 3 . ILE 212 3 . LEU 213 3 . ALA 214 3 . VAL 215 3 . ASN 216 3 . SER 217 3 . VAL 218 3 . GLY 219 3 . LEU 220 3 . GLU 221 3 . ASP 222 3 . VAL 223 3 . MET 224 3 . HIS 225 3 . GLU 226 3 . ASP 227 3 . ALA 228 3 . VAL 229 3 . ALA 230 3 . ALA 231 3 . LEU 232 3 . LYS 233 3 . ASN 234 3 . THR 235 3 . TYR 236 3 . ASP 237 3 . VAL 238 3 . VAL 239 3 . TYR 240 3 . LEU 241 3 . LYS 242 3 . VAL 243 3 . ALA 244 3 . LYS 245 3 . PRO 246 3 . SER 247 3 . ASN 248 3 . ALA 249 3 . TYR 250 3 . LEU 251 3 . SER 252 3 . ASP 253 3 . SER 254 3 . TYR 255 3 . ALA 256 3 . PRO 257 3 . PRO 258 3 . ASP 259 3 . ILE 260 3 . THR 261 3 . THR 262 3 . SER 263 3 . TYR 264 3 . SER 265 3 . GLN 266 3 . HIS 267 3 . LEU 268 3 . ASP 269 3 . ASN 270 3 . GLU 271 3 . ILE 272 3 . SER 273 3 . HIS 274 3 . SER 275 3 . SER 276 3 . TYR 277 3 . LEU 278 3 . GLY 279 3 . THR 280 3 . ASP 281 3 . TYR 282 3 . PRO 283 3 . THR 284 3 . ALA 285 3 . MET 286 3 . THR 287 3 . PRO 288 3 . THR 289 3 . SER 290 3 . PRO 291 3 . ARG 292 3 . ARG 293 3 . TYR 294 3 . SER 295 3 . PRO 296 3 . VAL 297 3 . ALA 298 3 . LYS 299 3 . ASP 300 3 . LEU 301 3 . LEU 302 3 . GLY 303 3 . GLU 304 3 . GLU 305 3 . ASP 306 3 . ILE 307 3 . PRO 308 3 . ARG 309 3 . GLU 310 3 . PRO 311 3 . ARG 312 3 . ARG 313 3 . ILE 314 3 . VAL 315 3 . ILE 316 3 . HIS 317 3 . ARG 318 3 . GLY 319 3 . SER 320 3 . THR 321 3 . GLY 322 3 . LEU 323 3 . GLY 324 3 . PHE 325 3 . ASN 326 3 . ILE 327 3 . VAL 328 3 . GLY 329 3 . GLY 330 3 . GLU 331 3 . ASP 332 3 . GLY 333 3 . GLU 334 3 . GLY 335 3 . ILE 336 3 . PHE 337 3 . ILE 338 3 . SER 339 3 . PHE 340 3 . ILE 341 3 . LEU 342 3 . ALA 343 3 . GLY 344 3 . GLY 345 3 . PRO 346 3 . ALA 347 3 . ASP 348 3 . LEU 349 3 . SER 350 3 . GLY 351 3 . GLU 352 3 . LEU 353 3 . ARG 354 3 . LYS 355 3 . GLY 356 3 . ASP 357 3 . GLN 358 3 . ILE 359 3 . LEU 360 3 . SER 361 3 . VAL 362 3 . ASN 363 3 . GLY 364 3 . VAL 365 3 . ASP 366 3 . LEU 367 3 . ARG 368 3 . ASN 369 3 . ALA 370 3 . SER 371 3 . HIS 372 3 . GLU 373 3 . GLN 374 3 . ALA 375 3 . ALA 376 3 . ILE 377 3 . ALA 378 3 . LEU 379 3 . LYS 380 3 . ASN 381 3 . ALA 382 3 . GLY 383 3 . GLN 384 3 . THR 385 3 . VAL 386 3 . THR 387 3 . ILE 388 3 . ILE 389 3 . ALA 390 3 . GLN 391 3 . TYR 392 3 . LYS 393 3 . PRO 394 3 . GLU 395 3 . GLU 396 3 . TYR 397 3 . SER 398 3 . ARG 399 3 . PHE 400 3 . GLU 401 3 . ALA 402 3 . LYS 403 3 . ILE 404 3 . HIS 405 3 . ASP 406 3 . LEU 407 3 . ARG 408 3 . GLU 409 3 . GLN 410 3 . LEU 411 3 . MET 412 3 . ASN 413 3 . SER 414 3 . SER 415 3 . LEU 416 3 . GLY 417 3 . SER 418 3 . GLY 419 3 . THR 420 3 . ALA 421 3 . SER 422 3 . LEU 423 3 . ARG 424 3 . SER 425 3 . ASN 426 3 . PRO 427 3 . LYS 428 3 . ARG 429 3 . GLY 430 3 . PHE 431 3 . TYR 432 3 . ILE 433 3 . ARG 434 3 . ALA 435 3 . LEU 436 3 . PHE 437 3 . ASP 438 3 . TYR 439 3 . ASP 440 3 . LYS 441 3 . THR 442 3 . LYS 443 3 . ASP 444 3 . CYS 445 3 . GLY 446 3 . PHE 447 3 . LEU 448 3 . SER 449 3 . GLN 450 3 . ALA 451 3 . LEU 452 3 . SER 453 3 . PHE 454 3 . ARG 455 3 . PHE 456 3 . GLY 457 3 . ASP 458 3 . VAL 459 3 . LEU 460 3 . HIS 461 3 . VAL 462 3 . ILE 463 3 . ASP 464 3 . ALA 465 3 . SER 466 3 . ASP 467 3 . GLU 468 3 . GLU 469 3 . TRP 470 3 . TRP 471 3 . GLN 472 3 . ALA 473 3 . ARG 474 3 . ARG 475 3 . VAL 476 3 . HIS 477 3 . SER 478 3 . ASP 479 3 . SER 480 3 . GLU 481 3 . THR 482 3 . ASP 483 3 . ASP 484 3 . ILE 485 3 . GLY 486 3 . PHE 487 3 . ILE 488 3 . PRO 489 3 . SER 490 3 . LYS 491 3 . ARG 492 3 . ARG 493 3 . VAL 494 3 . GLU 495 3 . ARG 496 3 . ARG 497 3 . GLU 498 3 . TRP 499 3 . SER 500 3 . ARG 501 3 . LEU 502 3 . LYS 503 3 . ALA 504 3 . LYS 505 3 . ASP 506 3 . TRP 507 3 . GLY 508 3 . SER 509 3 . SER 510 3 . SER 511 3 . GLY 512 3 . SER 513 3 . GLN 514 3 . GLY 515 3 . ARG 516 3 . GLU 517 3 . ASP 518 3 . SER 519 3 . VAL 520 3 . LEU 521 3 . SER 522 3 . TYR 523 3 . GLU 524 3 . THR 525 3 . VAL 526 3 . THR 527 3 . GLN 528 3 . MET 529 3 . GLU 530 3 . VAL 531 3 . HIS 532 3 . TYR 533 3 . ALA 534 3 . ARG 535 3 . PRO 536 3 . ILE 537 3 . ILE 538 3 . ILE 539 3 . LEU 540 3 . GLY 541 3 . PRO 542 3 . THR 543 3 . LYS 544 3 . ASP 545 3 . ARG 546 3 . ALA 547 3 . ASN 548 3 . ASP 549 3 . ASP 550 3 . LEU 551 3 . LEU 552 3 . SER 553 3 . GLU 554 3 . PHE 555 3 . PRO 556 3 . ASP 557 3 . LYS 558 3 . PHE 559 3 . GLY 560 3 . SER 561 3 . CYS 562 3 . VAL 563 3 . PRO 564 3 . HIS 565 3 . THR 566 3 . THR 567 3 . ARG 568 3 . PRO 569 3 . LYS 570 3 . ARG 571 3 . GLU 572 3 . TYR 573 3 . GLU 574 3 . ILE 575 3 . ASP 576 3 . GLY 577 3 . ARG 578 3 . ASP 579 3 . TYR 580 3 . HIS 581 3 . PHE 582 3 . VAL 583 3 . SER 584 3 . SER 585 3 . ARG 586 3 . GLU 587 3 . LYS 588 3 . MET 589 3 . GLU 590 3 . LYS 591 3 . ASP 592 3 . ILE 593 3 . GLN 594 3 . ALA 595 3 . HIS 596 3 . LYS 597 3 . PHE 598 3 . ILE 599 3 . GLU 600 3 . ALA 601 3 . GLY 602 3 . GLN 603 3 . TYR 604 3 . ASN 605 3 . SER 606 3 . HIS 607 3 . LEU 608 3 . TYR 609 3 . GLY 610 3 . THR 611 3 . SER 612 3 . VAL 613 3 . GLN 614 3 . SER 615 3 . VAL 616 3 . ARG 617 3 . GLU 618 3 . VAL 619 3 . ALA 620 3 . GLU 621 3 . GLN 622 3 . GLY 623 3 . LYS 624 3 . HIS 625 3 . CYS 626 3 . ILE 627 3 . LEU 628 3 . ASP 629 3 . VAL 630 3 . SER 631 3 . ALA 632 3 . ASN 633 3 . ALA 634 3 . VAL 635 3 . ARG 636 3 . ARG 637 3 . LEU 638 3 . GLN 639 3 . ALA 640 3 . ALA 641 3 . HIS 642 3 . LEU 643 3 . HIS 644 3 . PRO 645 3 . ILE 646 3 . ALA 647 3 . ILE 648 3 . PHE 649 3 . ILE 650 3 . ARG 651 3 . PRO 652 3 . ARG 653 3 . SER 654 3 . LEU 655 3 . GLU 656 3 . ASN 657 3 . VAL 658 3 . LEU 659 3 . GLU 660 3 . ILE 661 3 . ASN 662 3 . LYS 663 3 . ARG 664 3 . ILE 665 3 . THR 666 3 . GLU 667 3 . GLU 668 3 . GLN 669 3 . ALA 670 3 . ARG 671 3 . LYS 672 3 . ALA 673 3 . PHE 674 3 . ASP 675 3 . ARG 676 3 . ALA 677 3 . THR 678 3 . LYS 679 3 . LEU 680 3 . GLU 681 3 . GLN 682 3 . GLU 683 3 . PHE 684 3 . THR 685 3 . GLU 686 3 . CYS 687 3 . PHE 688 3 . SER 689 3 . ALA 690 3 . ILE 691 3 . VAL 692 3 . GLU 693 3 . GLY 694 3 . ASP 695 3 . SER 696 3 . PHE 697 3 . GLU 698 3 . GLU 699 3 . ILE 700 3 . TYR 701 3 . HIS 702 3 . LYS 703 3 . VAL 704 3 . LYS 705 3 . ARG 706 3 . VAL 707 3 . ILE 708 3 . GLU 709 3 . ASP 710 3 . LEU 711 3 . SER 712 3 . GLY 713 3 . PRO 714 3 . TYR 715 3 . ILE 716 3 . TRP 717 3 . VAL 718 3 . PRO 719 3 . ALA 720 3 . ARG 721 3 . GLU 722 3 . ARG 723 3 . LEU 724 # loop_ _ihm_chemical_component_descriptor.auth_name _ihm_chemical_component_descriptor.chemical_name _ihm_chemical_component_descriptor.common_name _ihm_chemical_component_descriptor.details _ihm_chemical_component_descriptor.id _ihm_chemical_component_descriptor.inchi _ihm_chemical_component_descriptor.inchi_key _ihm_chemical_component_descriptor.smiles _ihm_chemical_component_descriptor.smiles_canonical "Alexa-488 C5-maleimide" . . . 1 . . Nc1ccc2c(c3ccc(cc3C(=O)O)C(=O)NCCCCCN3C(=O)C=CC3=O)c3ccc(=[NH2+])c(c3oc2c1S(=O)(=O)[O-])S(=O)(=O)[O-] . "Alexa-488 chromophore" . . . 2 . . C1=CC(=C(C=C1C(=O)NCCCCCN2C(=O)C=CC2=O)C(=O)O)C3=C4C=CC(=[NH2+])C(=C4OC5=C3C=CC(=C5S(=O)(=O)O)N)S(=O)(=O)O . "Alexa-647 C2-maleimide" . . . 3 . . O=C(N1CCNC(CCCCCC2(C)/C(N(CCCS(=O)([O-])=O)C3=C2C=C(S(=O)([O-])=O)C=C3)=C\C=C\C=C\C4=[N+](CCCS(=O)([O-])=O)C5=C(C=C(S(=O)([O-])=O)C=C5)C4(C)C)=O)C=CC1=O . "Alexa647 - chromophore" . . . 4 . . CC1(C)/C(N(CCCS(=O)([O-])=O)C2=C1C=C(S(=O)([O-])=O)C=C2)=C\C=C\C=C\C3=[N+](CCCS(=O)([O-])=O)C4=C(C=C(S(=O)([O-])=O)C=C4)C3(C)C . "Alexa-488 C5-maleimide-CYS" . . . 5 . . C1=CC(=C(C=C1C(=O)N(CCCCCN2C(=O)C(CC2=O)SCC(N([H])[H])C(O[H])=O)[H])C(=O)O[H])C4=C3C=CC(=[N+]([H])[H])C(=C3OC5=C4C=CC(=C5[S](=O)(=O)O[H])N([H])[H])[S](=O)(=O)O[H] . Alexa647-C2-maleimide-Cys . . . 6 . . O=C(C(N[R1])SC1CC(N(CCNC(CCCCCC2(C)/C(N(CCCS(=O)([O-])=O)C3=C2C=C(S(=O)([O-])=O)C=C3)=C\C=C\C=C\C4=[N+](CCCS(=O)([O-])=O)C5=C(C=C(S(=O)([O-])=O)C=C5)C4(C)C)=O)C1=O)=O)N[R2] . # loop_ _ihm_dataset_external_reference.dataset_list_id _ihm_dataset_external_reference.file_id _ihm_dataset_external_reference.id 1 1 1 2 2 2 3 3 3 4 4 4 5 5 5 6 6 6 7 7 7 8 8 8 9 9 9 10 10 10 11 11 11 12 12 12 13 13 13 14 14 14 15 15 15 16 16 16 17 17 17 18 18 18 19 19 19 20 20 20 21 21 21 22 22 22 23 23 23 24 24 24 25 25 25 26 26 26 27 27 27 28 28 28 29 29 29 30 30 30 31 31 31 32 32 32 34 36 34 35 37 35 # _ihm_dataset_group.application . _ihm_dataset_group.details . _ihm_dataset_group.id 1 _ihm_dataset_group.name . # loop_ _ihm_dataset_group_link.dataset_list_id _ihm_dataset_group_link.group_id 1 1 2 1 3 1 4 1 5 1 6 1 7 1 8 1 9 1 10 1 11 1 12 1 13 1 14 1 15 1 16 1 17 1 18 1 19 1 20 1 21 1 22 1 23 1 24 1 25 1 26 1 27 1 28 1 29 1 30 1 31 1 # loop_ _ihm_dataset_list.data_type _ihm_dataset_list.database_hosted _ihm_dataset_list.details _ihm_dataset_list.id "Single molecule FRET data" NO "Single molecule data" 1 "Single molecule FRET data" NO "Single molecule data" 2 "Single molecule FRET data" NO "Single molecule data" 3 "Single molecule FRET data" NO "Single molecule data" 4 "Single molecule FRET data" NO "Single molecule data" 5 "Single molecule FRET data" NO "Single molecule data" 6 "Single molecule FRET data" NO "Single molecule data" 7 "Single molecule FRET data" NO "Single molecule data" 8 "Single molecule FRET data" NO "Single molecule data" 9 "Single molecule FRET data" NO "Single molecule data" 10 "Single molecule FRET data" NO "Single molecule data" 11 "Single molecule FRET data" NO "Single molecule data" 12 "Single molecule FRET data" NO "Single molecule data" 13 "Single molecule FRET data" NO "Single molecule data" 14 "Single molecule FRET data" NO "Single molecule data" 15 "Single molecule FRET data" NO "Single molecule data" 16 "Single molecule FRET data" NO "Single molecule data" 17 "Single molecule FRET data" NO "Single molecule data" 18 "Single molecule FRET data" NO "Single molecule data" 19 "Single molecule FRET data" NO "Single molecule data" 20 "Single molecule FRET data" NO "Single molecule data" 21 "Single molecule FRET data" NO "Single molecule data" 22 "Single molecule FRET data" NO "Single molecule data" 23 "Single molecule FRET data" NO "Single molecule data" 24 "Single molecule FRET data" NO "Single molecule data" 25 "Single molecule FRET data" NO "Single molecule data" 26 "Single molecule FRET data" NO "Single molecule data" 27 "Predicted contacts" NO "Predicted contacts" 28 "Predicted contacts" NO "Predicted contacts" 29 "Predicted contacts" NO "Predicted contacts" 30 "Predicted contacts" NO "Predicted contacts" 31 "Comparative model" NO "Starting model XYZ1 SH3-GuK" 32 "Integrative model" NO "Combined PDZ3 experimental and SH3-GuK comparative models used in rigid body docking, provided as a single starting model for convenience." 33 "Experimental model" YES "Template for Starting model XYZ1 SH3-GuK" 34 "Experimental model" YES "Starting experimental model XYZ2 for PDZ3" 35 Other NO "Input sequence for initial generation of starting models" 36 # loop_ _ihm_related_datasets.dataset_list_id_derived _ihm_related_datasets.dataset_list_id_primary 33 32 33 35 # loop_ _ihm_dataset_related_db_reference.accession_code _ihm_dataset_related_db_reference.dataset_list_id _ihm_dataset_related_db_reference.db_name _ihm_dataset_related_db_reference.details _ihm_dataset_related_db_reference.id _ihm_dataset_related_db_reference.version 1KJW 34 PDB "Initial experimental model for SH3-GuK" 1 . 6QJD 35 PDB "PDZ3 initial experimental model" 2 . # loop_ _ihm_entity_poly_segment.comp_id_begin _ihm_entity_poly_segment.comp_id_end _ihm_entity_poly_segment.entity_id _ihm_entity_poly_segment.id _ihm_entity_poly_segment.seq_id_begin _ihm_entity_poly_segment.seq_id_end ARG SER 3 1 313 398 LYS LEU 3 2 428 724 MET LEU 3 3 1 724 ARG LEU 3 4 313 724 # loop_ _ihm_external_files.content_type _ihm_external_files.details _ihm_external_files.file_format _ihm_external_files.file_path _ihm_external_files.file_size_bytes _ihm_external_files.id _ihm_external_files.reference_id "Input data or restraints" "FRET-sensitize donor fluorescence decay curve from seTCSPC for PSD95 R313C-S606" . "single_molecule/PSG Data Compiled_08_2022/Fluorescence Decay Histograms/P1G2/P1G2_DA.dat" . 1 1 "Input data or restraints" "FRET-sensitize donor fluorescence decay curve from seTCSPC for PSD95 R313C-E618C" . "single_molecule/PSG Data Compiled_08_2022/Fluorescence Decay Histograms/P1G3/P1G3_DA.dat" . 2 1 "Input data or restraints" "FRET-sensitize donor fluorescence decay curve from seTCSPC for PSD95 R313C-E621C" . "single_molecule/PSG Data Compiled_08_2022/Fluorescence Decay Histograms/P1G4/P1G4_DA.dat" . 3 1 "Input data or restraints" "FRET-sensitize donor fluorescence decay curve from seTCSPC for PSD95 Q374C-R492C" . "single_molecule/PSG Data Compiled_08_2022/Fluorescence Decay Histograms/P2S2/P2S2_DA.dat" . 4 1 "Input data or restraints" "FRET-sensitize donor fluorescence decay curve from seTCSPC for PSD95 Q374C-K591C" . "single_molecule/PSG Data Compiled_08_2022/Fluorescence Decay Histograms/P2G1/P2G1_DA.dat" . 5 1 "Input data or restraints" "FRET-sensitize donor fluorescence decay curve from seTCSPC for PSD95 Q374C-R671C" . "single_molecule/PSG Data Compiled_08_2022/Fluorescence Decay Histograms/P2G6/P2G6_DA.dat" . 6 1 "Input data or restraints" "FRET-sensitize donor fluorescence decay curve from seTCSPC for PSD95 S398C-R492C" . "single_molecule/PSG Data Compiled_08_2022/Fluorescence Decay Histograms/P3S2/P3S2_DA.dat" . 7 1 "Input data or restraints" "FRET-sensitize donor fluorescence decay curve from seTCSPC for PSD95 S398C-E621C" . "single_molecule/PSG Data Compiled_08_2022/Fluorescence Decay Histograms/P3G4/P3G4_DA.dat" . 8 1 "Input data or restraints" "FRET-sensitize donor fluorescence decay curve from seTCSPC for PSD95 S398C-A640C" . "single_molecule/PSG Data Compiled_08_2022/Fluorescence Decay Histograms/P3G5/P3G5_DA.dat" . 9 1 "Input data or restraints" "Donor-only donor fluorescence decay curve from seTCSPC for PSD95 R313C-S606" . "single_molecule/PSG Data Compiled_08_2022/Fluorescence Decay Histograms/P1G2/P1G2_DO.dat" . 10 1 "Input data or restraints" "Donor-only donor fluorescence decay curve from seTCSPC for PSD95 R313C-E618C" . "single_molecule/PSG Data Compiled_08_2022/Fluorescence Decay Histograms/P1G3/P1G3_DO.dat" . 11 1 "Input data or restraints" "Donor-only donor fluorescence decay curve from seTCSPC for PSD95 R313C-E621C" . "single_molecule/PSG Data Compiled_08_2022/Fluorescence Decay Histograms/P1G4/P1G4_DO.dat" . 12 1 "Input data or restraints" "Donor-only donor fluorescence decay curve from seTCSPC for PSD95 Q374C-R492C" . "single_molecule/PSG Data Compiled_08_2022/Fluorescence Decay Histograms/P2S2/P2S2_DO.dat" . 13 1 "Input data or restraints" "Donor-only donor fluorescence decay curve from seTCSPC for PSD95 Q374C-K591C" . "single_molecule/PSG Data Compiled_08_2022/Fluorescence Decay Histograms/P2G1/P2G1_DO.dat" . 14 1 "Input data or restraints" "Donor-only donor fluorescence decay curve from seTCSPC for PSD95 Q374C-R671C" . "single_molecule/PSG Data Compiled_08_2022/Fluorescence Decay Histograms/P2G6/P2G6_DO.dat" . 15 1 "Input data or restraints" "Donor-only donor fluorescence decay curve from seTCSPC for PSD95 S398C-R492C" . "single_molecule/PSG Data Compiled_08_2022/Fluorescence Decay Histograms/P3S2/P3S2_DO.dat" . 16 1 "Input data or restraints" "Donor-only donor fluorescence decay curve from seTCSPC for PSD95 S398C-E621C" . "single_molecule/PSG Data Compiled_08_2022/Fluorescence Decay Histograms/P3G4/P3G4_DO.dat" . 17 1 "Input data or restraints" "Donor-only donor fluorescence decay curve from seTCSPC for PSD95 S398C-A640C" . "single_molecule/PSG Data Compiled_08_2022/Fluorescence Decay Histograms/P3G5/P3G5_DO.dat" . 18 1 "Input data or restraints" "IRF curve from seTCSPC for PSD95 R313C-S606C" . "single_molecule/PSG Data Compiled_08_2022/Fluorescence Decay Histograms/P1G2/P1G2_IRF.dat" . 19 1 "Input data or restraints" "IRF curve from seTCSPC for PSD95 R313C-E618C" . "single_molecule/PSG Data Compiled_08_2022/Fluorescence Decay Histograms/P1G3/P1G3_IRF.dat" . 20 1 "Input data or restraints" "IRF curve from seTCSPC for PSD95 R313C-E621C" . "single_molecule/PSG Data Compiled_08_2022/Fluorescence Decay Histograms/P1G4/P1G4_IRF.dat" . 21 1 "Input data or restraints" "IRF curve from seTCSPC for PSD95 Q374C-R492C" . "single_molecule/PSG Data Compiled_08_2022/Fluorescence Decay Histograms/P2S2/P2S2_IRF.dat" . 22 1 "Input data or restraints" "IRF curve from seTCSPC for PSD95 Q374C-K591C" . "single_molecule/PSG Data Compiled_08_2022/Fluorescence Decay Histograms/P2G1/P2G1_IRF.dat" . 23 1 "Input data or restraints" "IRF curve from seTCSPC for PSD95 Q374C-R671C" . "single_molecule/PSG Data Compiled_08_2022/Fluorescence Decay Histograms/P2G6/P2G6_IRF.dat" . 24 1 "Input data or restraints" "IRF curve from seTCSPC for PSD95 S398C-R492C" . "single_molecule/PSG Data Compiled_08_2022/Fluorescence Decay Histograms/P3S2/P3S2_IRF.dat" . 25 1 "Input data or restraints" "IRF curve from seTCSPC for PSD95 S398C-E621C" . "single_molecule/PSG Data Compiled_08_2022/Fluorescence Decay Histograms/P3G4/P3G4_IRF.dat" 258 26 1 "Input data or restraints" "IRF curve from seTCSPC for PSD95 S398C-A640C" . "single_molecule/PSG Data Compiled_08_2022/Fluorescence Decay Histograms/P3G5/P3G5_IRF.dat" 258 27 1 "Input data or restraints" "Input distance restraints for A in FPS software from seTCSPC analysis" . prediced_contacts/PDBDev_adtl_Datasets/Docking_Data_Files/FL_A_dist_DS 258 28 1 "Input data or restraints" "Input distance restraints for B in FPS software from seTCSPC analysis" . prediced_contacts/PDBDev_adtl_Datasets/Docking_Data_Files/FL_B_dist_DS 258 29 1 "Input data or restraints" "Label position definitions for FPS software" . prediced_contacts/PDBDev_adtl_Datasets/Docking_Data_Files/LPs_withDS 258 30 1 "Input data or restraints" "Interdomain contacts used in refinement post-processing step for rigid body docking with FRET-derived distance restraints" . prediced_contacts/PDBDev_adtl_Datasets/Docking_Data_Files/Disulfide_Contacts.docx 258 31 1 "Input data or restraints" "Input structure for rigid body docking" . xyz1/PDBDev_adtl_Datasets/Docking_Data_Files/PDZ3.pdb.cif 258 32 1 "Input data or restraints" "Input structure for rigid body docking" . xyz2/PDBDev_adtl_Datasets/Docking_Data_Files/SH3GuK.pdb.cif 258 33 1 "Input data or restraints" "Input PDZ3 and SH3-GuK structure for rigid body docking with linker between PDZ3 and SH3 deleted, resulting in two distinct objects. PDB files for separate PDZ3 and SH3-GuK are also included for convenience of use with rigid body docking software." CIF xyz3/PDBDev_adtl_Datasets/Docking_Data_Files/PDZ3_SH3GuK.pdb.cif 258 34 1 "Input data or restraints" "Reference sequence used for initial generation of starting model." TXT sequence/PDBDev_adtl_Datasets/Docking_Data_Files/Input_Sequence.txt 258 35 1 "Input data or restraints" "Experimental model used for initial modeling of SH3-GuK" CIF "xyz4/PDBDev_adtl_Datasets/Initial Model/1kjw.cif" 258 36 1 "Input data or restraints" "Experimental model used as initial model for PDZ3" CIF "xyz5/PDBDev_adtl_Datasets/Initial Model/6qjd.pdb.cif" 258 37 1 # _ihm_external_reference_info.associated_url https://zenodo.org/record/7125978 _ihm_external_reference_info.details . _ihm_external_reference_info.reference 10.5281/zenodo.7125978 _ihm_external_reference_info.reference_id 1 _ihm_external_reference_info.reference_provider Zenodo _ihm_external_reference_info.reference_type DOI _ihm_external_reference_info.refers_to File # loop_ _ihm_model_group.details _ihm_model_group.id _ihm_model_group.name . 1 A . 2 B # loop_ _ihm_model_group_link.group_id _ihm_model_group_link.model_id 1 1 1 2 2 3 2 4 # loop_ _ihm_model_list.assembly_id _ihm_model_list.model_id _ihm_model_list.model_name _ihm_model_list.protocol_id _ihm_model_list.representation_id 1 1 A 1 1 1 2 A 2 1 1 3 B 1 1 1 4 B 2 1 # _ihm_model_representation.details . _ihm_model_representation.id 1 _ihm_model_representation.name . # _ihm_model_representation_details.description . _ihm_model_representation_details.entity_asym_id A _ihm_model_representation_details.entity_description "PSD95 Wild-Type" _ihm_model_representation_details.entity_id 3 _ihm_model_representation_details.entity_poly_segment_id 4 _ihm_model_representation_details.id 1 _ihm_model_representation_details.model_granularity by-atom _ihm_model_representation_details.model_mode rigid _ihm_model_representation_details.model_object_count . _ihm_model_representation_details.model_object_primitive atomistic _ihm_model_representation_details.representation_id 1 _ihm_model_representation_details.starting_model_id 3 # loop_ _ihm_modeling_post_process.analysis_id _ihm_modeling_post_process.dataset_group_id _ihm_modeling_post_process.details _ihm_modeling_post_process.feature _ihm_modeling_post_process.feature_name _ihm_modeling_post_process.id _ihm_modeling_post_process.num_models_begin _ihm_modeling_post_process.num_models_end _ihm_modeling_post_process.protocol_id _ihm_modeling_post_process.script_file_id _ihm_modeling_post_process.software_id _ihm_modeling_post_process.step_id _ihm_modeling_post_process.struct_assembly_id _ihm_modeling_post_process.type 1 1 "Representative structures were filtered according to the calculated chi-squared between the simulated inter-dye (FRET) distances from AV simulations for docking structures and the experimental distance restraints (FRET Chi_Squared)" other "FRET Chi_Squared" 1 . 2 1 . 1 1 1 filter 1 1 "Representative structures were filtered according to the calculated chi-squared between the simulated inter-dye (FRET) distances from AV simulations for docking structures and the experimental distance restraints (FRET Chi_Squared)" other "FRET Chi_Squared" 2 . 2 2 . 1 1 1 filter # loop_ _ihm_modeling_protocol.details _ihm_modeling_protocol.id _ihm_modeling_protocol.num_steps _ihm_modeling_protocol.protocol_name . 1 1 "FRET-guided structural modeling" . 2 1 "FRET-guided structural modeling with disulfide mapping restraints" # loop_ _ihm_modeling_protocol_details.dataset_group_id _ihm_modeling_protocol_details.description _ihm_modeling_protocol_details.ensemble_flag _ihm_modeling_protocol_details.id _ihm_modeling_protocol_details.multi_scale_flag _ihm_modeling_protocol_details.multi_state_flag _ihm_modeling_protocol_details.num_models_begin _ihm_modeling_protocol_details.num_models_end _ihm_modeling_protocol_details.ordered_flag _ihm_modeling_protocol_details.protocol_id _ihm_modeling_protocol_details.script_file_id _ihm_modeling_protocol_details.software_id _ihm_modeling_protocol_details.step_id _ihm_modeling_protocol_details.step_method _ihm_modeling_protocol_details.step_name _ihm_modeling_protocol_details.struct_assembly_description _ihm_modeling_protocol_details.struct_assembly_id 1 . NO 1 NO YES . . NO 1 . 1 1 . "FRET-guided rigid body docking" . 1 1 . NO 2 NO YES . . NO 2 . 1 1 . "FRET-guided rigid body docking with disulfide mapping restraints" . 1 # loop_ _ihm_multi_state_model_group_link.model_group_id _ihm_multi_state_model_group_link.state_id 1 1 2 2 # loop_ _ihm_multi_state_modeling.details _ihm_multi_state_modeling.experiment_type _ihm_multi_state_modeling.population_fraction _ihm_multi_state_modeling.population_fraction_sd _ihm_multi_state_modeling.state_group_id _ihm_multi_state_modeling.state_id _ihm_multi_state_modeling.state_name _ihm_multi_state_modeling.state_type "PDZ3 localized near SH3" "Single molecule" 0.461 . 1 1 A "conformational change" "PDZ3 localized near GuK and SH3" "Single molecule" 0.539 . 1 2 B "conformational change" # loop_ _ihm_predicted_contact_restraint.asym_id_1 _ihm_predicted_contact_restraint.asym_id_2 _ihm_predicted_contact_restraint.comp_id_1 _ihm_predicted_contact_restraint.comp_id_2 _ihm_predicted_contact_restraint.dataset_list_id _ihm_predicted_contact_restraint.distance_lower_limit _ihm_predicted_contact_restraint.distance_upper_limit _ihm_predicted_contact_restraint.entity_description_1 _ihm_predicted_contact_restraint.entity_description_2 _ihm_predicted_contact_restraint.entity_id_1 _ihm_predicted_contact_restraint.entity_id_2 _ihm_predicted_contact_restraint.group_id _ihm_predicted_contact_restraint.id _ihm_predicted_contact_restraint.model_granularity _ihm_predicted_contact_restraint.probability _ihm_predicted_contact_restraint.rep_atom_1 _ihm_predicted_contact_restraint.rep_atom_2 _ihm_predicted_contact_restraint.restraint_type _ihm_predicted_contact_restraint.seq_id_1 _ihm_predicted_contact_restraint.seq_id_2 _ihm_predicted_contact_restraint.software_id A A ARG ARG 28 2 3 . . 3 3 1 1 by-residue . . . "lower and upper bound" 313 492 1 A A ASN ALA 29 2 3 . . 3 3 1 2 by-residue . . . "lower and upper bound" 326 504 1 A A GLY SER 30 2 3 . . 3 3 1 3 by-residue . . . "lower and upper bound" 329 500 1 A A GLY ASN 31 2 3 . . 3 3 2 4 by-residue . . . "lower and upper bound" 344 633 1 # _ihm_starting_comparative_models.alignment_file_id . _ihm_starting_comparative_models.details "Generated from continuous sequence (residue 428-724). Used with PDZ3 experimental structure (313-398) for rigid body docking." _ihm_starting_comparative_models.id 1 _ihm_starting_comparative_models.starting_model_auth_asym_id A _ihm_starting_comparative_models.starting_model_id 2 _ihm_starting_comparative_models.starting_model_seq_id_begin 428 _ihm_starting_comparative_models.starting_model_seq_id_end 724 _ihm_starting_comparative_models.template_auth_asym_id A _ihm_starting_comparative_models.template_dataset_list_id 35 _ihm_starting_comparative_models.template_seq_id_begin 428 _ihm_starting_comparative_models.template_seq_id_end 724 _ihm_starting_comparative_models.template_sequence_identity . _ihm_starting_comparative_models.template_sequence_identity_denominator . # loop_ _ihm_starting_model_details.asym_id _ihm_starting_model_details.dataset_list_id _ihm_starting_model_details.description _ihm_starting_model_details.entity_description _ihm_starting_model_details.entity_id _ihm_starting_model_details.entity_poly_segment_id _ihm_starting_model_details.starting_model_auth_asym_id _ihm_starting_model_details.starting_model_id _ihm_starting_model_details.starting_model_sequence_offset _ihm_starting_model_details.starting_model_source A 35 "Starting PDZ3 structure used in rigid body docking, prepared from PDB ID 6QJD" PDZ3 1 1 A 1 0 "experimental model" A 32 "SH3-GuK comparative model used for rigid body docking" "SH3-GuK comparative model used for rigid body docking" 2 2 A 2 0 "comparative model" A 33 "PDZ3 and SH3-GuK rigid bodies with PDZ3-SH3 linker deleted. Discontinuous at linker residues." "PDZ3 and SH3-GuK rigid bodies with PDZ3-SH3 linker deleted." 3 4 A 3 0 "integrative model" # _ihm_struct_assembly.description "Structures of the PSG Supramodule of Postsynaptic Density Protein 95 Resolved by Integrative FRET" _ihm_struct_assembly.id 1 _ihm_struct_assembly.name "Postsynaptic density protein 95" # loop_ _ihm_struct_assembly_details.assembly_id _ihm_struct_assembly_details.asym_id _ihm_struct_assembly_details.entity_description _ihm_struct_assembly_details.entity_id _ihm_struct_assembly_details.entity_poly_segment_id _ihm_struct_assembly_details.id _ihm_struct_assembly_details.parent_assembly_id 1 A "PSD95 Wild-Type" 3 4 1 1 # _software.citation_id . _software.classification "Model Building" _software.description "Toolkit for FRET-restrained modeling of biomolecules through rigid-body docking simulations that explicitly account for the spatial distributions of fluorophores" _software.location https://www.mpc.hhu.de/en/software/fps _software.name "FRET Positioning and Screening (FPS)" _software.pdbx_ordinal 1 _software.type program _software.version 1.100 # _struct.entry_id 9A2E _struct.pdbx_CASP_flag . _struct.pdbx_descriptor . _struct.pdbx_details . _struct.pdbx_model_details . _struct.pdbx_model_type_details . _struct.title "Structures of the PSG Supramodule of PSD-95 Resolved by Integrative FRET" _struct.pdbx_structure_determination_methodology integrative # _struct_asym.details "PDZ3-only structure for docking (PDZ3-SH3 linker removed) & SH3-GuK-only structure for docking (PDZ3-SH3 linker removed)" _struct_asym.entity_id 3 _struct_asym.id A _struct_asym.pdbx_PDB_id . _struct_asym.pdbx_alt_id . _struct_asym.pdbx_blank_PDB_chainid_flag . _struct_asym.pdbx_modified . _struct_asym.pdbx_order . _struct_asym.pdbx_type . # loop_ _struct_ref.db_code _struct_ref.db_name _struct_ref.details _struct_ref.entity_id _struct_ref.id _struct_ref.pdbx_align_begin _struct_ref.pdbx_db_accession _struct_ref.pdbx_seq_one_letter_code P78352 UNP . 3 1 1 P78352 MDCLCIVTTKKYRYQDEDTPPLEHSPAHLPNQANSPPVIVNTDTLEAPGYELQVNGTEGEMEYEEITLERGNSGLGFSIAGGTDNPHIGDDPSIFITKIIPGGAAAQDGRLRVNDSILFVNEVDVREVTHSAAVEALKEAGSIVRLYVMRRKPPAEKVMEIKLIKGPKGLGFSIAGGVGNQHIPGDNSIYVTKIIEGGAAHKDGRLQIGDKILAVNSVGLEDVMHEDAVAALKNTYDVVYLKVAKPSNAYLSDSYAPPDITTSYSQHLDNEISHSSYLGTDYPTAMTPTSPRRYSPVAKDLLGEEDIPREPRRIVIHRGSTGLGFNIVGGEDGEGIFISFILAGGPADLSGELRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVTIIAQYKPEEYSRFEAKIHDLREQLMNSSLGSGTASLRSNPKRGFYIRALFDYDKTKDCGFLSQALSFRFGDVLHVIDASDEEWWQARRVHSDSETDDIGFIPSKRRVERREWSRLKAKDWGSSSGSQGREDSVLSYETVTQMEVHYARPIIILGPTKDRANDDLLSEFPDKFGSCVPHTTRPKREYEIDGRDYHFVSSREKMEKDIQAHKFIEAGQYNSHLYGTSVQSVREVAEQGKHCILDVSANAVRRLQAAHLHPIAIFIRPRSLENVLEINKRITEEQARKAFDRATKLEQEFTECFSAIVEGDSFEEIYHKVKRVIEDLSGPYIWVPARERL P78352 UNP . 1 2 313 P78352 "RIVIHRGSTGLGFNIVGGEDGEGIFISFILAGGPADLSGELRKGDQILSVNGVDLRNASHEQAAIALKNA GQTVTIIAQYKPEEYS" P78352 UNP . 2 3 399 P78352 "RFEAKIHDLREQLMNSSLGSGTASLRSNPKRGFYIRALFDYDKTKDCGFLSQALSFRFGDVLHVIDASDE EWWQARRVHSDSETDDIGFIPSKRRVERREWSRLKAKDWGSSSGSQGREDSVLSYETVTQMEVHYARPII ILGPTKDRANDDLLSEFPDKFGSCVPHTTRPKREYEIDGRDYHFVSSREKMEKDIQAHKFIEAGQYNSHL YGTSVQSVREVAEQGKHCILDVSANAVRRLQAAHLHPIAIFIRPRSLENVLEINKRITEEQARKAFDRAT KLEQEFTECFSAIVEGDSFEEIYHKVKRVIEDLSGPYIWVPARERL" # loop_ _struct_ref_seq.align_id _struct_ref_seq.db_align_beg _struct_ref_seq.db_align_end _struct_ref_seq.ref_id _struct_ref_seq.seq_align_beg _struct_ref_seq.seq_align_end 1 1 724 1 1 724 2 313 398 1 313 398 3 399 724 1 399 724 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code A 3 1 MET 1 1 MET MET A . A 3 2 ASP 2 2 ASP ASP A . A 3 3 CYS 3 3 CYS CYS A . A 3 4 LEU 4 4 LEU LEU A . A 3 5 CYS 5 5 CYS CYS A . A 3 6 ILE 6 6 ILE ILE A . A 3 7 VAL 7 7 VAL VAL A . A 3 8 THR 8 8 THR THR A . A 3 9 THR 9 9 THR THR A . A 3 10 LYS 10 10 LYS LYS A . A 3 11 LYS 11 11 LYS LYS A . A 3 12 TYR 12 12 TYR TYR A . A 3 13 ARG 13 13 ARG ARG A . A 3 14 TYR 14 14 TYR TYR A . A 3 15 GLN 15 15 GLN GLN A . A 3 16 ASP 16 16 ASP ASP A . A 3 17 GLU 17 17 GLU GLU A . A 3 18 ASP 18 18 ASP ASP A . A 3 19 THR 19 19 THR THR A . A 3 20 PRO 20 20 PRO PRO A . A 3 21 PRO 21 21 PRO PRO A . A 3 22 LEU 22 22 LEU LEU A . A 3 23 GLU 23 23 GLU GLU A . A 3 24 HIS 24 24 HIS HIS A . A 3 25 SER 25 25 SER SER A . A 3 26 PRO 26 26 PRO PRO A . A 3 27 ALA 27 27 ALA ALA A . A 3 28 HIS 28 28 HIS HIS A . A 3 29 LEU 29 29 LEU LEU A . A 3 30 PRO 30 30 PRO PRO A . A 3 31 ASN 31 31 ASN ASN A . A 3 32 GLN 32 32 GLN GLN A . A 3 33 ALA 33 33 ALA ALA A . A 3 34 ASN 34 34 ASN ASN A . A 3 35 SER 35 35 SER SER A . A 3 36 PRO 36 36 PRO PRO A . A 3 37 PRO 37 37 PRO PRO A . A 3 38 VAL 38 38 VAL VAL A . A 3 39 ILE 39 39 ILE ILE A . A 3 40 VAL 40 40 VAL VAL A . A 3 41 ASN 41 41 ASN ASN A . A 3 42 THR 42 42 THR THR A . A 3 43 ASP 43 43 ASP ASP A . A 3 44 THR 44 44 THR THR A . A 3 45 LEU 45 45 LEU LEU A . A 3 46 GLU 46 46 GLU GLU A . A 3 47 ALA 47 47 ALA ALA A . A 3 48 PRO 48 48 PRO PRO A . A 3 49 GLY 49 49 GLY GLY A . A 3 50 TYR 50 50 TYR TYR A . A 3 51 GLU 51 51 GLU GLU A . A 3 52 LEU 52 52 LEU LEU A . A 3 53 GLN 53 53 GLN GLN A . A 3 54 VAL 54 54 VAL VAL A . A 3 55 ASN 55 55 ASN ASN A . A 3 56 GLY 56 56 GLY GLY A . A 3 57 THR 57 57 THR THR A . A 3 58 GLU 58 58 GLU GLU A . A 3 59 GLY 59 59 GLY GLY A . A 3 60 GLU 60 60 GLU GLU A . A 3 61 MET 61 61 MET MET A . A 3 62 GLU 62 62 GLU GLU A . A 3 63 TYR 63 63 TYR TYR A . A 3 64 GLU 64 64 GLU GLU A . A 3 65 GLU 65 65 GLU GLU A . A 3 66 ILE 66 66 ILE ILE A . A 3 67 THR 67 67 THR THR A . A 3 68 LEU 68 68 LEU LEU A . A 3 69 GLU 69 69 GLU GLU A . A 3 70 ARG 70 70 ARG ARG A . A 3 71 GLY 71 71 GLY GLY A . A 3 72 ASN 72 72 ASN ASN A . A 3 73 SER 73 73 SER SER A . A 3 74 GLY 74 74 GLY GLY A . A 3 75 LEU 75 75 LEU LEU A . A 3 76 GLY 76 76 GLY GLY A . A 3 77 PHE 77 77 PHE PHE A . A 3 78 SER 78 78 SER SER A . A 3 79 ILE 79 79 ILE ILE A . A 3 80 ALA 80 80 ALA ALA A . A 3 81 GLY 81 81 GLY GLY A . A 3 82 GLY 82 82 GLY GLY A . A 3 83 THR 83 83 THR THR A . A 3 84 ASP 84 84 ASP ASP A . A 3 85 ASN 85 85 ASN ASN A . A 3 86 PRO 86 86 PRO PRO A . A 3 87 HIS 87 87 HIS HIS A . A 3 88 ILE 88 88 ILE ILE A . A 3 89 GLY 89 89 GLY GLY A . A 3 90 ASP 90 90 ASP ASP A . A 3 91 ASP 91 91 ASP ASP A . A 3 92 PRO 92 92 PRO PRO A . A 3 93 SER 93 93 SER SER A . A 3 94 ILE 94 94 ILE ILE A . A 3 95 PHE 95 95 PHE PHE A . A 3 96 ILE 96 96 ILE ILE A . A 3 97 THR 97 97 THR THR A . A 3 98 LYS 98 98 LYS LYS A . A 3 99 ILE 99 99 ILE ILE A . A 3 100 ILE 100 100 ILE ILE A . A 3 101 PRO 101 101 PRO PRO A . A 3 102 GLY 102 102 GLY GLY A . A 3 103 GLY 103 103 GLY GLY A . A 3 104 ALA 104 104 ALA ALA A . A 3 105 ALA 105 105 ALA ALA A . A 3 106 ALA 106 106 ALA ALA A . A 3 107 GLN 107 107 GLN GLN A . A 3 108 ASP 108 108 ASP ASP A . A 3 109 GLY 109 109 GLY GLY A . A 3 110 ARG 110 110 ARG ARG A . A 3 111 LEU 111 111 LEU LEU A . A 3 112 ARG 112 112 ARG ARG A . A 3 113 VAL 113 113 VAL VAL A . A 3 114 ASN 114 114 ASN ASN A . A 3 115 ASP 115 115 ASP ASP A . A 3 116 SER 116 116 SER SER A . A 3 117 ILE 117 117 ILE ILE A . A 3 118 LEU 118 118 LEU LEU A . A 3 119 PHE 119 119 PHE PHE A . A 3 120 VAL 120 120 VAL VAL A . A 3 121 ASN 121 121 ASN ASN A . A 3 122 GLU 122 122 GLU GLU A . A 3 123 VAL 123 123 VAL VAL A . A 3 124 ASP 124 124 ASP ASP A . A 3 125 VAL 125 125 VAL VAL A . A 3 126 ARG 126 126 ARG ARG A . A 3 127 GLU 127 127 GLU GLU A . A 3 128 VAL 128 128 VAL VAL A . A 3 129 THR 129 129 THR THR A . A 3 130 HIS 130 130 HIS HIS A . A 3 131 SER 131 131 SER SER A . A 3 132 ALA 132 132 ALA ALA A . A 3 133 ALA 133 133 ALA ALA A . A 3 134 VAL 134 134 VAL VAL A . A 3 135 GLU 135 135 GLU GLU A . A 3 136 ALA 136 136 ALA ALA A . A 3 137 LEU 137 137 LEU LEU A . A 3 138 LYS 138 138 LYS LYS A . A 3 139 GLU 139 139 GLU GLU A . A 3 140 ALA 140 140 ALA ALA A . A 3 141 GLY 141 141 GLY GLY A . A 3 142 SER 142 142 SER SER A . A 3 143 ILE 143 143 ILE ILE A . A 3 144 VAL 144 144 VAL VAL A . A 3 145 ARG 145 145 ARG ARG A . A 3 146 LEU 146 146 LEU LEU A . A 3 147 TYR 147 147 TYR TYR A . A 3 148 VAL 148 148 VAL VAL A . A 3 149 MET 149 149 MET MET A . A 3 150 ARG 150 150 ARG ARG A . A 3 151 ARG 151 151 ARG ARG A . A 3 152 LYS 152 152 LYS LYS A . A 3 153 PRO 153 153 PRO PRO A . A 3 154 PRO 154 154 PRO PRO A . A 3 155 ALA 155 155 ALA ALA A . A 3 156 GLU 156 156 GLU GLU A . A 3 157 LYS 157 157 LYS LYS A . A 3 158 VAL 158 158 VAL VAL A . A 3 159 MET 159 159 MET MET A . A 3 160 GLU 160 160 GLU GLU A . A 3 161 ILE 161 161 ILE ILE A . A 3 162 LYS 162 162 LYS LYS A . A 3 163 LEU 163 163 LEU LEU A . A 3 164 ILE 164 164 ILE ILE A . A 3 165 LYS 165 165 LYS LYS A . A 3 166 GLY 166 166 GLY GLY A . A 3 167 PRO 167 167 PRO PRO A . A 3 168 LYS 168 168 LYS LYS A . A 3 169 GLY 169 169 GLY GLY A . A 3 170 LEU 170 170 LEU LEU A . A 3 171 GLY 171 171 GLY GLY A . A 3 172 PHE 172 172 PHE PHE A . A 3 173 SER 173 173 SER SER A . A 3 174 ILE 174 174 ILE ILE A . A 3 175 ALA 175 175 ALA ALA A . A 3 176 GLY 176 176 GLY GLY A . A 3 177 GLY 177 177 GLY GLY A . A 3 178 VAL 178 178 VAL VAL A . A 3 179 GLY 179 179 GLY GLY A . A 3 180 ASN 180 180 ASN ASN A . A 3 181 GLN 181 181 GLN GLN A . A 3 182 HIS 182 182 HIS HIS A . A 3 183 ILE 183 183 ILE ILE A . A 3 184 PRO 184 184 PRO PRO A . A 3 185 GLY 185 185 GLY GLY A . A 3 186 ASP 186 186 ASP ASP A . A 3 187 ASN 187 187 ASN ASN A . A 3 188 SER 188 188 SER SER A . A 3 189 ILE 189 189 ILE ILE A . A 3 190 TYR 190 190 TYR TYR A . A 3 191 VAL 191 191 VAL VAL A . A 3 192 THR 192 192 THR THR A . A 3 193 LYS 193 193 LYS LYS A . A 3 194 ILE 194 194 ILE ILE A . A 3 195 ILE 195 195 ILE ILE A . A 3 196 GLU 196 196 GLU GLU A . A 3 197 GLY 197 197 GLY GLY A . A 3 198 GLY 198 198 GLY GLY A . A 3 199 ALA 199 199 ALA ALA A . A 3 200 ALA 200 200 ALA ALA A . A 3 201 HIS 201 201 HIS HIS A . A 3 202 LYS 202 202 LYS LYS A . A 3 203 ASP 203 203 ASP ASP A . A 3 204 GLY 204 204 GLY GLY A . A 3 205 ARG 205 205 ARG ARG A . A 3 206 LEU 206 206 LEU LEU A . A 3 207 GLN 207 207 GLN GLN A . A 3 208 ILE 208 208 ILE ILE A . A 3 209 GLY 209 209 GLY GLY A . A 3 210 ASP 210 210 ASP ASP A . A 3 211 LYS 211 211 LYS LYS A . A 3 212 ILE 212 212 ILE ILE A . A 3 213 LEU 213 213 LEU LEU A . A 3 214 ALA 214 214 ALA ALA A . A 3 215 VAL 215 215 VAL VAL A . A 3 216 ASN 216 216 ASN ASN A . A 3 217 SER 217 217 SER SER A . A 3 218 VAL 218 218 VAL VAL A . A 3 219 GLY 219 219 GLY GLY A . A 3 220 LEU 220 220 LEU LEU A . A 3 221 GLU 221 221 GLU GLU A . A 3 222 ASP 222 222 ASP ASP A . A 3 223 VAL 223 223 VAL VAL A . A 3 224 MET 224 224 MET MET A . A 3 225 HIS 225 225 HIS HIS A . A 3 226 GLU 226 226 GLU GLU A . A 3 227 ASP 227 227 ASP ASP A . A 3 228 ALA 228 228 ALA ALA A . A 3 229 VAL 229 229 VAL VAL A . A 3 230 ALA 230 230 ALA ALA A . A 3 231 ALA 231 231 ALA ALA A . A 3 232 LEU 232 232 LEU LEU A . A 3 233 LYS 233 233 LYS LYS A . A 3 234 ASN 234 234 ASN ASN A . A 3 235 THR 235 235 THR THR A . A 3 236 TYR 236 236 TYR TYR A . A 3 237 ASP 237 237 ASP ASP A . A 3 238 VAL 238 238 VAL VAL A . A 3 239 VAL 239 239 VAL VAL A . A 3 240 TYR 240 240 TYR TYR A . A 3 241 LEU 241 241 LEU LEU A . A 3 242 LYS 242 242 LYS LYS A . A 3 243 VAL 243 243 VAL VAL A . A 3 244 ALA 244 244 ALA ALA A . A 3 245 LYS 245 245 LYS LYS A . A 3 246 PRO 246 246 PRO PRO A . A 3 247 SER 247 247 SER SER A . A 3 248 ASN 248 248 ASN ASN A . A 3 249 ALA 249 249 ALA ALA A . A 3 250 TYR 250 250 TYR TYR A . A 3 251 LEU 251 251 LEU LEU A . A 3 252 SER 252 252 SER SER A . A 3 253 ASP 253 253 ASP ASP A . A 3 254 SER 254 254 SER SER A . A 3 255 TYR 255 255 TYR TYR A . A 3 256 ALA 256 256 ALA ALA A . A 3 257 PRO 257 257 PRO PRO A . A 3 258 PRO 258 258 PRO PRO A . A 3 259 ASP 259 259 ASP ASP A . A 3 260 ILE 260 260 ILE ILE A . A 3 261 THR 261 261 THR THR A . A 3 262 THR 262 262 THR THR A . A 3 263 SER 263 263 SER SER A . A 3 264 TYR 264 264 TYR TYR A . A 3 265 SER 265 265 SER SER A . A 3 266 GLN 266 266 GLN GLN A . A 3 267 HIS 267 267 HIS HIS A . A 3 268 LEU 268 268 LEU LEU A . A 3 269 ASP 269 269 ASP ASP A . A 3 270 ASN 270 270 ASN ASN A . A 3 271 GLU 271 271 GLU GLU A . A 3 272 ILE 272 272 ILE ILE A . A 3 273 SER 273 273 SER SER A . A 3 274 HIS 274 274 HIS HIS A . A 3 275 SER 275 275 SER SER A . A 3 276 SER 276 276 SER SER A . A 3 277 TYR 277 277 TYR TYR A . A 3 278 LEU 278 278 LEU LEU A . A 3 279 GLY 279 279 GLY GLY A . A 3 280 THR 280 280 THR THR A . A 3 281 ASP 281 281 ASP ASP A . A 3 282 TYR 282 282 TYR TYR A . A 3 283 PRO 283 283 PRO PRO A . A 3 284 THR 284 284 THR THR A . A 3 285 ALA 285 285 ALA ALA A . A 3 286 MET 286 286 MET MET A . A 3 287 THR 287 287 THR THR A . A 3 288 PRO 288 288 PRO PRO A . A 3 289 THR 289 289 THR THR A . A 3 290 SER 290 290 SER SER A . A 3 291 PRO 291 291 PRO PRO A . A 3 292 ARG 292 292 ARG ARG A . A 3 293 ARG 293 293 ARG ARG A . A 3 294 TYR 294 294 TYR TYR A . A 3 295 SER 295 295 SER SER A . A 3 296 PRO 296 296 PRO PRO A . A 3 297 VAL 297 297 VAL VAL A . A 3 298 ALA 298 298 ALA ALA A . A 3 299 LYS 299 299 LYS LYS A . A 3 300 ASP 300 300 ASP ASP A . A 3 301 LEU 301 301 LEU LEU A . A 3 302 LEU 302 302 LEU LEU A . A 3 303 GLY 303 303 GLY GLY A . A 3 304 GLU 304 304 GLU GLU A . A 3 305 GLU 305 305 GLU GLU A . A 3 306 ASP 306 306 ASP ASP A . A 3 307 ILE 307 307 ILE ILE A . A 3 308 PRO 308 308 PRO PRO A . A 3 309 ARG 309 309 ARG ARG A . A 3 310 GLU 310 310 GLU GLU A . A 3 311 PRO 311 311 PRO PRO A . A 3 312 ARG 312 312 ARG ARG A . A 3 313 ARG 313 313 ARG ARG A . A 3 314 ILE 314 314 ILE ILE A . A 3 315 VAL 315 315 VAL VAL A . A 3 316 ILE 316 316 ILE ILE A . A 3 317 HIS 317 317 HIS HIS A . A 3 318 ARG 318 318 ARG ARG A . A 3 319 GLY 319 319 GLY GLY A . A 3 320 SER 320 320 SER SER A . A 3 321 THR 321 321 THR THR A . A 3 322 GLY 322 322 GLY GLY A . A 3 323 LEU 323 323 LEU LEU A . A 3 324 GLY 324 324 GLY GLY A . A 3 325 PHE 325 325 PHE PHE A . A 3 326 ASN 326 326 ASN ASN A . A 3 327 ILE 327 327 ILE ILE A . A 3 328 VAL 328 328 VAL VAL A . A 3 329 GLY 329 329 GLY GLY A . A 3 330 GLY 330 330 GLY GLY A . A 3 331 GLU 331 331 GLU GLU A . A 3 332 ASP 332 332 ASP ASP A . A 3 333 GLY 333 333 GLY GLY A . A 3 334 GLU 334 334 GLU GLU A . A 3 335 GLY 335 335 GLY GLY A . A 3 336 ILE 336 336 ILE ILE A . A 3 337 PHE 337 337 PHE PHE A . A 3 338 ILE 338 338 ILE ILE A . A 3 339 SER 339 339 SER SER A . A 3 340 PHE 340 340 PHE PHE A . A 3 341 ILE 341 341 ILE ILE A . A 3 342 LEU 342 342 LEU LEU A . A 3 343 ALA 343 343 ALA ALA A . A 3 344 GLY 344 344 GLY GLY A . A 3 345 GLY 345 345 GLY GLY A . A 3 346 PRO 346 346 PRO PRO A . A 3 347 ALA 347 347 ALA ALA A . A 3 348 ASP 348 348 ASP ASP A . A 3 349 LEU 349 349 LEU LEU A . A 3 350 SER 350 350 SER SER A . A 3 351 GLY 351 351 GLY GLY A . A 3 352 GLU 352 352 GLU GLU A . A 3 353 LEU 353 353 LEU LEU A . A 3 354 ARG 354 354 ARG ARG A . A 3 355 LYS 355 355 LYS LYS A . A 3 356 GLY 356 356 GLY GLY A . A 3 357 ASP 357 357 ASP ASP A . A 3 358 GLN 358 358 GLN GLN A . A 3 359 ILE 359 359 ILE ILE A . A 3 360 LEU 360 360 LEU LEU A . A 3 361 SER 361 361 SER SER A . A 3 362 VAL 362 362 VAL VAL A . A 3 363 ASN 363 363 ASN ASN A . A 3 364 GLY 364 364 GLY GLY A . A 3 365 VAL 365 365 VAL VAL A . A 3 366 ASP 366 366 ASP ASP A . A 3 367 LEU 367 367 LEU LEU A . A 3 368 ARG 368 368 ARG ARG A . A 3 369 ASN 369 369 ASN ASN A . A 3 370 ALA 370 370 ALA ALA A . A 3 371 SER 371 371 SER SER A . A 3 372 HIS 372 372 HIS HIS A . A 3 373 GLU 373 373 GLU GLU A . A 3 374 GLN 374 374 GLN GLN A . A 3 375 ALA 375 375 ALA ALA A . A 3 376 ALA 376 376 ALA ALA A . A 3 377 ILE 377 377 ILE ILE A . A 3 378 ALA 378 378 ALA ALA A . A 3 379 LEU 379 379 LEU LEU A . A 3 380 LYS 380 380 LYS LYS A . A 3 381 ASN 381 381 ASN ASN A . A 3 382 ALA 382 382 ALA ALA A . A 3 383 GLY 383 383 GLY GLY A . A 3 384 GLN 384 384 GLN GLN A . A 3 385 THR 385 385 THR THR A . A 3 386 VAL 386 386 VAL VAL A . A 3 387 THR 387 387 THR THR A . A 3 388 ILE 388 388 ILE ILE A . A 3 389 ILE 389 389 ILE ILE A . A 3 390 ALA 390 390 ALA ALA A . A 3 391 GLN 391 391 GLN GLN A . A 3 392 TYR 392 392 TYR TYR A . A 3 393 LYS 393 393 LYS LYS A . A 3 394 PRO 394 394 PRO PRO A . A 3 395 GLU 395 395 GLU GLU A . A 3 396 GLU 396 396 GLU GLU A . A 3 397 TYR 397 397 TYR TYR A . A 3 398 SER 398 398 SER SER A . A 3 399 ARG 399 399 ARG ARG A . A 3 400 PHE 400 400 PHE PHE A . A 3 401 GLU 401 401 GLU GLU A . A 3 402 ALA 402 402 ALA ALA A . A 3 403 LYS 403 403 LYS LYS A . A 3 404 ILE 404 404 ILE ILE A . A 3 405 HIS 405 405 HIS HIS A . A 3 406 ASP 406 406 ASP ASP A . A 3 407 LEU 407 407 LEU LEU A . A 3 408 ARG 408 408 ARG ARG A . A 3 409 GLU 409 409 GLU GLU A . A 3 410 GLN 410 410 GLN GLN A . A 3 411 LEU 411 411 LEU LEU A . A 3 412 MET 412 412 MET MET A . A 3 413 ASN 413 413 ASN ASN A . A 3 414 SER 414 414 SER SER A . A 3 415 SER 415 415 SER SER A . A 3 416 LEU 416 416 LEU LEU A . A 3 417 GLY 417 417 GLY GLY A . A 3 418 SER 418 418 SER SER A . A 3 419 GLY 419 419 GLY GLY A . A 3 420 THR 420 420 THR THR A . A 3 421 ALA 421 421 ALA ALA A . A 3 422 SER 422 422 SER SER A . A 3 423 LEU 423 423 LEU LEU A . A 3 424 ARG 424 424 ARG ARG A . A 3 425 SER 425 425 SER SER A . A 3 426 ASN 426 426 ASN ASN A . A 3 427 PRO 427 427 PRO PRO A . A 3 428 LYS 428 428 LYS LYS A . A 3 429 ARG 429 429 ARG ARG A . A 3 430 GLY 430 430 GLY GLY A . A 3 431 PHE 431 431 PHE PHE A . A 3 432 TYR 432 432 TYR TYR A . A 3 433 ILE 433 433 ILE ILE A . A 3 434 ARG 434 434 ARG ARG A . A 3 435 ALA 435 435 ALA ALA A . A 3 436 LEU 436 436 LEU LEU A . A 3 437 PHE 437 437 PHE PHE A . A 3 438 ASP 438 438 ASP ASP A . A 3 439 TYR 439 439 TYR TYR A . A 3 440 ASP 440 440 ASP ASP A . A 3 441 LYS 441 441 LYS LYS A . A 3 442 THR 442 442 THR THR A . A 3 443 LYS 443 443 LYS LYS A . A 3 444 ASP 444 444 ASP ASP A . A 3 445 CYS 445 445 CYS CYS A . A 3 446 GLY 446 446 GLY GLY A . A 3 447 PHE 447 447 PHE PHE A . A 3 448 LEU 448 448 LEU LEU A . A 3 449 SER 449 449 SER SER A . A 3 450 GLN 450 450 GLN GLN A . A 3 451 ALA 451 451 ALA ALA A . A 3 452 LEU 452 452 LEU LEU A . A 3 453 SER 453 453 SER SER A . A 3 454 PHE 454 454 PHE PHE A . A 3 455 ARG 455 455 ARG ARG A . A 3 456 PHE 456 456 PHE PHE A . A 3 457 GLY 457 457 GLY GLY A . A 3 458 ASP 458 458 ASP ASP A . A 3 459 VAL 459 459 VAL VAL A . A 3 460 LEU 460 460 LEU LEU A . A 3 461 HIS 461 461 HIS HIS A . A 3 462 VAL 462 462 VAL VAL A . A 3 463 ILE 463 463 ILE ILE A . A 3 464 ASP 464 464 ASP ASP A . A 3 465 ALA 465 465 ALA ALA A . A 3 466 SER 466 466 SER SER A . A 3 467 ASP 467 467 ASP ASP A . A 3 468 GLU 468 468 GLU GLU A . A 3 469 GLU 469 469 GLU GLU A . A 3 470 TRP 470 470 TRP TRP A . A 3 471 TRP 471 471 TRP TRP A . A 3 472 GLN 472 472 GLN GLN A . A 3 473 ALA 473 473 ALA ALA A . A 3 474 ARG 474 474 ARG ARG A . A 3 475 ARG 475 475 ARG ARG A . A 3 476 VAL 476 476 VAL VAL A . A 3 477 HIS 477 477 HIS HIS A . A 3 478 SER 478 478 SER SER A . A 3 479 ASP 479 479 ASP ASP A . A 3 480 SER 480 480 SER SER A . A 3 481 GLU 481 481 GLU GLU A . A 3 482 THR 482 482 THR THR A . A 3 483 ASP 483 483 ASP ASP A . A 3 484 ASP 484 484 ASP ASP A . A 3 485 ILE 485 485 ILE ILE A . A 3 486 GLY 486 486 GLY GLY A . A 3 487 PHE 487 487 PHE PHE A . A 3 488 ILE 488 488 ILE ILE A . A 3 489 PRO 489 489 PRO PRO A . A 3 490 SER 490 490 SER SER A . A 3 491 LYS 491 491 LYS LYS A . A 3 492 ARG 492 492 ARG ARG A . A 3 493 ARG 493 493 ARG ARG A . A 3 494 VAL 494 494 VAL VAL A . A 3 495 GLU 495 495 GLU GLU A . A 3 496 ARG 496 496 ARG ARG A . A 3 497 ARG 497 497 ARG ARG A . A 3 498 GLU 498 498 GLU GLU A . A 3 499 TRP 499 499 TRP TRP A . A 3 500 SER 500 500 SER SER A . A 3 501 ARG 501 501 ARG ARG A . A 3 502 LEU 502 502 LEU LEU A . A 3 503 LYS 503 503 LYS LYS A . A 3 504 ALA 504 504 ALA ALA A . A 3 505 LYS 505 505 LYS LYS A . A 3 506 ASP 506 506 ASP ASP A . A 3 507 TRP 507 507 TRP TRP A . A 3 508 GLY 508 508 GLY GLY A . A 3 509 SER 509 509 SER SER A . A 3 510 SER 510 510 SER SER A . A 3 511 SER 511 511 SER SER A . A 3 512 GLY 512 512 GLY GLY A . A 3 513 SER 513 513 SER SER A . A 3 514 GLN 514 514 GLN GLN A . A 3 515 GLY 515 515 GLY GLY A . A 3 516 ARG 516 516 ARG ARG A . A 3 517 GLU 517 517 GLU GLU A . A 3 518 ASP 518 518 ASP ASP A . A 3 519 SER 519 519 SER SER A . A 3 520 VAL 520 520 VAL VAL A . A 3 521 LEU 521 521 LEU LEU A . A 3 522 SER 522 522 SER SER A . A 3 523 TYR 523 523 TYR TYR A . A 3 524 GLU 524 524 GLU GLU A . A 3 525 THR 525 525 THR THR A . A 3 526 VAL 526 526 VAL VAL A . A 3 527 THR 527 527 THR THR A . A 3 528 GLN 528 528 GLN GLN A . A 3 529 MET 529 529 MET MET A . A 3 530 GLU 530 530 GLU GLU A . A 3 531 VAL 531 531 VAL VAL A . A 3 532 HIS 532 532 HIS HIS A . A 3 533 TYR 533 533 TYR TYR A . A 3 534 ALA 534 534 ALA ALA A . A 3 535 ARG 535 535 ARG ARG A . A 3 536 PRO 536 536 PRO PRO A . A 3 537 ILE 537 537 ILE ILE A . A 3 538 ILE 538 538 ILE ILE A . A 3 539 ILE 539 539 ILE ILE A . A 3 540 LEU 540 540 LEU LEU A . A 3 541 GLY 541 541 GLY GLY A . A 3 542 PRO 542 542 PRO PRO A . A 3 543 THR 543 543 THR THR A . A 3 544 LYS 544 544 LYS LYS A . A 3 545 ASP 545 545 ASP ASP A . A 3 546 ARG 546 546 ARG ARG A . A 3 547 ALA 547 547 ALA ALA A . A 3 548 ASN 548 548 ASN ASN A . A 3 549 ASP 549 549 ASP ASP A . A 3 550 ASP 550 550 ASP ASP A . A 3 551 LEU 551 551 LEU LEU A . A 3 552 LEU 552 552 LEU LEU A . A 3 553 SER 553 553 SER SER A . A 3 554 GLU 554 554 GLU GLU A . A 3 555 PHE 555 555 PHE PHE A . A 3 556 PRO 556 556 PRO PRO A . A 3 557 ASP 557 557 ASP ASP A . A 3 558 LYS 558 558 LYS LYS A . A 3 559 PHE 559 559 PHE PHE A . A 3 560 GLY 560 560 GLY GLY A . A 3 561 SER 561 561 SER SER A . A 3 562 CYS 562 562 CYS CYS A . A 3 563 VAL 563 563 VAL VAL A . A 3 564 PRO 564 564 PRO PRO A . A 3 565 HIS 565 565 HIS HIS A . A 3 566 THR 566 566 THR THR A . A 3 567 THR 567 567 THR THR A . A 3 568 ARG 568 568 ARG ARG A . A 3 569 PRO 569 569 PRO PRO A . A 3 570 LYS 570 570 LYS LYS A . A 3 571 ARG 571 571 ARG ARG A . A 3 572 GLU 572 572 GLU GLU A . A 3 573 TYR 573 573 TYR TYR A . A 3 574 GLU 574 574 GLU GLU A . A 3 575 ILE 575 575 ILE ILE A . A 3 576 ASP 576 576 ASP ASP A . A 3 577 GLY 577 577 GLY GLY A . A 3 578 ARG 578 578 ARG ARG A . A 3 579 ASP 579 579 ASP ASP A . A 3 580 TYR 580 580 TYR TYR A . A 3 581 HIS 581 581 HIS HIS A . A 3 582 PHE 582 582 PHE PHE A . A 3 583 VAL 583 583 VAL VAL A . A 3 584 SER 584 584 SER SER A . A 3 585 SER 585 585 SER SER A . A 3 586 ARG 586 586 ARG ARG A . A 3 587 GLU 587 587 GLU GLU A . A 3 588 LYS 588 588 LYS LYS A . A 3 589 MET 589 589 MET MET A . A 3 590 GLU 590 590 GLU GLU A . A 3 591 LYS 591 591 LYS LYS A . A 3 592 ASP 592 592 ASP ASP A . A 3 593 ILE 593 593 ILE ILE A . A 3 594 GLN 594 594 GLN GLN A . A 3 595 ALA 595 595 ALA ALA A . A 3 596 HIS 596 596 HIS HIS A . A 3 597 LYS 597 597 LYS LYS A . A 3 598 PHE 598 598 PHE PHE A . A 3 599 ILE 599 599 ILE ILE A . A 3 600 GLU 600 600 GLU GLU A . A 3 601 ALA 601 601 ALA ALA A . A 3 602 GLY 602 602 GLY GLY A . A 3 603 GLN 603 603 GLN GLN A . A 3 604 TYR 604 604 TYR TYR A . A 3 605 ASN 605 605 ASN ASN A . A 3 606 SER 606 606 SER SER A . A 3 607 HIS 607 607 HIS HIS A . A 3 608 LEU 608 608 LEU LEU A . A 3 609 TYR 609 609 TYR TYR A . A 3 610 GLY 610 610 GLY GLY A . A 3 611 THR 611 611 THR THR A . A 3 612 SER 612 612 SER SER A . A 3 613 VAL 613 613 VAL VAL A . A 3 614 GLN 614 614 GLN GLN A . A 3 615 SER 615 615 SER SER A . A 3 616 VAL 616 616 VAL VAL A . A 3 617 ARG 617 617 ARG ARG A . A 3 618 GLU 618 618 GLU GLU A . A 3 619 VAL 619 619 VAL VAL A . A 3 620 ALA 620 620 ALA ALA A . A 3 621 GLU 621 621 GLU GLU A . A 3 622 GLN 622 622 GLN GLN A . A 3 623 GLY 623 623 GLY GLY A . A 3 624 LYS 624 624 LYS LYS A . A 3 625 HIS 625 625 HIS HIS A . A 3 626 CYS 626 626 CYS CYS A . A 3 627 ILE 627 627 ILE ILE A . A 3 628 LEU 628 628 LEU LEU A . A 3 629 ASP 629 629 ASP ASP A . A 3 630 VAL 630 630 VAL VAL A . A 3 631 SER 631 631 SER SER A . A 3 632 ALA 632 632 ALA ALA A . A 3 633 ASN 633 633 ASN ASN A . A 3 634 ALA 634 634 ALA ALA A . A 3 635 VAL 635 635 VAL VAL A . A 3 636 ARG 636 636 ARG ARG A . A 3 637 ARG 637 637 ARG ARG A . A 3 638 LEU 638 638 LEU LEU A . A 3 639 GLN 639 639 GLN GLN A . A 3 640 ALA 640 640 ALA ALA A . A 3 641 ALA 641 641 ALA ALA A . A 3 642 HIS 642 642 HIS HIS A . A 3 643 LEU 643 643 LEU LEU A . A 3 644 HIS 644 644 HIS HIS A . A 3 645 PRO 645 645 PRO PRO A . A 3 646 ILE 646 646 ILE ILE A . A 3 647 ALA 647 647 ALA ALA A . A 3 648 ILE 648 648 ILE ILE A . A 3 649 PHE 649 649 PHE PHE A . A 3 650 ILE 650 650 ILE ILE A . A 3 651 ARG 651 651 ARG ARG A . A 3 652 PRO 652 652 PRO PRO A . A 3 653 ARG 653 653 ARG ARG A . A 3 654 SER 654 654 SER SER A . A 3 655 LEU 655 655 LEU LEU A . A 3 656 GLU 656 656 GLU GLU A . A 3 657 ASN 657 657 ASN ASN A . A 3 658 VAL 658 658 VAL VAL A . A 3 659 LEU 659 659 LEU LEU A . A 3 660 GLU 660 660 GLU GLU A . A 3 661 ILE 661 661 ILE ILE A . A 3 662 ASN 662 662 ASN ASN A . A 3 663 LYS 663 663 LYS LYS A . A 3 664 ARG 664 664 ARG ARG A . A 3 665 ILE 665 665 ILE ILE A . A 3 666 THR 666 666 THR THR A . A 3 667 GLU 667 667 GLU GLU A . A 3 668 GLU 668 668 GLU GLU A . A 3 669 GLN 669 669 GLN GLN A . A 3 670 ALA 670 670 ALA ALA A . A 3 671 ARG 671 671 ARG ARG A . A 3 672 LYS 672 672 LYS LYS A . A 3 673 ALA 673 673 ALA ALA A . A 3 674 PHE 674 674 PHE PHE A . A 3 675 ASP 675 675 ASP ASP A . A 3 676 ARG 676 676 ARG ARG A . A 3 677 ALA 677 677 ALA ALA A . A 3 678 THR 678 678 THR THR A . A 3 679 LYS 679 679 LYS LYS A . A 3 680 LEU 680 680 LEU LEU A . A 3 681 GLU 681 681 GLU GLU A . A 3 682 GLN 682 682 GLN GLN A . A 3 683 GLU 683 683 GLU GLU A . A 3 684 PHE 684 684 PHE PHE A . A 3 685 THR 685 685 THR THR A . A 3 686 GLU 686 686 GLU GLU A . A 3 687 CYS 687 687 CYS CYS A . A 3 688 PHE 688 688 PHE PHE A . A 3 689 SER 689 689 SER SER A . A 3 690 ALA 690 690 ALA ALA A . A 3 691 ILE 691 691 ILE ILE A . A 3 692 VAL 692 692 VAL VAL A . A 3 693 GLU 693 693 GLU GLU A . A 3 694 GLY 694 694 GLY GLY A . A 3 695 ASP 695 695 ASP ASP A . A 3 696 SER 696 696 SER SER A . A 3 697 PHE 697 697 PHE PHE A . A 3 698 GLU 698 698 GLU GLU A . A 3 699 GLU 699 699 GLU GLU A . A 3 700 ILE 700 700 ILE ILE A . A 3 701 TYR 701 701 TYR TYR A . A 3 702 HIS 702 702 HIS HIS A . A 3 703 LYS 703 703 LYS LYS A . A 3 704 VAL 704 704 VAL VAL A . A 3 705 LYS 705 705 LYS LYS A . A 3 706 ARG 706 706 ARG ARG A . A 3 707 VAL 707 707 VAL VAL A . A 3 708 ILE 708 708 ILE ILE A . A 3 709 GLU 709 709 GLU GLU A . A 3 710 ASP 710 710 ASP ASP A . A 3 711 LEU 711 711 LEU LEU A . A 3 712 SER 712 712 SER SER A . A 3 713 GLY 713 713 GLY GLY A . A 3 714 PRO 714 714 PRO PRO A . A 3 715 TYR 715 715 TYR TYR A . A 3 716 ILE 716 716 ILE ILE A . A 3 717 TRP 717 717 TRP TRP A . A 3 718 VAL 718 718 VAL VAL A . A 3 719 PRO 719 719 PRO PRO A . A 3 720 ALA 720 720 ALA ALA A . A 3 721 ARG 721 721 ARG ARG A . A 3 722 GLU 722 722 GLU GLU A . A 3 723 ARG 723 723 ARG ARG A . A 3 724 LEU 724 724 LEU LEU A . # # loop_ # # loop_ _flr_experiment.ordinal_id _flr_experiment.id _flr_experiment.instrument_id _flr_experiment.inst_setting_id _flr_experiment.exp_condition_id _flr_experiment.sample_id _flr_experiment.details 1 1 1 1 1 1 'Sub-ensemble time-correlated single-photon-counting (seTCSPC) FRET measurements' 2 1 1 1 1 2 'Sub-ensemble time-correlated single-photon-counting (seTCSPC) FRET measurements' 3 1 1 1 1 3 'Sub-ensemble time-correlated single-photon-counting (seTCSPC) FRET measurements' 4 1 1 1 1 4 'Sub-ensemble time-correlated single-photon-counting (seTCSPC) FRET measurements' 5 1 1 1 1 5 'Sub-ensemble time-correlated single-photon-counting (seTCSPC) FRET measurements' 6 1 1 1 1 6 'Sub-ensemble time-correlated single-photon-counting (seTCSPC) FRET measurements' 7 1 1 1 1 7 'Sub-ensemble time-correlated single-photon-counting (seTCSPC) FRET measurements' 8 1 1 1 1 8 'Sub-ensemble time-correlated single-photon-counting (seTCSPC) FRET measurements' 9 1 1 1 1 9 'Sub-ensemble time-correlated single-photon-counting (seTCSPC) FRET measurements' 10 1 1 1 1 10 'Sub-ensemble time-correlated single-photon-counting (seTCSPC) FRET measurements' 11 1 1 1 1 11 'Sub-ensemble time-correlated single-photon-counting (seTCSPC) FRET measurements' 12 1 1 1 1 12 'Sub-ensemble time-correlated single-photon-counting (seTCSPC) FRET measurements' 13 1 1 1 1 13 'Sub-ensemble time-correlated single-photon-counting (seTCSPC) FRET measurements' 14 1 1 1 1 14 'Sub-ensemble time-correlated single-photon-counting (seTCSPC) FRET measurements' 15 1 1 1 1 15 'Sub-ensemble time-correlated single-photon-counting (seTCSPC) FRET measurements' 16 1 1 1 1 16 'Sub-ensemble time-correlated single-photon-counting (seTCSPC) FRET measurements' 17 1 1 1 1 17 'Sub-ensemble time-correlated single-photon-counting (seTCSPC) FRET measurements' 18 1 1 1 1 18 'Sub-ensemble time-correlated single-photon-counting (seTCSPC) FRET measurements' # # loop_ _flr_inst_setting.id _flr_inst_setting.details 1 'Two confocal setups were used, as indicated in the publication corresponding to these structures. In the first setup, freely diffusing molecules were excited as they passed through the focal volume of a 60x, 1.2NA collar corrected Olympus objective. Excitation was achieved via pulsed interleaved excitation with diode lasers (PicoQuant, Germany) at 485 nm (80 uW) and 640 (32 uW) nm for donor and acceptor, respectively, pulsed at 20MHz. Emission was spatially filtered with a 60um or 100um pinhole, separated into color and polarization channels via ET525/50 and ET720/150 band pass filters (Chroma Technology Co.), and collected into four detectors (one for each channel), PMA Hybrid 40 (PicoQuant, Germany) for donor and PMA Hybrid 50 (PicoQuant, Germany) for acceptor. Temporal data registration was achieved vi HydraHarp 400 TCSPC module (PicoQuant, Germany). The second confocal setup was similar but utilized PIE at 32MHz with the same laser lines. Data registration utilized 4 detectors per color channel, APD SPCM-AQR-14 (Perkin Elmer, Germany) for red and tau-SPAD (PicoQuant, Germany) for green. ' # # loop_ _flr_exp_condition.id _flr_exp_condition.details 1 'Measurements carried out at room temperature.' # # loop_ _flr_instrument.id _flr_instrument.details 1 'Samples were measured on a home-built multiparameter fluorescence detection setup. Samples were excited via pulsed-interleaved excitation and fluorescence emission was collected in 4 collection channels corresponding to polarization and color separation useing time-correlated single-photon counting electronics.' # # loop_ _flr_entity_assembly.ordinal_id _flr_entity_assembly.assembly_id _flr_entity_assembly.entity_id _flr_entity_assembly.num_copies _flr_entity_assembly.entity_description 1 1 1 1 . 2 1 2 1 . 3 2 3 1 . # # loop_ _flr_sample_condition.id _flr_sample_condition.details 1 'PBS pH 7.5, ~10pM sample' # # loop_ _flr_sample.id _flr_sample.entity_assembly_id _flr_sample.num_of_probes _flr_sample.sample_condition_id _flr_sample.sample_description _flr_sample.sample_details _flr_sample.solvent_phase 1 1 2 1 'State A Restraint for PSD95 R313C-S606C' . liquid 2 1 2 1 'State A Restraint for PSD95 R313C-E618C' . liquid 3 1 2 1 'State A Restraint for PSD95 R313C-E621C' . liquid 4 1 2 1 'State A Restraint for PSD95 Q374C-R492C' . liquid 5 1 2 1 'State A Restraint for PSD95 Q374C-K591C' . liquid 6 1 2 1 'State A Restraint for PSD95 Q374C-R671C' . liquid 7 1 2 1 'State A Restraint for PSD95 S398C-R492C' . liquid 8 1 2 1 'State A Restraint for PSD95 S398C-E621C' . liquid 9 1 2 1 'State A Restraint for PSD95 S398C-A640C' . liquid 10 1 2 1 'State B Restraint for PSD95 R313C-S606C' . liquid 11 1 2 1 'State B Restraint for PSD95 R313C-E618C' . liquid 12 1 2 1 'State B Restraint for PSD95 R313C-E621C' . liquid 13 1 2 1 'State B Restraint for PSD95 Q374C-R492C' . liquid 14 1 2 1 'State B Restraint for PSD95 Q374C-K591C' . liquid 15 1 2 1 'State B Restraint for PSD95 Q374C-R671C' . liquid 16 1 2 1 'State B Restraint for PSD95 S398C-R492C' . liquid 17 1 2 1 'State B Restraint for PSD95 S398C-E621C' . liquid 18 1 2 1 'State B Restraint for PSD95 S398C-A640C' . liquid 19 2 1 1 'Donor-only subensemble' . liquid # # loop_ _flr_probe_list.probe_id _flr_probe_list.chromophore_name _flr_probe_list.reactive_probe_flag _flr_probe_list.reactive_probe_name _flr_probe_list.probe_origin _flr_probe_list.probe_link_type 1 'Alexa-488 C5-maleimide' YES 'Alexa-488 C5-maleimide' intrinsic covalent 2 'Alexa-647 C2-maleimide' YES 'Alexa-647 C2-maleimide' extrinsic covalent 3 'Alexa-488 C5-maleimide' YES 'Alexa-488 C5-maleimide' extrinsic covalent # # loop_ _flr_probe_descriptor.probe_id _flr_probe_descriptor.reactive_probe_chem_descriptor_id _flr_probe_descriptor.chromophore_chem_descriptor_id _flr_probe_descriptor.chromophore_center_atom 1 1 2 . 2 3 4 . 3 1 2 . # # loop_ _flr_sample_probe_details.sample_probe_id _flr_sample_probe_details.sample_id _flr_sample_probe_details.probe_id _flr_sample_probe_details.fluorophore_type _flr_sample_probe_details.description _flr_sample_probe_details.poly_probe_position_id 1 1 1 donor 'Donor for PSD95 R313C-S606C' 1 2 1 2 acceptor 'Acceptor for PSD95 R313C-S606C' 2 3 2 1 donor 'Donor for PSD95 R313C-E618C' 1 4 2 2 acceptor 'Acceptor for PSD95 R313C-E618C' 3 5 3 1 donor 'Donor for PSD95 R313C-E621C' 1 6 3 2 acceptor 'Acceptor for PSD95 R313C-E621C' 4 7 4 1 donor 'Donor for PSD95 Q374C-R492C' 5 8 4 2 acceptor 'Acceptor for PSD95 Q374C-R492C' 6 9 5 1 donor 'Donor for PSD95 Q374C-K591C' 5 10 5 2 acceptor 'Acceptor for PSD95 Q374C-K591C' 7 11 6 1 donor 'Donor for PSD95 Q374C-R671C' 5 12 6 2 acceptor 'Acceptor for PSD95 Q374C-R671C' 8 13 7 1 donor 'Donor for PSD95 S398C-R492C' 9 14 7 2 acceptor 'Acceptor for PSD95 S398C-R492C' 6 15 8 1 donor 'Donor for PSD95 S398C-E621C' 9 16 8 2 acceptor 'Acceptor for PSD95 S398C-E621C' 4 17 9 1 donor 'Donor for PSD95 S398C-A640C' 9 18 9 2 acceptor 'Acceptor for PSD95 S398C-A640C' 10 19 10 1 donor 'Donor for PSD95 R313C-S606C' 1 20 10 2 acceptor 'Acceptor for PSD95 R313C-S606C' 2 21 11 1 donor 'Donor for PSD95 R313C-E618C' 1 22 11 2 acceptor 'Acceptor for PSD95 R313C-E618C' 3 23 12 1 donor 'Donor for PSD95 R313C-E621C' 1 24 12 2 acceptor 'Acceptor for PSD95 R313C-E621C' 4 25 13 1 donor 'Donor for PSD95 Q374C-R492C' 5 26 13 2 acceptor 'Acceptor for PSD95 Q374C-R492C' 6 27 14 1 donor 'Donor for PSD95 Q374C-K591C' 5 28 14 2 acceptor 'Acceptor for PSD95 Q374C-K591C' 7 29 15 1 donor 'Donor for PSD95 Q374C-R671C' 5 30 15 2 acceptor 'Acceptor for PSD95 Q374C-R671C' 8 31 16 1 donor 'Donor for PSD95 S398C-R492C' 9 32 16 2 acceptor 'Acceptor for PSD95 S398C-R492C' 6 33 17 1 donor 'Donor for PSD95 S398C-E621C' 9 34 17 2 acceptor 'Acceptor for PSD95 S398C-E621C' 4 35 18 1 donor 'Donor for PSD95 S398C-A640C' 9 36 18 2 acceptor 'Acceptor for PSD95 S398C-A640C' 10 37 19 3 donor 'Donor Reference PSD95 R313C-S606C Mutant' 11 38 19 3 donor 'Donor Reference PSD95 R313C-E618C Mutant' 12 39 19 3 donor 'Donor Reference PSD95 R313C-E621C Mutant' 13 40 19 3 donor 'Donor Reference PSD95 Q374C-R492C Mutant' 14 41 19 3 donor 'Donor Reference PSD95 Q374C-K591C Mutant' 15 42 19 3 donor 'Donor Reference PSD95 Q374C-R671C Mutant' 16 43 19 3 donor 'Donor Reference PSD95 S398C-R492C Mutant' 17 44 19 3 donor 'Donor Reference PSD95 S398C-E621C Mutant' 18 45 19 3 donor 'Donor Reference PSD95 S398C-A640C Mutant' 19 # # loop_ _flr_poly_probe_position.id _flr_poly_probe_position.entity_id _flr_poly_probe_position.entity_description _flr_poly_probe_position.asym_id _flr_poly_probe_position.seq_id _flr_poly_probe_position.comp_id _flr_poly_probe_position.atom_id _flr_poly_probe_position.mutation_flag _flr_poly_probe_position.modification_flag _flr_poly_probe_position.auth_name 1 3 . A 313 ARG SG YES NO 313 2 3 . A 606 SER SG YES NO 606 3 3 . A 618 GLU SG YES NO 618 4 3 . A 621 GLU SG YES NO 621 5 3 . A 374 GLN SG YES NO 374 6 3 . A 492 ARG SG YES NO 492 7 3 . A 591 LYS SG YES NO 591 8 3 . A 671 ARG SG YES NO 671 9 3 . A 398 SER SG YES NO 398 10 3 . A 640 ALA SG YES NO 640 11 3 . A 313 ARG SG YES NO R313C-S606C 12 3 . A 313 ARG SG YES NO R313C-E618C 13 3 . A 313 ARG SG YES NO R313C-E621C 14 3 . A 374 GLN SG YES NO Q374C-R492C 15 3 . A 374 GLN SG YES NO Q374C-K591C 16 3 . A 374 GLN SG YES NO Q374C-R671C 17 3 . A 398 SER SG YES NO S398C-R492C 18 3 . A 398 SER SG YES NO S398C-E621C 19 3 . A 398 SER SG YES NO S398C-A640C # # loop_ _flr_poly_probe_position_mutated.id _flr_poly_probe_position_mutated.chem_comp_id _flr_poly_probe_position_mutated.atom_id 1 CYS SG 2 CYS SG 3 CYS SG 4 CYS SG 5 CYS SG 6 CYS SG 7 CYS SG 8 CYS SG 9 CYS SG 10 CYS SG 11 CYS SG 12 CYS SG 13 CYS SG 14 CYS SG 15 CYS SG 16 CYS SG 17 CYS SG 18 CYS SG 19 CYS SG # # loop_ _flr_poly_probe_conjugate.id _flr_poly_probe_conjugate.sample_probe_id _flr_poly_probe_conjugate.chem_descriptor_id _flr_poly_probe_conjugate.ambiguous_stoichiometry_flag _flr_poly_probe_conjugate.probe_stoichiometry 1 37 5 YES . 2 38 5 YES . 3 39 5 YES . 4 40 5 YES . 5 41 5 YES . 6 42 5 YES . 7 43 5 YES . 8 44 5 YES . 9 45 5 YES . 10 1 5 YES . 11 3 5 YES . 12 5 5 YES . 13 7 5 YES . 14 9 5 YES . 15 11 5 YES . 16 13 5 YES . 17 15 5 YES . 18 17 5 YES . 19 19 5 YES . 20 21 5 YES . 21 23 5 YES . 22 25 5 YES . 23 27 5 YES . 24 29 5 YES . 25 31 5 YES . 26 33 5 YES . 27 35 5 YES . 28 2 6 YES . 29 4 6 YES . 30 6 6 YES . 31 8 6 YES . 32 10 6 YES . 33 12 6 YES . 34 14 6 YES . 35 16 6 YES . 36 18 6 YES . 37 20 6 YES . 38 22 6 YES . 39 24 6 YES . 40 26 6 YES . 41 28 6 YES . 42 30 6 YES . 43 32 6 YES . 44 34 6 YES . 45 36 6 YES . # # loop_ _flr_fret_forster_radius.id _flr_fret_forster_radius.donor_probe_id _flr_fret_forster_radius.acceptor_probe_id _flr_fret_forster_radius.forster_radius _flr_fret_forster_radius.reduced_forster_radius 1 1 2 52.000 . 2 1 2 52.000 . 3 1 2 52.000 . 4 1 2 52.000 . 5 1 2 52.000 . 6 1 2 52.000 . 7 1 2 52.000 . 8 1 2 52.000 . 9 1 2 52.000 . 10 1 2 52.000 . 11 1 2 52.000 . 12 1 2 52.000 . 13 1 2 52.000 . 14 1 2 52.000 . 15 1 2 52.000 . 16 1 2 52.000 . 17 1 2 52.000 . 18 1 2 52.000 . # # loop_ _flr_lifetime_fit_model.id _flr_lifetime_fit_model.name _flr_lifetime_fit_model.description _flr_lifetime_fit_model.external_file_id _flr_lifetime_fit_model.citation_id 1 'Global Lifetime Fit' . . 1 # # loop_ _flr_reference_measurement_group.id _flr_reference_measurement_group.num_measurements _flr_reference_measurement_group.details 1 1 1 2 1 2 3 1 3 4 1 4 5 1 5 6 1 6 7 1 7 8 1 8 9 1 9 # # loop_ _flr_reference_measurement_group_link.group_id _flr_reference_measurement_group_link.reference_measurement_id 1 1 2 2 3 3 4 4 5 5 6 6 7 7 8 8 9 9 # # loop_ _flr_reference_measurement.id _flr_reference_measurement.reference_sample_probe_id _flr_reference_measurement.num_species _flr_reference_measurement.details 1 37 1 'Donly for PSD95 R313C-S606C Mutant' 2 38 1 'Donly for PSD95 R313C-E618C Mutant' 3 39 1 'Donly for PSD95 R313C-E621C Mutant' 4 40 1 'Donly for PSD95 Q374C-R492C Mutant' 5 41 1 'Donly for PSD95 Q374C-K591C Mutant' 6 42 1 'Donly for PSD95 Q374C-R671C Mutant' 7 43 1 'Donly for PSD95 S398C-R492C Mutant' 8 44 1 'Donly for PSD95 S398C-E621C Mutant' 9 45 1 'Donly for PSD95 S398C-A640C Mutant' # # loop_ _flr_reference_measurement_lifetime.ordinal_id _flr_reference_measurement_lifetime.reference_measurement_id _flr_reference_measurement_lifetime.species_name _flr_reference_measurement_lifetime.species_fraction _flr_reference_measurement_lifetime.lifetime 1 1 . 1.000 3.769 2 2 . 1.000 3.559 3 3 . 1.000 3.792 4 4 . 1.000 3.375 5 5 . 1.000 3.590 6 6 . 1.000 3.598 7 7 . 1.000 4.040 8 8 . 1.000 3.759 9 9 . 1.000 3.855 # # loop_ _flr_fret_analysis.id _flr_fret_analysis.experiment_id _flr_fret_analysis.type _flr_fret_analysis.sample_probe_id_1 _flr_fret_analysis.sample_probe_id_2 _flr_fret_analysis.forster_radius_id _flr_fret_analysis.dataset_list_id _flr_fret_analysis.external_file_id _flr_fret_analysis.software_id 1 1 lifetime-based 1 2 1 1 1 1 2 1 lifetime-based 3 4 2 1 2 1 3 1 lifetime-based 5 6 3 1 3 1 4 1 lifetime-based 7 8 4 1 4 1 5 1 lifetime-based 9 10 5 1 5 1 6 1 lifetime-based 11 12 6 1 6 1 7 1 lifetime-based 13 14 7 1 7 1 8 1 lifetime-based 15 16 8 1 8 1 9 1 lifetime-based 17 18 9 1 9 1 10 1 lifetime-based 19 20 10 1 1 1 11 1 lifetime-based 21 22 11 1 2 1 12 1 lifetime-based 23 24 12 1 3 1 13 1 lifetime-based 25 26 13 1 4 1 14 1 lifetime-based 27 28 14 1 5 1 15 1 lifetime-based 29 30 15 1 6 1 16 1 lifetime-based 31 32 16 1 7 1 17 1 lifetime-based 33 34 17 1 8 1 18 1 lifetime-based 35 36 18 1 9 1 # # loop_ _flr_fret_analysis_lifetime.ordinal_id _flr_fret_analysis_lifetime.analysis_id _flr_fret_analysis_lifetime.reference_measurement_group_id _flr_fret_analysis_lifetime.lifetime_fit_model_id _flr_fret_analysis_lifetime.donor_only_fraction _flr_fret_analysis_lifetime.chi_square_reduced _flr_fret_analysis_lifetime.method_name _flr_fret_analysis_lifetime.details 1 1 1 1 . 1.150 'Lifetime Fit' . 2 2 2 1 . 2.120 'Lifetime Fit' . 3 3 3 1 . 2.110 'Lifetime Fit' . 4 4 4 1 . 1.960 'Lifetime Fit' . 5 5 5 1 . 1.220 'Lifetime Fit' . 6 6 6 1 . 2.540 'Lifetime Fit' . 7 7 7 1 . 0.450 'Lifetime Fit' . 8 8 8 1 . 1.490 'Lifetime Fit' . 9 9 9 1 . 1.130 'Lifetime Fit' . 10 10 1 1 . 1.150 'Lifetime Fit' . 11 11 2 1 . 2.120 'Lifetime Fit' . 12 12 3 1 . 2.110 'Lifetime Fit' . 13 13 4 1 . 1.960 'Lifetime Fit' . 14 14 5 1 . 1.220 'Lifetime Fit' . 15 15 6 1 . 2.540 'Lifetime Fit' . 16 16 7 1 . 0.450 'Lifetime Fit' . 17 17 8 1 . 1.490 'Lifetime Fit' . 18 18 9 1 . 1.130 'Lifetime Fit' . # # loop_ _flr_peak_assignment.id _flr_peak_assignment.method_name _flr_peak_assignment.details 1 Population 'In global fit, peaks were assigned to states through setting of a global population fraction parameter per state' # # loop_ _flr_fret_distance_restraint.ordinal_id _flr_fret_distance_restraint.id _flr_fret_distance_restraint.group_id _flr_fret_distance_restraint.sample_probe_id_1 _flr_fret_distance_restraint.sample_probe_id_2 _flr_fret_distance_restraint.state_id _flr_fret_distance_restraint.analysis_id _flr_fret_distance_restraint.distance _flr_fret_distance_restraint.distance_error_plus _flr_fret_distance_restraint.distance_error_minus _flr_fret_distance_restraint.distance_type _flr_fret_distance_restraint.population_fraction _flr_fret_distance_restraint.peak_assignment_id 1 1 1 1 2 1 1 76.900 7.400 7.400 0.461 1 2 2 1 3 4 1 2 79.800 9.800 9.800 0.461 1 3 3 1 5 6 1 3 83.300 5.200 5.200 0.461 1 4 4 1 7 8 1 4 37.400 3.500 3.500 0.461 1 5 5 1 9 10 1 5 84.700 7.000 7.000 0.461 1 6 6 1 11 12 1 6 64.000 2.000 2.000 0.461 1 7 7 1 13 14 1 7 33.800 6.000 6.000 0.461 1 8 8 1 15 16 1 8 60.400 2.900 2.900 0.461 1 9 9 1 17 18 1 9 57.100 3.200 3.200 0.461 1 10 10 1 19 20 2 10 30.600 4.500 4.500 0.539 1 11 11 2 21 22 2 11 44.200 8.300 8.300 0.539 1 12 12 2 23 24 2 12 45.100 5.800 5.800 0.539 1 13 13 2 25 26 2 13 55.600 1.600 1.600 0.539 1 14 14 2 27 28 2 14 37.800 3.800 3.800 0.539 1 15 15 2 29 30 2 15 36.600 4.400 4.400 0.539 1 16 16 2 31 32 2 16 52.600 2.100 2.100 0.539 1 17 17 2 33 34 2 17 38.500 1.100 1.100 0.539 1 18 18 2 35 36 2 18 35.000 6.000 6.000 0.539 1 # # loop_ _flr_fret_model_quality.model_id _flr_fret_model_quality.chi_square_reduced _flr_fret_model_quality.dataset_group_id _flr_fret_model_quality.method _flr_fret_model_quality.details 1 1.040 1 Chi-square 'Calculated using all 9 FRET distances' 2 1.070 1 Chi-square 'Calculated using all 9 FRET distances' 3 1.120 1 Chi-square 'Calculated using all 9 FRET distances' 4 1.150 1 Chi-square 'Calculated using all 9 FRET distances' # # loop_ _flr_fret_model_distance.id _flr_fret_model_distance.restraint_id _flr_fret_model_distance.model_id _flr_fret_model_distance.distance _flr_fret_model_distance.distance_deviation 1 1 1 78.600 -1.700 2 2 1 81.900 -2.100 3 3 1 79.900 3.400 4 4 1 38.600 -1.200 5 5 1 90.300 -5.600 6 6 1 69.600 -5.600 7 7 1 33.100 0.700 8 8 1 64.600 -4.200 9 9 1 55.800 1.300 10 1 2 78.700 -1.800 11 2 2 81.900 -2.100 12 3 2 80.000 3.300 13 4 2 38.600 -1.200 14 5 2 90.300 -5.600 15 6 2 69.700 -5.700 16 7 2 33.100 0.700 17 8 2 64.700 -4.300 18 9 2 55.900 1.200 19 10 3 29.400 1.200 20 11 3 43.300 0.900 21 12 3 44.900 0.200 22 13 3 54.500 1.100 23 14 3 41.900 -4.100 24 15 3 37.800 -1.200 25 16 3 59.300 -6.700 26 17 3 38.700 -0.200 27 18 3 31.400 3.600 28 10 4 29.400 1.200 29 11 4 43.300 0.900 30 12 4 44.900 0.200 31 13 4 54.500 1.100 32 14 4 41.900 -4.100 33 15 4 37.800 -1.200 34 16 4 59.400 -6.800 35 17 4 38.700 -0.200 36 18 4 31.300 3.700 # # loop_ _flr_FPS_modeling.id _flr_FPS_modeling.ihm_modeling_protocol_ordinal_id _flr_FPS_modeling.restraint_group_id _flr_FPS_modeling.global_parameter_id _flr_FPS_modeling.probe_modeling_method _flr_FPS_modeling.details 1 1 1 1 AV3 'FRET-guided rigid body docking' 2 1 1 2 AV3 'FRET-guided rigid body docking with disulfide mapping restraints' 3 1 2 1 AV3 'FRET-guided rigid body docking' 4 1 2 2 AV3 'FRET-guided rigid body docking with disulfide mapping restraints' # # loop_ _flr_FPS_global_parameter.id _flr_FPS_global_parameter.forster_radius_value _flr_FPS_global_parameter.conversion_function_polynom_order _flr_FPS_global_parameter.repetition _flr_FPS_global_parameter.AV_grid_rel _flr_FPS_global_parameter.AV_min_grid_A _flr_FPS_global_parameter.AV_allowed_sphere _flr_FPS_global_parameter.AV_search_nodes _flr_FPS_global_parameter.AV_E_samples_k _flr_FPS_global_parameter.sim_viscosity_adjustment _flr_FPS_global_parameter.sim_dt_adjustment _flr_FPS_global_parameter.sim_max_iter_k _flr_FPS_global_parameter.sim_max_force _flr_FPS_global_parameter.sim_clash_tolerance_A _flr_FPS_global_parameter.sim_reciprocal_kT _flr_FPS_global_parameter.sim_clash_potential _flr_FPS_global_parameter.convergence_E _flr_FPS_global_parameter.convergence_K _flr_FPS_global_parameter.convergence_F _flr_FPS_global_parameter.convergence_T 1 52 3 10000 0.200 0.400 0.500 3 200 1 1 200 400 1 10 '"^2"' 100 0.001 0.001 0.020 2 52 3 10000 0.200 0.400 0.500 3 200 1 1 200 400 1 10 '"^2"' 100 0.001 0.001 0.020 # # loop_ _flr_FPS_AV_parameter.id _flr_FPS_AV_parameter.num_linker_atoms _flr_FPS_AV_parameter.linker_length _flr_FPS_AV_parameter.linker_width _flr_FPS_AV_parameter.probe_radius_1 _flr_FPS_AV_parameter.probe_radius_2 _flr_FPS_AV_parameter.probe_radius_3 1 10 20.500 4.500 5.000 4.500 1.500 2 12 21.000 4.500 7.150 4.500 1.500 # # loop_ _flr_FPS_AV_modeling.id _flr_FPS_AV_modeling.sample_probe_id _flr_FPS_AV_modeling.FPS_modeling_id _flr_FPS_AV_modeling.parameter_id 1 1 1 1 2 1 2 1 3 2 1 2 4 2 2 2 5 3 1 1 6 3 2 1 7 4 1 2 8 4 2 2 9 5 1 1 10 5 2 1 11 6 1 2 12 6 2 2 13 7 1 1 14 7 2 1 15 8 1 2 16 8 2 2 17 9 1 1 18 9 2 1 19 10 1 2 20 10 2 2 21 11 1 1 22 11 2 1 23 12 1 2 24 12 2 2 25 13 1 1 26 13 2 1 27 14 1 2 28 14 2 2 29 15 1 1 30 15 2 1 31 16 1 2 32 16 2 2 33 17 1 1 34 17 2 1 35 18 1 2 36 18 2 2 37 19 1 1 38 19 2 1 39 20 1 2 40 20 2 2 41 21 3 1 42 21 4 1 43 22 3 2 44 22 4 2 45 23 3 1 46 23 4 1 47 24 3 2 48 24 4 2 49 25 3 1 50 25 4 1 51 26 3 2 52 26 4 2 53 27 3 1 54 27 4 1 55 28 3 2 56 28 4 2 57 29 3 1 58 29 4 1 59 30 3 2 60 30 4 2 61 31 3 1 62 31 4 1 63 32 3 2 64 32 4 2 65 33 3 1 66 33 4 1 67 34 3 2 68 34 4 2 69 35 3 1 70 35 4 1 71 36 3 2 72 36 4 2 #