data_9A2F # _entry.id 9A2F # loop_ _atom_type.symbol C H N O S # loop_ _audit_author.name _audit_author.pdbx_ordinal "Hamilton, G." 1 " Saikia, N." 2 " Basak, S." 3 " Welcome, F. S." 4 " Wu, F." 5 " Kubiak, J." 6 " Zhang, C." 7 " Hao, Y." 8 " Seidel, C. A. M." 9 " Ding, F." 10 " Sanabria, H." 11 " Bowen, M. E." 12 # loop_ _audit_conform.dict_location _audit_conform.dict_name _audit_conform.dict_version https://mmcif.wwpdb.org/dictionaries/ascii/mmcif_ihm_ext.dic mmcif_ihm_ext.dic 1.26 http://mmcif.wwpdb.org/dictionaries/ascii/mmcif_pdbx_v50.dic mmcif_pdbx.dic 5.395 # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB-Dev PDBDEV_00000164 PDBDEV_00000164 ? PDB 9A2F pdb_00009a2f 10.2210/pdb9a2f/pdb # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 9A2F _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2022-09-14 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2022-10-28 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _chem_comp.formula _chem_comp.formula_weight _chem_comp.id _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.type "C3 H7 N O2" 89.094 ALA . ALANINE . "L-peptide linking" "C6 H15 N4 O2 1" 175.212 ARG . ARGININE . "L-peptide linking" "C4 H8 N2 O3" 132.119 ASN . ASPARAGINE . "L-peptide linking" "C4 H7 N O4" 133.103 ASP . "ASPARTIC ACID" . "L-peptide linking" "C3 H7 N O2 S" 121.154 CYS . CYSTEINE . "L-peptide linking" "C5 H10 N2 O3" 146.146 GLN . GLUTAMINE . "L-peptide linking" "C5 H9 N O4" 147.13 GLU . "GLUTAMIC ACID" . "L-peptide linking" "C2 H5 N O2" 75.067 GLY . GLYCINE . "peptide linking" "C6 H10 N3 O2 1" 156.165 HIS . HISTIDINE . "L-peptide linking" "C6 H13 N O2" 131.175 ILE . ISOLEUCINE . "L-peptide linking" "C6 H13 N O2" 131.175 LEU . LEUCINE . "L-peptide linking" "C6 H15 N2 O2 1" 147.198 LYS . LYSINE . "L-peptide linking" "C5 H11 N O2 S" 149.208 MET . METHIONINE . "L-peptide linking" "C9 H11 N O2" 165.192 PHE . PHENYLALANINE . "L-peptide linking" "C5 H9 N O2" 115.132 PRO . PROLINE . "L-peptide linking" "C3 H7 N O3" 105.093 SER . SERINE . "L-peptide linking" "C4 H9 N O3" 119.12 THR . THREONINE . "L-peptide linking" "C11 H12 N2 O2" 204.229 TRP . TRYPTOPHAN . "L-peptide linking" "C9 H11 N O3" 181.191 TYR . TYROSINE . "L-peptide linking" "C5 H11 N O2" 117.148 VAL . VALINE . "L-peptide linking" # loop_ _citation.country _citation.id _citation.journal_abbrev _citation.journal_id_ASTM _citation.journal_id_CSD _citation.journal_id_ISSN _citation.journal_issue _citation.journal_volume _citation.page_first _citation.page_last _citation.pdbx_database_id_DOI _citation.pdbx_database_id_PubMed _citation.title _citation.year . 1 eLife . . . . . . . 10.7554/eLife.77242 36069777 "Fuzzy Supertertiary Interactions within PSD-95 Enable Ligand Binding" 2022 . 2 . . . . . . . . 10.1016/j.bpj.2018.11.1815 . "Automated and optimally FRET-assisted structural modeling" . # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal 1 "Hamilton, G." 1 1 " Saikia, N." 2 1 " Basak, S." 3 1 " Welcome, F. S." 4 1 " Wu, F." 5 1 " Kubiak, J." 6 1 " Zhang, C." 7 1 " Hao, Y." 8 1 " Seidel, C. A. M." 9 1 " Ding, F." 10 1 " Sanabria, H." 11 1 " Bowen, M. E." 12 2 "Dimura, M." 13 2 "Peulen, T.-O." 14 2 "Sanabria, H." 15 2 "Rodnin, D." 16 2 "Hemmen, K." 17 2 "Hanke, C.A." 18 2 "Seidel, C.A.M." 19 2 "Gohlke, H." 20 # loop_ _entity.details _entity.formula_weight _entity.id _entity.pdbx_description _entity.pdbx_number_of_molecules _entity.src_method _entity.type . 54907.082 1 "Postsynaptic density protein 95 (PSD95) PDZ3-SH3-GuK Module" 1 MAN polymer . 93630.28 2 "Postsynaptic density protein 95 (PSD95) Wild-Type" 1 MAN polymer # loop_ _entity_poly.entity_id _entity_poly.nstd_chirality _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_sequence_evidence_code _entity_poly.pdbx_strand_id _entity_poly.type 1 . NO NO PREPRRIVIHRGSTGLGFNIVGGEDGEGIFISFILAGGPADLSGELRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVTIIAQYKPEEYSRFEAKIHDLREQLMNSSLGSGTASLRSNPKRGFYIRALFDYDKTKDCGFLSQALSFRFGDVLHVIDASDEEWWQARRVHSDSETDDIGFIPSKRRVERREWSRLKAKDWGSSSGSQGREDSVLSYETVTQMEVHYARPIIILGPTKDRANDDLLSEFPDKFGSCVPHTTRPKREYEIDGRDYHFVSSREKMEKDIQAHKFIEAGQYNSHLYGTSVQSVREVAEQGKHCILDVSANAVRRLQAAHLHPIAIFIRPRSLENVLEINKRITEEQARKAFDRATKLEQEFTECFSAIVEGDSFEEIYHKVKRVIEDLSGPYIWVPARERL PREPRRIVIHRGSTGLGFNIVGGEDGEGIFISFILAGGPADLSGELRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVTIIAQYKPEEYSRFEAKIHDLREQLMNSSLGSGTASLRSNPKRGFYIRALFDYDKTKDCGFLSQALSFRFGDVLHVIDASDEEWWQARRVHSDSETDDIGFIPSKRRVERREWSRLKAKDWGSSSGSQGREDSVLSYETVTQMEVHYARPIIILGPTKDRANDDLLSEFPDKFGSCVPHTTRPKREYEIDGRDYHFVSSREKMEKDIQAHKFIEAGQYNSHLYGTSVQSVREVAEQGKHCILDVSANAVRRLQAAHLHPIAIFIRPRSLENVLEINKRITEEQARKAFDRATKLEQEFTECFSAIVEGDSFEEIYHKVKRVIEDLSGPYIWVPARERL . A polypeptide(L) 2 . NO NO MDCLCIVTTKKYRYQDEDTPPLEHSPAHLPNQANSPPVIVNTDTLEAPGYELQVNGTEGEMEYEEITLERGNSGLGFSIAGGTDNPHIGDDPSIFITKIIPGGAAAQDGRLRVNDSILFVNEVDVREVTHSAAVEALKEAGSIVRLYVMRRKPPAEKVMEIKLIKGPKGLGFSIAGGVGNQHIPGDNSIYVTKIIEGGAAHKDGRLQIGDKILAVNSVGLEDVMHEDAVAALKNTYDVVYLKVAKPSNAYLSDSYAPPDITTSYSQHLDNEISHSSYLGTDYPTAMTPTSPRRYSPVAKDLLGEEDIPREPRRIVIHRGSTGLGFNIVGGEDGEGIFISFILAGGPADLSGELRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVTIIAQYKPEEYSRFEAKIHDLREQLMNSSLGSGTASLRSNPKRGFYIRALFDYDKTKDCGFLSQALSFRFGDVLHVIDASDEEWWQARRVHSDSETDDIGFIPSKRRVERREWSRLKAKDWGSSSGSQGREDSVLSYETVTQMEVHYARPIIILGPTKDRANDDLLSEFPDKFGSCVPHTTRPKREYEIDGRDYHFVSSREKMEKDIQAHKFIEAGQYNSHLYGTSVQSVREVAEQGKHCILDVSANAVRRLQAAHLHPIAIFIRPRSLENVLEINKRITEEQARKAFDRATKLEQEFTECFSAIVEGDSFEEIYHKVKRVIEDLSGPYIWVPARERL MDCLCIVTTKKYRYQDEDTPPLEHSPAHLPNQANSPPVIVNTDTLEAPGYELQVNGTEGEMEYEEITLERGNSGLGFSIAGGTDNPHIGDDPSIFITKIIPGGAAAQDGRLRVNDSILFVNEVDVREVTHSAAVEALKEAGSIVRLYVMRRKPPAEKVMEIKLIKGPKGLGFSIAGGVGNQHIPGDNSIYVTKIIEGGAAHKDGRLQIGDKILAVNSVGLEDVMHEDAVAALKNTYDVVYLKVAKPSNAYLSDSYAPPDITTSYSQHLDNEISHSSYLGTDYPTAMTPTSPRRYSPVAKDLLGEEDIPREPRRIVIHRGSTGLGFNIVGGEDGEGIFISFILAGGPADLSGELRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVTIIAQYKPEEYSRFEAKIHDLREQLMNSSLGSGTASLRSNPKRGFYIRALFDYDKTKDCGFLSQALSFRFGDVLHVIDASDEEWWQARRVHSDSETDDIGFIPSKRRVERREWSRLKAKDWGSSSGSQGREDSVLSYETVTQMEVHYARPIIILGPTKDRANDDLLSEFPDKFGSCVPHTTRPKREYEIDGRDYHFVSSREKMEKDIQAHKFIEAGQYNSHLYGTSVQSVREVAEQGKHCILDVSANAVRRLQAAHLHPIAIFIRPRSLENVLEINKRITEEQARKAFDRATKLEQEFTECFSAIVEGDSFEEIYHKVKRVIEDLSGPYIWVPARERL . . polypeptide(L) # loop_ _entity_poly_seq.entity_id _entity_poly_seq.hetero _entity_poly_seq.mon_id _entity_poly_seq.num 1 . PRO 1 1 . ARG 2 1 . GLU 3 1 . PRO 4 1 . ARG 5 1 . ARG 6 1 . ILE 7 1 . VAL 8 1 . ILE 9 1 . HIS 10 1 . ARG 11 1 . GLY 12 1 . SER 13 1 . THR 14 1 . GLY 15 1 . LEU 16 1 . GLY 17 1 . PHE 18 1 . ASN 19 1 . ILE 20 1 . VAL 21 1 . GLY 22 1 . GLY 23 1 . GLU 24 1 . ASP 25 1 . GLY 26 1 . GLU 27 1 . GLY 28 1 . ILE 29 1 . PHE 30 1 . ILE 31 1 . SER 32 1 . PHE 33 1 . ILE 34 1 . LEU 35 1 . ALA 36 1 . GLY 37 1 . GLY 38 1 . PRO 39 1 . ALA 40 1 . ASP 41 1 . LEU 42 1 . SER 43 1 . GLY 44 1 . GLU 45 1 . LEU 46 1 . ARG 47 1 . LYS 48 1 . GLY 49 1 . ASP 50 1 . GLN 51 1 . ILE 52 1 . LEU 53 1 . SER 54 1 . VAL 55 1 . ASN 56 1 . GLY 57 1 . VAL 58 1 . ASP 59 1 . LEU 60 1 . ARG 61 1 . ASN 62 1 . ALA 63 1 . SER 64 1 . HIS 65 1 . GLU 66 1 . GLN 67 1 . ALA 68 1 . ALA 69 1 . ILE 70 1 . ALA 71 1 . LEU 72 1 . LYS 73 1 . ASN 74 1 . ALA 75 1 . GLY 76 1 . GLN 77 1 . THR 78 1 . VAL 79 1 . THR 80 1 . ILE 81 1 . ILE 82 1 . ALA 83 1 . GLN 84 1 . TYR 85 1 . LYS 86 1 . PRO 87 1 . GLU 88 1 . GLU 89 1 . TYR 90 1 . SER 91 1 . ARG 92 1 . PHE 93 1 . GLU 94 1 . ALA 95 1 . LYS 96 1 . ILE 97 1 . HIS 98 1 . ASP 99 1 . LEU 100 1 . ARG 101 1 . GLU 102 1 . GLN 103 1 . LEU 104 1 . MET 105 1 . ASN 106 1 . SER 107 1 . SER 108 1 . LEU 109 1 . GLY 110 1 . SER 111 1 . GLY 112 1 . THR 113 1 . ALA 114 1 . SER 115 1 . LEU 116 1 . ARG 117 1 . SER 118 1 . ASN 119 1 . PRO 120 1 . LYS 121 1 . ARG 122 1 . GLY 123 1 . PHE 124 1 . TYR 125 1 . ILE 126 1 . ARG 127 1 . ALA 128 1 . LEU 129 1 . PHE 130 1 . ASP 131 1 . TYR 132 1 . ASP 133 1 . LYS 134 1 . THR 135 1 . LYS 136 1 . ASP 137 1 . CYS 138 1 . GLY 139 1 . PHE 140 1 . LEU 141 1 . SER 142 1 . GLN 143 1 . ALA 144 1 . LEU 145 1 . SER 146 1 . PHE 147 1 . ARG 148 1 . PHE 149 1 . GLY 150 1 . ASP 151 1 . VAL 152 1 . LEU 153 1 . HIS 154 1 . VAL 155 1 . ILE 156 1 . ASP 157 1 . ALA 158 1 . SER 159 1 . ASP 160 1 . GLU 161 1 . GLU 162 1 . TRP 163 1 . TRP 164 1 . GLN 165 1 . ALA 166 1 . ARG 167 1 . ARG 168 1 . VAL 169 1 . HIS 170 1 . SER 171 1 . ASP 172 1 . SER 173 1 . GLU 174 1 . THR 175 1 . ASP 176 1 . ASP 177 1 . ILE 178 1 . GLY 179 1 . PHE 180 1 . ILE 181 1 . PRO 182 1 . SER 183 1 . LYS 184 1 . ARG 185 1 . ARG 186 1 . VAL 187 1 . GLU 188 1 . ARG 189 1 . ARG 190 1 . GLU 191 1 . TRP 192 1 . SER 193 1 . ARG 194 1 . LEU 195 1 . LYS 196 1 . ALA 197 1 . LYS 198 1 . ASP 199 1 . TRP 200 1 . GLY 201 1 . SER 202 1 . SER 203 1 . SER 204 1 . GLY 205 1 . SER 206 1 . GLN 207 1 . GLY 208 1 . ARG 209 1 . GLU 210 1 . ASP 211 1 . SER 212 1 . VAL 213 1 . LEU 214 1 . SER 215 1 . TYR 216 1 . GLU 217 1 . THR 218 1 . VAL 219 1 . THR 220 1 . GLN 221 1 . MET 222 1 . GLU 223 1 . VAL 224 1 . HIS 225 1 . TYR 226 1 . ALA 227 1 . ARG 228 1 . PRO 229 1 . ILE 230 1 . ILE 231 1 . ILE 232 1 . LEU 233 1 . GLY 234 1 . PRO 235 1 . THR 236 1 . LYS 237 1 . ASP 238 1 . ARG 239 1 . ALA 240 1 . ASN 241 1 . ASP 242 1 . ASP 243 1 . LEU 244 1 . LEU 245 1 . SER 246 1 . GLU 247 1 . PHE 248 1 . PRO 249 1 . ASP 250 1 . LYS 251 1 . PHE 252 1 . GLY 253 1 . SER 254 1 . CYS 255 1 . VAL 256 1 . PRO 257 1 . HIS 258 1 . THR 259 1 . THR 260 1 . ARG 261 1 . PRO 262 1 . LYS 263 1 . ARG 264 1 . GLU 265 1 . TYR 266 1 . GLU 267 1 . ILE 268 1 . ASP 269 1 . GLY 270 1 . ARG 271 1 . ASP 272 1 . TYR 273 1 . HIS 274 1 . PHE 275 1 . VAL 276 1 . SER 277 1 . SER 278 1 . ARG 279 1 . GLU 280 1 . LYS 281 1 . MET 282 1 . GLU 283 1 . LYS 284 1 . ASP 285 1 . ILE 286 1 . GLN 287 1 . ALA 288 1 . HIS 289 1 . LYS 290 1 . PHE 291 1 . ILE 292 1 . GLU 293 1 . ALA 294 1 . GLY 295 1 . GLN 296 1 . TYR 297 1 . ASN 298 1 . SER 299 1 . HIS 300 1 . LEU 301 1 . TYR 302 1 . GLY 303 1 . THR 304 1 . SER 305 1 . VAL 306 1 . GLN 307 1 . SER 308 1 . VAL 309 1 . ARG 310 1 . GLU 311 1 . VAL 312 1 . ALA 313 1 . GLU 314 1 . GLN 315 1 . GLY 316 1 . LYS 317 1 . HIS 318 1 . CYS 319 1 . ILE 320 1 . LEU 321 1 . ASP 322 1 . VAL 323 1 . SER 324 1 . ALA 325 1 . ASN 326 1 . ALA 327 1 . VAL 328 1 . ARG 329 1 . ARG 330 1 . LEU 331 1 . GLN 332 1 . ALA 333 1 . ALA 334 1 . HIS 335 1 . LEU 336 1 . HIS 337 1 . PRO 338 1 . ILE 339 1 . ALA 340 1 . ILE 341 1 . PHE 342 1 . ILE 343 1 . ARG 344 1 . PRO 345 1 . ARG 346 1 . SER 347 1 . LEU 348 1 . GLU 349 1 . ASN 350 1 . VAL 351 1 . LEU 352 1 . GLU 353 1 . ILE 354 1 . ASN 355 1 . LYS 356 1 . ARG 357 1 . ILE 358 1 . THR 359 1 . GLU 360 1 . GLU 361 1 . GLN 362 1 . ALA 363 1 . ARG 364 1 . LYS 365 1 . ALA 366 1 . PHE 367 1 . ASP 368 1 . ARG 369 1 . ALA 370 1 . THR 371 1 . LYS 372 1 . LEU 373 1 . GLU 374 1 . GLN 375 1 . GLU 376 1 . PHE 377 1 . THR 378 1 . GLU 379 1 . CYS 380 1 . PHE 381 1 . SER 382 1 . ALA 383 1 . ILE 384 1 . VAL 385 1 . GLU 386 1 . GLY 387 1 . ASP 388 1 . SER 389 1 . PHE 390 1 . GLU 391 1 . GLU 392 1 . ILE 393 1 . TYR 394 1 . HIS 395 1 . LYS 396 1 . VAL 397 1 . LYS 398 1 . ARG 399 1 . VAL 400 1 . ILE 401 1 . GLU 402 1 . ASP 403 1 . LEU 404 1 . SER 405 1 . GLY 406 1 . PRO 407 1 . TYR 408 1 . ILE 409 1 . TRP 410 1 . VAL 411 1 . PRO 412 1 . ALA 413 1 . ARG 414 1 . GLU 415 1 . ARG 416 1 . LEU 417 2 . MET 1 2 . ASP 2 2 . CYS 3 2 . LEU 4 2 . CYS 5 2 . ILE 6 2 . VAL 7 2 . THR 8 2 . THR 9 2 . LYS 10 2 . LYS 11 2 . TYR 12 2 . ARG 13 2 . TYR 14 2 . GLN 15 2 . ASP 16 2 . GLU 17 2 . ASP 18 2 . THR 19 2 . PRO 20 2 . PRO 21 2 . LEU 22 2 . GLU 23 2 . HIS 24 2 . SER 25 2 . PRO 26 2 . ALA 27 2 . HIS 28 2 . LEU 29 2 . PRO 30 2 . ASN 31 2 . GLN 32 2 . ALA 33 2 . ASN 34 2 . SER 35 2 . PRO 36 2 . PRO 37 2 . VAL 38 2 . ILE 39 2 . VAL 40 2 . ASN 41 2 . THR 42 2 . ASP 43 2 . THR 44 2 . LEU 45 2 . GLU 46 2 . ALA 47 2 . PRO 48 2 . GLY 49 2 . TYR 50 2 . GLU 51 2 . LEU 52 2 . GLN 53 2 . VAL 54 2 . ASN 55 2 . GLY 56 2 . THR 57 2 . GLU 58 2 . GLY 59 2 . GLU 60 2 . MET 61 2 . GLU 62 2 . TYR 63 2 . GLU 64 2 . GLU 65 2 . ILE 66 2 . THR 67 2 . LEU 68 2 . GLU 69 2 . ARG 70 2 . GLY 71 2 . ASN 72 2 . SER 73 2 . GLY 74 2 . LEU 75 2 . GLY 76 2 . PHE 77 2 . SER 78 2 . ILE 79 2 . ALA 80 2 . GLY 81 2 . GLY 82 2 . THR 83 2 . ASP 84 2 . ASN 85 2 . PRO 86 2 . HIS 87 2 . ILE 88 2 . GLY 89 2 . ASP 90 2 . ASP 91 2 . PRO 92 2 . SER 93 2 . ILE 94 2 . PHE 95 2 . ILE 96 2 . THR 97 2 . LYS 98 2 . ILE 99 2 . ILE 100 2 . PRO 101 2 . GLY 102 2 . GLY 103 2 . ALA 104 2 . ALA 105 2 . ALA 106 2 . GLN 107 2 . ASP 108 2 . GLY 109 2 . ARG 110 2 . LEU 111 2 . ARG 112 2 . VAL 113 2 . ASN 114 2 . ASP 115 2 . SER 116 2 . ILE 117 2 . LEU 118 2 . PHE 119 2 . VAL 120 2 . ASN 121 2 . GLU 122 2 . VAL 123 2 . ASP 124 2 . VAL 125 2 . ARG 126 2 . GLU 127 2 . VAL 128 2 . THR 129 2 . HIS 130 2 . SER 131 2 . ALA 132 2 . ALA 133 2 . VAL 134 2 . GLU 135 2 . ALA 136 2 . LEU 137 2 . LYS 138 2 . GLU 139 2 . ALA 140 2 . GLY 141 2 . SER 142 2 . ILE 143 2 . VAL 144 2 . ARG 145 2 . LEU 146 2 . TYR 147 2 . VAL 148 2 . MET 149 2 . ARG 150 2 . ARG 151 2 . LYS 152 2 . PRO 153 2 . PRO 154 2 . ALA 155 2 . GLU 156 2 . LYS 157 2 . VAL 158 2 . MET 159 2 . GLU 160 2 . ILE 161 2 . LYS 162 2 . LEU 163 2 . ILE 164 2 . LYS 165 2 . GLY 166 2 . PRO 167 2 . LYS 168 2 . GLY 169 2 . LEU 170 2 . GLY 171 2 . PHE 172 2 . SER 173 2 . ILE 174 2 . ALA 175 2 . GLY 176 2 . GLY 177 2 . VAL 178 2 . GLY 179 2 . ASN 180 2 . GLN 181 2 . HIS 182 2 . ILE 183 2 . PRO 184 2 . GLY 185 2 . ASP 186 2 . ASN 187 2 . SER 188 2 . ILE 189 2 . TYR 190 2 . VAL 191 2 . THR 192 2 . LYS 193 2 . ILE 194 2 . ILE 195 2 . GLU 196 2 . GLY 197 2 . GLY 198 2 . ALA 199 2 . ALA 200 2 . HIS 201 2 . LYS 202 2 . ASP 203 2 . GLY 204 2 . ARG 205 2 . LEU 206 2 . GLN 207 2 . ILE 208 2 . GLY 209 2 . ASP 210 2 . LYS 211 2 . ILE 212 2 . LEU 213 2 . ALA 214 2 . VAL 215 2 . ASN 216 2 . SER 217 2 . VAL 218 2 . GLY 219 2 . LEU 220 2 . GLU 221 2 . ASP 222 2 . VAL 223 2 . MET 224 2 . HIS 225 2 . GLU 226 2 . ASP 227 2 . ALA 228 2 . VAL 229 2 . ALA 230 2 . ALA 231 2 . LEU 232 2 . LYS 233 2 . ASN 234 2 . THR 235 2 . TYR 236 2 . ASP 237 2 . VAL 238 2 . VAL 239 2 . TYR 240 2 . LEU 241 2 . LYS 242 2 . VAL 243 2 . ALA 244 2 . LYS 245 2 . PRO 246 2 . SER 247 2 . ASN 248 2 . ALA 249 2 . TYR 250 2 . LEU 251 2 . SER 252 2 . ASP 253 2 . SER 254 2 . TYR 255 2 . ALA 256 2 . PRO 257 2 . PRO 258 2 . ASP 259 2 . ILE 260 2 . THR 261 2 . THR 262 2 . SER 263 2 . TYR 264 2 . SER 265 2 . GLN 266 2 . HIS 267 2 . LEU 268 2 . ASP 269 2 . ASN 270 2 . GLU 271 2 . ILE 272 2 . SER 273 2 . HIS 274 2 . SER 275 2 . SER 276 2 . TYR 277 2 . LEU 278 2 . GLY 279 2 . THR 280 2 . ASP 281 2 . TYR 282 2 . PRO 283 2 . THR 284 2 . ALA 285 2 . MET 286 2 . THR 287 2 . PRO 288 2 . THR 289 2 . SER 290 2 . PRO 291 2 . ARG 292 2 . ARG 293 2 . TYR 294 2 . SER 295 2 . PRO 296 2 . VAL 297 2 . ALA 298 2 . LYS 299 2 . ASP 300 2 . LEU 301 2 . LEU 302 2 . GLY 303 2 . GLU 304 2 . GLU 305 2 . ASP 306 2 . ILE 307 2 . PRO 308 2 . ARG 309 2 . GLU 310 2 . PRO 311 2 . ARG 312 2 . ARG 313 2 . ILE 314 2 . VAL 315 2 . ILE 316 2 . HIS 317 2 . ARG 318 2 . GLY 319 2 . SER 320 2 . THR 321 2 . GLY 322 2 . LEU 323 2 . GLY 324 2 . PHE 325 2 . ASN 326 2 . ILE 327 2 . VAL 328 2 . GLY 329 2 . GLY 330 2 . GLU 331 2 . ASP 332 2 . GLY 333 2 . GLU 334 2 . GLY 335 2 . ILE 336 2 . PHE 337 2 . ILE 338 2 . SER 339 2 . PHE 340 2 . ILE 341 2 . LEU 342 2 . ALA 343 2 . GLY 344 2 . GLY 345 2 . PRO 346 2 . ALA 347 2 . ASP 348 2 . LEU 349 2 . SER 350 2 . GLY 351 2 . GLU 352 2 . LEU 353 2 . ARG 354 2 . LYS 355 2 . GLY 356 2 . ASP 357 2 . GLN 358 2 . ILE 359 2 . LEU 360 2 . SER 361 2 . VAL 362 2 . ASN 363 2 . GLY 364 2 . VAL 365 2 . ASP 366 2 . LEU 367 2 . ARG 368 2 . ASN 369 2 . ALA 370 2 . SER 371 2 . HIS 372 2 . GLU 373 2 . GLN 374 2 . ALA 375 2 . ALA 376 2 . ILE 377 2 . ALA 378 2 . LEU 379 2 . LYS 380 2 . ASN 381 2 . ALA 382 2 . GLY 383 2 . GLN 384 2 . THR 385 2 . VAL 386 2 . THR 387 2 . ILE 388 2 . ILE 389 2 . ALA 390 2 . GLN 391 2 . TYR 392 2 . LYS 393 2 . PRO 394 2 . GLU 395 2 . GLU 396 2 . TYR 397 2 . SER 398 2 . ARG 399 2 . PHE 400 2 . GLU 401 2 . ALA 402 2 . LYS 403 2 . ILE 404 2 . HIS 405 2 . ASP 406 2 . LEU 407 2 . ARG 408 2 . GLU 409 2 . GLN 410 2 . LEU 411 2 . MET 412 2 . ASN 413 2 . SER 414 2 . SER 415 2 . LEU 416 2 . GLY 417 2 . SER 418 2 . GLY 419 2 . THR 420 2 . ALA 421 2 . SER 422 2 . LEU 423 2 . ARG 424 2 . SER 425 2 . ASN 426 2 . PRO 427 2 . LYS 428 2 . ARG 429 2 . GLY 430 2 . PHE 431 2 . TYR 432 2 . ILE 433 2 . ARG 434 2 . ALA 435 2 . LEU 436 2 . PHE 437 2 . ASP 438 2 . TYR 439 2 . ASP 440 2 . LYS 441 2 . THR 442 2 . LYS 443 2 . ASP 444 2 . CYS 445 2 . GLY 446 2 . PHE 447 2 . LEU 448 2 . SER 449 2 . GLN 450 2 . ALA 451 2 . LEU 452 2 . SER 453 2 . PHE 454 2 . ARG 455 2 . PHE 456 2 . GLY 457 2 . ASP 458 2 . VAL 459 2 . LEU 460 2 . HIS 461 2 . VAL 462 2 . ILE 463 2 . ASP 464 2 . ALA 465 2 . SER 466 2 . ASP 467 2 . GLU 468 2 . GLU 469 2 . TRP 470 2 . TRP 471 2 . GLN 472 2 . ALA 473 2 . ARG 474 2 . ARG 475 2 . VAL 476 2 . HIS 477 2 . SER 478 2 . ASP 479 2 . SER 480 2 . GLU 481 2 . THR 482 2 . ASP 483 2 . ASP 484 2 . ILE 485 2 . GLY 486 2 . PHE 487 2 . ILE 488 2 . PRO 489 2 . SER 490 2 . LYS 491 2 . ARG 492 2 . ARG 493 2 . VAL 494 2 . GLU 495 2 . ARG 496 2 . ARG 497 2 . GLU 498 2 . TRP 499 2 . SER 500 2 . ARG 501 2 . LEU 502 2 . LYS 503 2 . ALA 504 2 . LYS 505 2 . ASP 506 2 . TRP 507 2 . GLY 508 2 . SER 509 2 . SER 510 2 . SER 511 2 . GLY 512 2 . SER 513 2 . GLN 514 2 . GLY 515 2 . ARG 516 2 . GLU 517 2 . ASP 518 2 . SER 519 2 . VAL 520 2 . LEU 521 2 . SER 522 2 . TYR 523 2 . GLU 524 2 . THR 525 2 . VAL 526 2 . THR 527 2 . GLN 528 2 . MET 529 2 . GLU 530 2 . VAL 531 2 . HIS 532 2 . TYR 533 2 . ALA 534 2 . ARG 535 2 . PRO 536 2 . ILE 537 2 . ILE 538 2 . ILE 539 2 . LEU 540 2 . GLY 541 2 . PRO 542 2 . THR 543 2 . LYS 544 2 . ASP 545 2 . ARG 546 2 . ALA 547 2 . ASN 548 2 . ASP 549 2 . ASP 550 2 . LEU 551 2 . LEU 552 2 . SER 553 2 . GLU 554 2 . PHE 555 2 . PRO 556 2 . ASP 557 2 . LYS 558 2 . PHE 559 2 . GLY 560 2 . SER 561 2 . CYS 562 2 . VAL 563 2 . PRO 564 2 . HIS 565 2 . THR 566 2 . THR 567 2 . ARG 568 2 . PRO 569 2 . LYS 570 2 . ARG 571 2 . GLU 572 2 . TYR 573 2 . GLU 574 2 . ILE 575 2 . ASP 576 2 . GLY 577 2 . ARG 578 2 . ASP 579 2 . TYR 580 2 . HIS 581 2 . PHE 582 2 . VAL 583 2 . SER 584 2 . SER 585 2 . ARG 586 2 . GLU 587 2 . LYS 588 2 . MET 589 2 . GLU 590 2 . LYS 591 2 . ASP 592 2 . ILE 593 2 . GLN 594 2 . ALA 595 2 . HIS 596 2 . LYS 597 2 . PHE 598 2 . ILE 599 2 . GLU 600 2 . ALA 601 2 . GLY 602 2 . GLN 603 2 . TYR 604 2 . ASN 605 2 . SER 606 2 . HIS 607 2 . LEU 608 2 . TYR 609 2 . GLY 610 2 . THR 611 2 . SER 612 2 . VAL 613 2 . GLN 614 2 . SER 615 2 . VAL 616 2 . ARG 617 2 . GLU 618 2 . VAL 619 2 . ALA 620 2 . GLU 621 2 . GLN 622 2 . GLY 623 2 . LYS 624 2 . HIS 625 2 . CYS 626 2 . ILE 627 2 . LEU 628 2 . ASP 629 2 . VAL 630 2 . SER 631 2 . ALA 632 2 . ASN 633 2 . ALA 634 2 . VAL 635 2 . ARG 636 2 . ARG 637 2 . LEU 638 2 . GLN 639 2 . ALA 640 2 . ALA 641 2 . HIS 642 2 . LEU 643 2 . HIS 644 2 . PRO 645 2 . ILE 646 2 . ALA 647 2 . ILE 648 2 . PHE 649 2 . ILE 650 2 . ARG 651 2 . PRO 652 2 . ARG 653 2 . SER 654 2 . LEU 655 2 . GLU 656 2 . ASN 657 2 . VAL 658 2 . LEU 659 2 . GLU 660 2 . ILE 661 2 . ASN 662 2 . LYS 663 2 . ARG 664 2 . ILE 665 2 . THR 666 2 . GLU 667 2 . GLU 668 2 . GLN 669 2 . ALA 670 2 . ARG 671 2 . LYS 672 2 . ALA 673 2 . PHE 674 2 . ASP 675 2 . ARG 676 2 . ALA 677 2 . THR 678 2 . LYS 679 2 . LEU 680 2 . GLU 681 2 . GLN 682 2 . GLU 683 2 . PHE 684 2 . THR 685 2 . GLU 686 2 . CYS 687 2 . PHE 688 2 . SER 689 2 . ALA 690 2 . ILE 691 2 . VAL 692 2 . GLU 693 2 . GLY 694 2 . ASP 695 2 . SER 696 2 . PHE 697 2 . GLU 698 2 . GLU 699 2 . ILE 700 2 . TYR 701 2 . HIS 702 2 . LYS 703 2 . VAL 704 2 . LYS 705 2 . ARG 706 2 . VAL 707 2 . ILE 708 2 . GLU 709 2 . ASP 710 2 . LEU 711 2 . SER 712 2 . GLY 713 2 . PRO 714 2 . TYR 715 2 . ILE 716 2 . TRP 717 2 . VAL 718 2 . PRO 719 2 . ALA 720 2 . ARG 721 2 . GLU 722 2 . ARG 723 2 . LEU 724 # loop_ _ihm_chemical_component_descriptor.auth_name _ihm_chemical_component_descriptor.chemical_name _ihm_chemical_component_descriptor.common_name _ihm_chemical_component_descriptor.details _ihm_chemical_component_descriptor.id _ihm_chemical_component_descriptor.inchi _ihm_chemical_component_descriptor.inchi_key _ihm_chemical_component_descriptor.smiles _ihm_chemical_component_descriptor.smiles_canonical "Alexa-488 C5-maleimide" . . . 1 . . Nc1ccc2c(c3ccc(cc3C(=O)O)C(=O)NCCCCCN3C(=O)C=CC3=O)c3ccc(=[NH2+])c(c3oc2c1S(=O)(=O)[O-])S(=O)(=O)[O-] . "Alexa-488 chromophore" . . . 2 . . C1=CC(=C(C=C1C(=O)NCCCCCN2C(=O)C=CC2=O)C(=O)O)C3=C4C=CC(=[NH2+])C(=C4OC5=C3C=CC(=C5S(=O)(=O)O)N)S(=O)(=O)O . "Alexa-647 C2-maleimide" . . . 3 . . O=C(N1CCNC(CCCCCC2(C)/C(N(CCCS(=O)([O-])=O)C3=C2C=C(S(=O)([O-])=O)C=C3)=C\C=C\C=C\C4=[N+](CCCS(=O)([O-])=O)C5=C(C=C(S(=O)([O-])=O)C=C5)C4(C)C)=O)C=CC1=O . "Alexa647 - chromophore" . . . 4 . . CC1(C)/C(N(CCCS(=O)([O-])=O)C2=C1C=C(S(=O)([O-])=O)C=C2)=C\C=C\C=C\C3=[N+](CCCS(=O)([O-])=O)C4=C(C=C(S(=O)([O-])=O)C=C4)C3(C)C . "Alexa-488 C5-maleimide-CYS" . . . 5 . . C1=CC(=C(C=C1C(=O)N(CCCCCN2C(=O)C(CC2=O)SCC(N([H])[H])C(O[H])=O)[H])C(=O)O[H])C4=C3C=CC(=[N+]([H])[H])C(=C3OC5=C4C=CC(=C5[S](=O)(=O)O[H])N([H])[H])[S](=O)(=O)O[H] . Alexa647-C2-maleimide-Cys . . . 6 . . O=C(C(N[R1])SC1CC(N(CCNC(CCCCCC2(C)/C(N(CCCS(=O)([O-])=O)C3=C2C=C(S(=O)([O-])=O)C=C3)=C\C=C\C=C\C4=[N+](CCCS(=O)([O-])=O)C5=C(C=C(S(=O)([O-])=O)C=C5)C4(C)C)=O)C1=O)=O)N[R2] . # loop_ _ihm_dataset_external_reference.dataset_list_id _ihm_dataset_external_reference.file_id _ihm_dataset_external_reference.id 1 30 1 2 1 2 3 2 3 4 3 4 5 4 5 6 5 6 7 6 7 8 7 8 9 8 9 10 9 10 11 10 11 12 11 12 13 12 13 14 13 14 15 14 15 16 15 16 17 16 17 18 17 18 19 18 19 20 19 20 21 20 21 22 21 22 23 22 23 24 23 24 25 24 25 26 25 26 27 26 27 28 27 28 29 28 29 30 29 30 31 33 31 32 37 32 33 36 33 34 35 34 # loop_ _ihm_dataset_group.application _ihm_dataset_group.details _ihm_dataset_group.id _ihm_dataset_group.name . . 1 . . . 2 . # loop_ _ihm_dataset_group_link.dataset_list_id _ihm_dataset_group_link.group_id 1 1 2 2 3 2 4 2 5 2 6 2 7 2 8 2 9 2 10 2 11 2 12 2 13 2 14 2 15 2 16 2 17 2 18 2 19 2 20 2 21 2 22 2 23 2 24 2 25 2 26 2 27 2 28 2 29 2 30 2 31 2 # loop_ _ihm_dataset_list.data_type _ihm_dataset_list.database_hosted _ihm_dataset_list.details _ihm_dataset_list.id Other NO "Archive of PDB files containing PSG and ions for charge neutrality resulting from DMD simulations" 1 "Single molecule FRET data" NO "Single molecule data" 2 "Single molecule FRET data" NO "Single molecule data" 3 "Single molecule FRET data" NO "Single molecule data" 4 "Single molecule FRET data" NO "Single molecule data" 5 "Single molecule FRET data" NO "Single molecule data" 6 "Single molecule FRET data" NO "Single molecule data" 7 "Single molecule FRET data" NO "Single molecule data" 8 "Single molecule FRET data" NO "Single molecule data" 9 "Single molecule FRET data" NO "Single molecule data" 10 "Single molecule FRET data" NO "Single molecule data" 11 "Single molecule FRET data" NO "Single molecule data" 12 "Single molecule FRET data" NO "Single molecule data" 13 "Single molecule FRET data" NO "Single molecule data" 14 "Single molecule FRET data" NO "Single molecule data" 15 "Single molecule FRET data" NO "Single molecule data" 16 "Single molecule FRET data" NO "Single molecule data" 17 "Single molecule FRET data" NO "Single molecule data" 18 "Single molecule FRET data" NO "Single molecule data" 19 "Single molecule FRET data" NO "Single molecule data" 20 "Single molecule FRET data" NO "Single molecule data" 21 "Single molecule FRET data" NO "Single molecule data" 22 "Single molecule FRET data" NO "Single molecule data" 23 "Single molecule FRET data" NO "Single molecule data" 24 "Single molecule FRET data" NO "Single molecule data" 25 "Single molecule FRET data" NO "Single molecule data" 26 "Single molecule FRET data" NO "Single molecule data" 27 "Single molecule FRET data" NO "Single molecule data" 28 "Single molecule FRET data" NO "Single molecule data" 29 "Single molecule FRET data" NO "Single molecule data" 30 "Integrative model" NO "Input model for DMD simulation. Combines experimental PDZ3 model and comparative SH3-GuK model" 31 "Comparative model" NO "Comparative model for SH3-GuK used for generating input structure for DMD simulations" 32 "Experimental model" YES "Initial experimental model for PDZ3 used for generating input structure for DMD simulations. PDB ID 6QJD" 33 "Experimental model" YES "Initial experimental model for SH3-GuK, PDB ID 1KJW" 34 # loop_ _ihm_dataset_related_db_reference.accession_code _ihm_dataset_related_db_reference.dataset_list_id _ihm_dataset_related_db_reference.db_name _ihm_dataset_related_db_reference.details _ihm_dataset_related_db_reference.id _ihm_dataset_related_db_reference.version 1KJW 34 PDB "Initial experimental SH3-GuK model" 1 . 6QJD 33 PDB "Initial experimental PDZ3 model. Used with SH3-GuK comparative model for DMD input." 2 . # loop_ _ihm_ensemble_info.details _ihm_ensemble_info.ensemble_clustering_feature _ihm_ensemble_info.ensemble_clustering_method _ihm_ensemble_info.ensemble_file_id _ihm_ensemble_info.ensemble_id _ihm_ensemble_info.ensemble_name _ihm_ensemble_info.ensemble_precision_value _ihm_ensemble_info.model_group_id _ihm_ensemble_info.num_ensemble_models _ihm_ensemble_info.num_ensemble_models_deposited _ihm_ensemble_info.post_process_id _ihm_ensemble_info.sub_sample_flag _ihm_ensemble_info.sub_sampling_type . other Other 31 1 A . 1 4325 100 1 NO . . other Other 32 2 B . 2 114 100 2 NO . # loop_ _ihm_entity_poly_segment.comp_id_begin _ihm_entity_poly_segment.comp_id_end _ihm_entity_poly_segment.entity_id _ihm_entity_poly_segment.id _ihm_entity_poly_segment.seq_id_begin _ihm_entity_poly_segment.seq_id_end ARG LEU 2 1 313 724 PRO LEU 1 2 1 417 GLY LEU 1 3 123 417 PRO LYS 1 4 1 86 # loop_ _ihm_external_files.content_type _ihm_external_files.details _ihm_external_files.file_format _ihm_external_files.file_path _ihm_external_files.file_size_bytes _ihm_external_files.id _ihm_external_files.reference_id "Input data or restraints" "FRET-sensitize donor fluorescence decay curve from seTCSPC for PSD95 R313C-S606" . "single_molecule/PSG Data Compiled_08_2022/Fluorescence Decay Histograms/P1G2/P1G2_DA.dat" . 1 1 "Input data or restraints" "FRET-sensitize donor fluorescence decay curve from seTCSPC for PSD95 R313C-E618C" . "single_molecule/PSG Data Compiled_08_2022/Fluorescence Decay Histograms/P1G3/P1G3_DA.dat" . 2 1 "Input data or restraints" "FRET-sensitize donor fluorescence decay curve from seTCSPC for PSD95 R313C-E621C" . "single_molecule/PSG Data Compiled_08_2022/Fluorescence Decay Histograms/P1G4/P1G4_DA.dat" . 3 1 "Input data or restraints" "FRET-sensitize donor fluorescence decay curve from seTCSPC for PSD95 Q374C-R492C" . "single_molecule/PSG Data Compiled_08_2022/Fluorescence Decay Histograms/P2S2/P2S2_DA.dat" . 4 1 "Input data or restraints" "FRET-sensitize donor fluorescence decay curve from seTCSPC for PSD95 Q374C-K591C" . "single_molecule/PSG Data Compiled_08_2022/Fluorescence Decay Histograms/P2G1/P2G1_DA.dat" . 5 1 "Input data or restraints" "FRET-sensitize donor fluorescence decay curve from seTCSPC for PSD95 Q374C-R671C" . "single_molecule/PSG Data Compiled_08_2022/Fluorescence Decay Histograms/P2G6/P2G6_DA.dat" . 6 1 "Input data or restraints" "FRET-sensitize donor fluorescence decay curve from seTCSPC for PSD95 S398C-R492C" . "single_molecule/PSG Data Compiled_08_2022/Fluorescence Decay Histograms/P3S2/P3S2_DA.dat" . 7 1 "Input data or restraints" "FRET-sensitize donor fluorescence decay curve from seTCSPC for PSD95 S398C-E621C" . "single_molecule/PSG Data Compiled_08_2022/Fluorescence Decay Histograms/P3G4/P3G4_DA.dat" . 8 1 "Input data or restraints" "FRET-sensitize donor fluorescence decay curve from seTCSPC for PSD95 S398C-A640C" . "single_molecule/PSG Data Compiled_08_2022/Fluorescence Decay Histograms/P3G5/P3G5_DA.dat" . 9 1 "Input data or restraints" "Donor-only donor fluorescence decay curve from seTCSPC for PSD95 R313C-S606" . "single_molecule/PSG Data Compiled_08_2022/Fluorescence Decay Histograms/P1G2/P1G2_DO.dat" . 10 1 "Input data or restraints" "Donor-only donor fluorescence decay curve from seTCSPC for PSD95 R313C-E618C" . "single_molecule/PSG Data Compiled_08_2022/Fluorescence Decay Histograms/P1G3/P1G3_DO.dat" . 11 1 "Input data or restraints" "Donor-only donor fluorescence decay curve from seTCSPC for PSD95 R313C-E621C" . "single_molecule/PSG Data Compiled_08_2022/Fluorescence Decay Histograms/P1G4/P1G4_DO.dat" . 12 1 "Input data or restraints" "Donor-only donor fluorescence decay curve from seTCSPC for PSD95 Q374C-R492C" . "single_molecule/PSG Data Compiled_08_2022/Fluorescence Decay Histograms/P2S2/P2S2_DO.dat" . 13 1 "Input data or restraints" "Donor-only donor fluorescence decay curve from seTCSPC for PSD95 Q374C-K591C" . "single_molecule/PSG Data Compiled_08_2022/Fluorescence Decay Histograms/P2G1/P2G1_DO.dat" . 14 1 "Input data or restraints" "Donor-only donor fluorescence decay curve from seTCSPC for PSD95 Q374C-R671C" . "single_molecule/PSG Data Compiled_08_2022/Fluorescence Decay Histograms/P2G6/P2G6_DO.dat" . 15 1 "Input data or restraints" "Donor-only donor fluorescence decay curve from seTCSPC for PSD95 S398C-R492C" . "single_molecule/PSG Data Compiled_08_2022/Fluorescence Decay Histograms/P3S2/P3S2_DO.dat" . 16 1 "Input data or restraints" "Donor-only donor fluorescence decay curve from seTCSPC for PSD95 S398C-E621C" . "single_molecule/PSG Data Compiled_08_2022/Fluorescence Decay Histograms/P3G4/P3G4_DO.dat" . 17 1 "Input data or restraints" "Donor-only donor fluorescence decay curve from seTCSPC for PSD95 S398C-A640C" . "single_molecule/PSG Data Compiled_08_2022/Fluorescence Decay Histograms/P3G5/P3G5_DO.dat" . 18 1 "Input data or restraints" "IRF curve from seTCSPC for PSD95 R313C-S606C" . "single_molecule/PSG Data Compiled_08_2022/Fluorescence Decay Histograms/P1G2/P1G2_IRF.dat" . 19 1 "Input data or restraints" "IRF curve from seTCSPC for PSD95 R313C-E618C" . "single_molecule/PSG Data Compiled_08_2022/Fluorescence Decay Histograms/P1G3/P1G3_IRF.dat" . 20 1 "Input data or restraints" "IRF curve from seTCSPC for PSD95 R313C-E621C" . "single_molecule/PSG Data Compiled_08_2022/Fluorescence Decay Histograms/P1G4/P1G4_IRF.dat" . 21 1 "Input data or restraints" "IRF curve from seTCSPC for PSD95 Q374C-R492C" . "single_molecule/PSG Data Compiled_08_2022/Fluorescence Decay Histograms/P2S2/P2S2_IRF.dat" . 22 1 "Input data or restraints" "IRF curve from seTCSPC for PSD95 Q374C-K591C" . "single_molecule/PSG Data Compiled_08_2022/Fluorescence Decay Histograms/P2G1/P2G1_IRF.dat" . 23 1 "Input data or restraints" "IRF curve from seTCSPC for PSD95 Q374C-R671C" . "single_molecule/PSG Data Compiled_08_2022/Fluorescence Decay Histograms/P2G6/P2G6_IRF.dat" . 24 1 "Input data or restraints" "IRF curve from seTCSPC for PSD95 S398C-R492C" . "single_molecule/PSG Data Compiled_08_2022/Fluorescence Decay Histograms/P3S2/P3S2_IRF.dat" . 25 1 "Input data or restraints" "IRF curve from seTCSPC for PSD95 S398C-E621C" . "single_molecule/PSG Data Compiled_08_2022/Fluorescence Decay Histograms/P3G4/P3G4_IRF.dat" . 26 1 "Input data or restraints" "IRF curve from seTCSPC for PSD95 S398C-A640C" . "single_molecule/PSG Data Compiled_08_2022/Fluorescence Decay Histograms/P3G5/P3G5_IRF.dat" . 27 1 "Input data or restraints" "Input distance restraints for A in FPS software from seTCSPC analysis" . single_molecule/PDBDev_adtl_Datasets/Screening_Files/Multifit_ResultsA.docx . 28 1 "Input data or restraints" "Input distance restraints for B in FPS software from seTCSPC analysis" . single_molecule/PDBDev_adtl_Datasets/Screening_Files/Multifit_ResultsB.docx . 29 1 "Modeling or post-processing output" "Input structure for rigid body docking" . "Structures/PSG Data Compiled_08_2022/Simulation AV-Derived Distance Values/Structures.zip" . 30 1 "Modeling or post-processing output" "File list containing all structures for ensemble A" . "Structure_Lists/PDBDev_adtl_Datasets/Screening_Files/Ensemble_File_Lists A" . 31 1 "Modeling or post-processing output" "File list containing all structures for ensemble A" . "Structure_Lists/PDBDev_adtl_Datasets/Screening_Files/Ensemble_File_Lists B" . 32 1 "Input data or restraints" "Input structure for DMD simulations" . Screening_Files/PDBDev_adtl_Datasets/Screening_Files/PSG_Starting_Model.pdb.cif . 33 1 "Input data or restraints" "Input sequence" . Screening_Files/PDBDev_adtl_Datasets/Screening_Files/Input_Sequence . 34 1 "Input data or restraints" "Initial experimental model for SH3-GuK" CIF "xyz4/PDBDev_adtl_Datasets/Initial Model/1kjw.cif" . 35 1 "Input data or restraints" "Initial experimental model of PDZ3. PDB ID 6QJD. Used with comparative model of SH3-GuK for input structure for DMD simulations" CIF "/xyz5/PDBDev_adtl_Datasets/Initial Model/6qjd.pdb.cif" . 36 1 "Input data or restraints" "Comparative model of SH3-GuK used with PDZ3 experimental model for input structure to DMD simulations." CIF xyz2/PDBDev_adtl_Datasets/Docking_Data_Files/SH3GuK.pdb.cif . 37 1 # _ihm_external_reference_info.associated_url https://zenodo.org/record/7125978 _ihm_external_reference_info.details . _ihm_external_reference_info.reference 10.5281/zenodo.7125978 _ihm_external_reference_info.reference_id 1 _ihm_external_reference_info.reference_provider Zenodo _ihm_external_reference_info.reference_type DOI _ihm_external_reference_info.refers_to File # loop_ _ihm_model_group.details _ihm_model_group.id _ihm_model_group.name . 1 A . 2 B # loop_ _ihm_model_group_link.group_id _ihm_model_group_link.model_id 1 1 1 2 1 3 1 4 1 5 1 6 1 7 1 8 1 9 1 10 1 11 1 12 1 13 1 14 1 15 1 16 1 17 1 18 1 19 1 20 1 21 1 22 1 23 1 24 1 25 1 26 1 27 1 28 1 29 1 30 1 31 1 32 1 33 1 34 1 35 1 36 1 37 1 38 1 39 1 40 1 41 1 42 1 43 1 44 1 45 1 46 1 47 1 48 1 49 1 50 1 51 1 52 1 53 1 54 1 55 1 56 1 57 1 58 1 59 1 60 1 61 1 62 1 63 1 64 1 65 1 66 1 67 1 68 1 69 1 70 1 71 1 72 1 73 1 74 1 75 1 76 1 77 1 78 1 79 1 80 1 81 1 82 1 83 1 84 1 85 1 86 1 87 1 88 1 89 1 90 1 91 1 92 1 93 1 94 1 95 1 96 1 97 1 98 1 99 1 100 2 101 2 102 2 103 2 104 2 105 2 106 2 107 2 108 2 109 2 110 2 111 2 112 2 113 2 114 2 115 2 116 2 117 2 118 2 119 2 120 2 121 2 122 2 123 2 124 2 125 2 126 2 127 2 128 2 129 2 130 2 131 2 132 2 133 2 134 2 135 2 136 2 137 2 138 2 139 2 140 2 141 2 142 2 143 2 144 2 145 2 146 2 147 2 148 2 149 2 150 2 151 2 152 2 153 2 154 2 155 2 156 2 157 2 158 2 159 2 160 2 161 2 162 2 163 2 164 2 165 2 166 2 167 2 168 2 169 2 170 2 171 2 172 2 173 2 174 2 175 2 176 2 177 2 178 2 179 2 180 2 181 2 182 2 183 2 184 2 185 2 186 2 187 2 188 2 189 2 190 2 191 2 192 2 193 2 194 2 195 2 196 2 197 2 198 2 199 2 200 # loop_ _ihm_model_list.assembly_id _ihm_model_list.model_id _ihm_model_list.model_name _ihm_model_list.protocol_id _ihm_model_list.representation_id 1 1 A 1 1 1 2 A 1 1 1 3 A 1 1 1 4 A 1 1 1 5 A 1 1 1 6 A 1 1 1 7 A 1 1 1 8 A 1 1 1 9 A 1 1 1 10 A 1 1 1 11 A 1 1 1 12 A 1 1 1 13 A 1 1 1 14 A 1 1 1 15 A 1 1 1 16 A 1 1 1 17 A 1 1 1 18 A 1 1 1 19 A 1 1 1 20 A 1 1 1 21 A 1 1 1 22 A 1 1 1 23 A 1 1 1 24 A 1 1 1 25 A 1 1 1 26 A 1 1 1 27 A 1 1 1 28 A 1 1 1 29 A 1 1 1 30 A 1 1 1 31 A 1 1 1 32 A 1 1 1 33 A 1 1 1 34 A 1 1 1 35 A 1 1 1 36 A 1 1 1 37 A 1 1 1 38 A 1 1 1 39 A 1 1 1 40 A 1 1 1 41 A 1 1 1 42 A 1 1 1 43 A 1 1 1 44 A 1 1 1 45 A 1 1 1 46 A 1 1 1 47 A 1 1 1 48 A 1 1 1 49 A 1 1 1 50 A 1 1 1 51 A 1 1 1 52 A 1 1 1 53 A 1 1 1 54 A 1 1 1 55 A 1 1 1 56 A 1 1 1 57 A 1 1 1 58 A 1 1 1 59 A 1 1 1 60 A 1 1 1 61 A 1 1 1 62 A 1 1 1 63 A 1 1 1 64 A 1 1 1 65 A 1 1 1 66 A 1 1 1 67 A 1 1 1 68 A 1 1 1 69 A 1 1 1 70 A 1 1 1 71 A 1 1 1 72 A 1 1 1 73 A 1 1 1 74 A 1 1 1 75 A 1 1 1 76 A 1 1 1 77 A 1 1 1 78 A 1 1 1 79 A 1 1 1 80 A 1 1 1 81 A 1 1 1 82 A 1 1 1 83 A 1 1 1 84 A 1 1 1 85 A 1 1 1 86 A 1 1 1 87 A 1 1 1 88 A 1 1 1 89 A 1 1 1 90 A 1 1 1 91 A 1 1 1 92 A 1 1 1 93 A 1 1 1 94 A 1 1 1 95 A 1 1 1 96 A 1 1 1 97 A 1 1 1 98 A 1 1 1 99 A 1 1 1 100 A 1 1 1 101 B 1 1 1 102 B 1 1 1 103 B 1 1 1 104 B 1 1 1 105 B 1 1 1 106 B 1 1 1 107 B 1 1 1 108 B 1 1 1 109 B 1 1 1 110 B 1 1 1 111 B 1 1 1 112 B 1 1 1 113 B 1 1 1 114 B 1 1 1 115 B 1 1 1 116 B 1 1 1 117 B 1 1 1 118 B 1 1 1 119 B 1 1 1 120 B 1 1 1 121 B 1 1 1 122 B 1 1 1 123 B 1 1 1 124 B 1 1 1 125 B 1 1 1 126 B 1 1 1 127 B 1 1 1 128 B 1 1 1 129 B 1 1 1 130 B 1 1 1 131 B 1 1 1 132 B 1 1 1 133 B 1 1 1 134 B 1 1 1 135 B 1 1 1 136 B 1 1 1 137 B 1 1 1 138 B 1 1 1 139 B 1 1 1 140 B 1 1 1 141 B 1 1 1 142 B 1 1 1 143 B 1 1 1 144 B 1 1 1 145 B 1 1 1 146 B 1 1 1 147 B 1 1 1 148 B 1 1 1 149 B 1 1 1 150 B 1 1 1 151 B 1 1 1 152 B 1 1 1 153 B 1 1 1 154 B 1 1 1 155 B 1 1 1 156 B 1 1 1 157 B 1 1 1 158 B 1 1 1 159 B 1 1 1 160 B 1 1 1 161 B 1 1 1 162 B 1 1 1 163 B 1 1 1 164 B 1 1 1 165 B 1 1 1 166 B 1 1 1 167 B 1 1 1 168 B 1 1 1 169 B 1 1 1 170 B 1 1 1 171 B 1 1 1 172 B 1 1 1 173 B 1 1 1 174 B 1 1 1 175 B 1 1 1 176 B 1 1 1 177 B 1 1 1 178 B 1 1 1 179 B 1 1 1 180 B 1 1 1 181 B 1 1 1 182 B 1 1 1 183 B 1 1 1 184 B 1 1 1 185 B 1 1 1 186 B 1 1 1 187 B 1 1 1 188 B 1 1 1 189 B 1 1 1 190 B 1 1 1 191 B 1 1 1 192 B 1 1 1 193 B 1 1 1 194 B 1 1 1 195 B 1 1 1 196 B 1 1 1 197 B 1 1 1 198 B 1 1 1 199 B 1 1 1 200 B 1 1 # _ihm_model_representation.details . _ihm_model_representation.id 1 _ihm_model_representation.name . # _ihm_model_representation_details.description . _ihm_model_representation_details.entity_asym_id A _ihm_model_representation_details.entity_description "PSD95 PDZ3-SH3-GuK Module" _ihm_model_representation_details.entity_id 1 _ihm_model_representation_details.entity_poly_segment_id 2 _ihm_model_representation_details.id 1 _ihm_model_representation_details.model_granularity by-atom _ihm_model_representation_details.model_mode flexible _ihm_model_representation_details.model_object_count . _ihm_model_representation_details.model_object_primitive atomistic _ihm_model_representation_details.representation_id 1 _ihm_model_representation_details.starting_model_id 1 # loop_ _ihm_model_representative.id _ihm_model_representative.model_group_id _ihm_model_representative.model_id _ihm_model_representative.selection_criteria 1 1 1 "best scoring model" 2 2 101 "best scoring model" # loop_ _ihm_modeling_post_process.analysis_id _ihm_modeling_post_process.dataset_group_id _ihm_modeling_post_process.details _ihm_modeling_post_process.feature _ihm_modeling_post_process.feature_name _ihm_modeling_post_process.id _ihm_modeling_post_process.num_models_begin _ihm_modeling_post_process.num_models_end _ihm_modeling_post_process.protocol_id _ihm_modeling_post_process.script_file_id _ihm_modeling_post_process.software_id _ihm_modeling_post_process.step_id _ihm_modeling_post_process.struct_assembly_id _ihm_modeling_post_process.type 1 2 "Representative structures were filtered according to the calculated chi-squared between the simulated inter-dye (FRET) distances from AV simulations and the experimental distance restraints (FRET Chi_Squared)" other "FRET Chi_Squared" 1 4325 100 1 . 1 1 1 filter 1 2 "Representative structures were filtered according to the calculated chi-squared between the simulated inter-dye (FRET) distances from AV simulations and the experimental distance restraints (FRET Chi_Squared)" other "FRET Chi_Squared" 2 114 100 1 . 1 2 1 filter # _ihm_modeling_protocol.details . _ihm_modeling_protocol.id 1 _ihm_modeling_protocol.num_steps 2 _ihm_modeling_protocol.protocol_name "Integrative FRET-guided structural modeling with molecular dynamics simulations" # loop_ _ihm_modeling_protocol_details.dataset_group_id _ihm_modeling_protocol_details.description _ihm_modeling_protocol_details.ensemble_flag _ihm_modeling_protocol_details.id _ihm_modeling_protocol_details.multi_scale_flag _ihm_modeling_protocol_details.multi_state_flag _ihm_modeling_protocol_details.num_models_begin _ihm_modeling_protocol_details.num_models_end _ihm_modeling_protocol_details.ordered_flag _ihm_modeling_protocol_details.protocol_id _ihm_modeling_protocol_details.script_file_id _ihm_modeling_protocol_details.software_id _ihm_modeling_protocol_details.step_id _ihm_modeling_protocol_details.step_method _ihm_modeling_protocol_details.step_name _ihm_modeling_protocol_details.struct_assembly_description _ihm_modeling_protocol_details.struct_assembly_id 1 . YES 1 NO YES 1 20871 YES 1 . 2 1 "DMD simulations" "Unbiased DMD Simulations" . 1 2 . YES 2 NO YES 20871 4439 NO 1 . 1 2 . "FRET-guided screening of structures from molecular dynamics simulations" . 1 # loop_ _ihm_multi_state_model_group_link.model_group_id _ihm_multi_state_model_group_link.state_id 1 1 2 2 # loop_ _ihm_multi_state_modeling.details _ihm_multi_state_modeling.experiment_type _ihm_multi_state_modeling.population_fraction _ihm_multi_state_modeling.population_fraction_sd _ihm_multi_state_modeling.state_group_id _ihm_multi_state_modeling.state_id _ihm_multi_state_modeling.state_name _ihm_multi_state_modeling.state_type "PDZ3 localized near SH3" "Single molecule" 0.461 . 1 1 A "conformational change" "PDZ3 localized near GuK and SH3" "Single molecule" 0.539 . 1 2 B "conformational change" # _ihm_starting_comparative_models.alignment_file_id . _ihm_starting_comparative_models.details "Corresponds to comparative models for SH3-GuK. Used with PDZ3 experimental model to generate input DMD structure. Linker residues added using canonical sequence code and DMD in-built residue chain builder." _ihm_starting_comparative_models.id 1 _ihm_starting_comparative_models.starting_model_auth_asym_id A _ihm_starting_comparative_models.starting_model_id 2 _ihm_starting_comparative_models.starting_model_seq_id_begin 1 _ihm_starting_comparative_models.starting_model_seq_id_end 295 _ihm_starting_comparative_models.template_auth_asym_id A _ihm_starting_comparative_models.template_dataset_list_id 34 _ihm_starting_comparative_models.template_seq_id_begin 1 _ihm_starting_comparative_models.template_seq_id_end 295 _ihm_starting_comparative_models.template_sequence_identity . _ihm_starting_comparative_models.template_sequence_identity_denominator . # loop_ _ihm_starting_model_details.asym_id _ihm_starting_model_details.dataset_list_id _ihm_starting_model_details.description _ihm_starting_model_details.entity_description _ihm_starting_model_details.entity_id _ihm_starting_model_details.entity_poly_segment_id _ihm_starting_model_details.starting_model_auth_asym_id _ihm_starting_model_details.starting_model_id _ihm_starting_model_details.starting_model_sequence_offset _ihm_starting_model_details.starting_model_source A 31 . "PSD95 PDZ3-SH3-GuK Module" 1 2 A 1 0 "integrative model" A 32 . SH3-GuK 1 3 A 2 121 "comparative model" A 33 . PDZ3 1 4 A 3 -8 "experimental model" # _ihm_struct_assembly.description "Structures of the PSG Supramodule of Postsynaptic density protein 95 Resolved by Screening of FRET-derived Distance Restraints against Simulated Structures" _ihm_struct_assembly.id 1 _ihm_struct_assembly.name "Postsynaptic density protein 95" # _ihm_struct_assembly_details.assembly_id 1 _ihm_struct_assembly_details.asym_id A _ihm_struct_assembly_details.entity_description "PSD95 PDZ3-SH3-GuK Module" _ihm_struct_assembly_details.entity_id 1 _ihm_struct_assembly_details.entity_poly_segment_id 2 _ihm_struct_assembly_details.id 1 _ihm_struct_assembly_details.parent_assembly_id 1 # loop_ _software.citation_id _software.classification _software.description _software.location _software.name _software.pdbx_ordinal _software.type _software.version . "Model Building" "Python package for simulating acessible volumes of fluorophores and obtaining predicted FRET observables for input structure files of biomolecules" github.com/Fluorescence-Tools/avtraj AvTraj 1 package 0.0.9 . "Molecular Dynamics Simulations" "Molecular dynamics package for acclerated sampling of biomolecular conformational space using replica exchange and discretized potentials with the Medusa force field" moleculesinaction.com/pdmd.html pDMD 2 program 1.100 # _struct.entry_id 9A2F _struct.pdbx_CASP_flag . _struct.pdbx_descriptor . _struct.pdbx_details . _struct.pdbx_model_details . _struct.pdbx_model_type_details . _struct.title "Structures of the PSG Supramodule of PSD-95 Resolved by Screening of FRET-derived Distance Restraints against Simulated Structures" _struct.pdbx_structure_determination_methodology integrative # _struct_asym.details "PDZ3-SH3-GuK Module" _struct_asym.entity_id 1 _struct_asym.id A _struct_asym.pdbx_PDB_id . _struct_asym.pdbx_alt_id . _struct_asym.pdbx_blank_PDB_chainid_flag . _struct_asym.pdbx_modified . _struct_asym.pdbx_order . _struct_asym.pdbx_type . # _struct_ref.db_code P78352 _struct_ref.db_name UNP _struct_ref.details . _struct_ref.entity_id 1 _struct_ref.id 1 _struct_ref.pdbx_align_begin 308 _struct_ref.pdbx_db_accession P78352 _struct_ref.pdbx_seq_one_letter_code "PREPRRIVIHRGSTGLGFNIVGGEDGEGIFISFILAGGPADLSGELRKGDQILSVNGVDLRNASHEQAAI ALKNAGQTVTIIAQYKPEEYSRFEAKIHDLREQLMNSSLGSGTASLRSNPKRGFYIRALFDYDKTKDCGF LSQALSFRFGDVLHVIDASDEEWWQARRVHSDSETDDIGFIPSKRRVERREWSRLKAKDWGSSSGSQGRE DSVLSYETVTQMEVHYARPIIILGPTKDRANDDLLSEFPDKFGSCVPHTTRPKREYEIDGRDYHFVSSRE KMEKDIQAHKFIEAGQYNSHLYGTSVQSVREVAEQGKHCILDVSANAVRRLQAAHLHPIAIFIRPRSLEN VLEINKRITEEQARKAFDRATKLEQEFTECFSAIVEGDSFEEIYHKVKRVIEDLSGPYIWVPARERL" # _struct_ref_seq.align_id 1 _struct_ref_seq.db_align_beg 308 _struct_ref_seq.db_align_end 724 _struct_ref_seq.ref_id 1 _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.seq_align_end 417 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code A 1 1 PRO 1 1 PRO PRO A . A 1 2 ARG 2 2 ARG ARG A . A 1 3 GLU 3 3 GLU GLU A . A 1 4 PRO 4 4 PRO PRO A . A 1 5 ARG 5 5 ARG ARG A . A 1 6 ARG 6 6 ARG ARG A . A 1 7 ILE 7 7 ILE ILE A . A 1 8 VAL 8 8 VAL VAL A . A 1 9 ILE 9 9 ILE ILE A . A 1 10 HIS 10 10 HIS HIS A . A 1 11 ARG 11 11 ARG ARG A . A 1 12 GLY 12 12 GLY GLY A . A 1 13 SER 13 13 SER SER A . A 1 14 THR 14 14 THR THR A . A 1 15 GLY 15 15 GLY GLY A . A 1 16 LEU 16 16 LEU LEU A . A 1 17 GLY 17 17 GLY GLY A . A 1 18 PHE 18 18 PHE PHE A . A 1 19 ASN 19 19 ASN ASN A . A 1 20 ILE 20 20 ILE ILE A . A 1 21 VAL 21 21 VAL VAL A . A 1 22 GLY 22 22 GLY GLY A . A 1 23 GLY 23 23 GLY GLY A . A 1 24 GLU 24 24 GLU GLU A . A 1 25 ASP 25 25 ASP ASP A . A 1 26 GLY 26 26 GLY GLY A . A 1 27 GLU 27 27 GLU GLU A . A 1 28 GLY 28 28 GLY GLY A . A 1 29 ILE 29 29 ILE ILE A . A 1 30 PHE 30 30 PHE PHE A . A 1 31 ILE 31 31 ILE ILE A . A 1 32 SER 32 32 SER SER A . A 1 33 PHE 33 33 PHE PHE A . A 1 34 ILE 34 34 ILE ILE A . A 1 35 LEU 35 35 LEU LEU A . A 1 36 ALA 36 36 ALA ALA A . A 1 37 GLY 37 37 GLY GLY A . A 1 38 GLY 38 38 GLY GLY A . A 1 39 PRO 39 39 PRO PRO A . A 1 40 ALA 40 40 ALA ALA A . A 1 41 ASP 41 41 ASP ASP A . A 1 42 LEU 42 42 LEU LEU A . A 1 43 SER 43 43 SER SER A . A 1 44 GLY 44 44 GLY GLY A . A 1 45 GLU 45 45 GLU GLU A . A 1 46 LEU 46 46 LEU LEU A . A 1 47 ARG 47 47 ARG ARG A . A 1 48 LYS 48 48 LYS LYS A . A 1 49 GLY 49 49 GLY GLY A . A 1 50 ASP 50 50 ASP ASP A . A 1 51 GLN 51 51 GLN GLN A . A 1 52 ILE 52 52 ILE ILE A . A 1 53 LEU 53 53 LEU LEU A . A 1 54 SER 54 54 SER SER A . A 1 55 VAL 55 55 VAL VAL A . A 1 56 ASN 56 56 ASN ASN A . A 1 57 GLY 57 57 GLY GLY A . A 1 58 VAL 58 58 VAL VAL A . A 1 59 ASP 59 59 ASP ASP A . A 1 60 LEU 60 60 LEU LEU A . A 1 61 ARG 61 61 ARG ARG A . A 1 62 ASN 62 62 ASN ASN A . A 1 63 ALA 63 63 ALA ALA A . A 1 64 SER 64 64 SER SER A . A 1 65 HIS 65 65 HIS HIS A . A 1 66 GLU 66 66 GLU GLU A . A 1 67 GLN 67 67 GLN GLN A . A 1 68 ALA 68 68 ALA ALA A . A 1 69 ALA 69 69 ALA ALA A . A 1 70 ILE 70 70 ILE ILE A . A 1 71 ALA 71 71 ALA ALA A . A 1 72 LEU 72 72 LEU LEU A . A 1 73 LYS 73 73 LYS LYS A . A 1 74 ASN 74 74 ASN ASN A . A 1 75 ALA 75 75 ALA ALA A . A 1 76 GLY 76 76 GLY GLY A . A 1 77 GLN 77 77 GLN GLN A . A 1 78 THR 78 78 THR THR A . A 1 79 VAL 79 79 VAL VAL A . A 1 80 THR 80 80 THR THR A . A 1 81 ILE 81 81 ILE ILE A . A 1 82 ILE 82 82 ILE ILE A . A 1 83 ALA 83 83 ALA ALA A . A 1 84 GLN 84 84 GLN GLN A . A 1 85 TYR 85 85 TYR TYR A . A 1 86 LYS 86 86 LYS LYS A . A 1 87 PRO 87 87 PRO PRO A . A 1 88 GLU 88 88 GLU GLU A . A 1 89 GLU 89 89 GLU GLU A . A 1 90 TYR 90 90 TYR TYR A . A 1 91 SER 91 91 SER SER A . A 1 92 ARG 92 92 ARG ARG A . A 1 93 PHE 93 93 PHE PHE A . A 1 94 GLU 94 94 GLU GLU A . A 1 95 ALA 95 95 ALA ALA A . A 1 96 LYS 96 96 LYS LYS A . A 1 97 ILE 97 97 ILE ILE A . A 1 98 HIS 98 98 HIS HIS A . A 1 99 ASP 99 99 ASP ASP A . A 1 100 LEU 100 100 LEU LEU A . A 1 101 ARG 101 101 ARG ARG A . A 1 102 GLU 102 102 GLU GLU A . A 1 103 GLN 103 103 GLN GLN A . A 1 104 LEU 104 104 LEU LEU A . A 1 105 MET 105 105 MET MET A . A 1 106 ASN 106 106 ASN ASN A . A 1 107 SER 107 107 SER SER A . A 1 108 SER 108 108 SER SER A . A 1 109 LEU 109 109 LEU LEU A . A 1 110 GLY 110 110 GLY GLY A . A 1 111 SER 111 111 SER SER A . A 1 112 GLY 112 112 GLY GLY A . A 1 113 THR 113 113 THR THR A . A 1 114 ALA 114 114 ALA ALA A . A 1 115 SER 115 115 SER SER A . A 1 116 LEU 116 116 LEU LEU A . A 1 117 ARG 117 117 ARG ARG A . A 1 118 SER 118 118 SER SER A . A 1 119 ASN 119 119 ASN ASN A . A 1 120 PRO 120 120 PRO PRO A . A 1 121 LYS 121 121 LYS LYS A . A 1 122 ARG 122 122 ARG ARG A . A 1 123 GLY 123 123 GLY GLY A . A 1 124 PHE 124 124 PHE PHE A . A 1 125 TYR 125 125 TYR TYR A . A 1 126 ILE 126 126 ILE ILE A . A 1 127 ARG 127 127 ARG ARG A . A 1 128 ALA 128 128 ALA ALA A . A 1 129 LEU 129 129 LEU LEU A . A 1 130 PHE 130 130 PHE PHE A . A 1 131 ASP 131 131 ASP ASP A . A 1 132 TYR 132 132 TYR TYR A . A 1 133 ASP 133 133 ASP ASP A . A 1 134 LYS 134 134 LYS LYS A . A 1 135 THR 135 135 THR THR A . A 1 136 LYS 136 136 LYS LYS A . A 1 137 ASP 137 137 ASP ASP A . A 1 138 CYS 138 138 CYS CYS A . A 1 139 GLY 139 139 GLY GLY A . A 1 140 PHE 140 140 PHE PHE A . A 1 141 LEU 141 141 LEU LEU A . A 1 142 SER 142 142 SER SER A . A 1 143 GLN 143 143 GLN GLN A . A 1 144 ALA 144 144 ALA ALA A . A 1 145 LEU 145 145 LEU LEU A . A 1 146 SER 146 146 SER SER A . A 1 147 PHE 147 147 PHE PHE A . A 1 148 ARG 148 148 ARG ARG A . A 1 149 PHE 149 149 PHE PHE A . A 1 150 GLY 150 150 GLY GLY A . A 1 151 ASP 151 151 ASP ASP A . A 1 152 VAL 152 152 VAL VAL A . A 1 153 LEU 153 153 LEU LEU A . A 1 154 HIS 154 154 HIS HIS A . A 1 155 VAL 155 155 VAL VAL A . A 1 156 ILE 156 156 ILE ILE A . A 1 157 ASP 157 157 ASP ASP A . A 1 158 ALA 158 158 ALA ALA A . A 1 159 SER 159 159 SER SER A . A 1 160 ASP 160 160 ASP ASP A . A 1 161 GLU 161 161 GLU GLU A . A 1 162 GLU 162 162 GLU GLU A . A 1 163 TRP 163 163 TRP TRP A . A 1 164 TRP 164 164 TRP TRP A . A 1 165 GLN 165 165 GLN GLN A . A 1 166 ALA 166 166 ALA ALA A . A 1 167 ARG 167 167 ARG ARG A . A 1 168 ARG 168 168 ARG ARG A . A 1 169 VAL 169 169 VAL VAL A . A 1 170 HIS 170 170 HIS HIS A . A 1 171 SER 171 171 SER SER A . A 1 172 ASP 172 172 ASP ASP A . A 1 173 SER 173 173 SER SER A . A 1 174 GLU 174 174 GLU GLU A . A 1 175 THR 175 175 THR THR A . A 1 176 ASP 176 176 ASP ASP A . A 1 177 ASP 177 177 ASP ASP A . A 1 178 ILE 178 178 ILE ILE A . A 1 179 GLY 179 179 GLY GLY A . A 1 180 PHE 180 180 PHE PHE A . A 1 181 ILE 181 181 ILE ILE A . A 1 182 PRO 182 182 PRO PRO A . A 1 183 SER 183 183 SER SER A . A 1 184 LYS 184 184 LYS LYS A . A 1 185 ARG 185 185 ARG ARG A . A 1 186 ARG 186 186 ARG ARG A . A 1 187 VAL 187 187 VAL VAL A . A 1 188 GLU 188 188 GLU GLU A . A 1 189 ARG 189 189 ARG ARG A . A 1 190 ARG 190 190 ARG ARG A . A 1 191 GLU 191 191 GLU GLU A . A 1 192 TRP 192 192 TRP TRP A . A 1 193 SER 193 193 SER SER A . A 1 194 ARG 194 194 ARG ARG A . A 1 195 LEU 195 195 LEU LEU A . A 1 196 LYS 196 196 LYS LYS A . A 1 197 ALA 197 197 ALA ALA A . A 1 198 LYS 198 198 LYS LYS A . A 1 199 ASP 199 199 ASP ASP A . A 1 200 TRP 200 200 TRP TRP A . A 1 201 GLY 201 201 GLY GLY A . A 1 202 SER 202 202 SER SER A . A 1 203 SER 203 203 SER SER A . A 1 204 SER 204 204 SER SER A . A 1 205 GLY 205 205 GLY GLY A . A 1 206 SER 206 206 SER SER A . A 1 207 GLN 207 207 GLN GLN A . A 1 208 GLY 208 208 GLY GLY A . A 1 209 ARG 209 209 ARG ARG A . A 1 210 GLU 210 210 GLU GLU A . A 1 211 ASP 211 211 ASP ASP A . A 1 212 SER 212 212 SER SER A . A 1 213 VAL 213 213 VAL VAL A . A 1 214 LEU 214 214 LEU LEU A . A 1 215 SER 215 215 SER SER A . A 1 216 TYR 216 216 TYR TYR A . A 1 217 GLU 217 217 GLU GLU A . A 1 218 THR 218 218 THR THR A . A 1 219 VAL 219 219 VAL VAL A . A 1 220 THR 220 220 THR THR A . A 1 221 GLN 221 221 GLN GLN A . A 1 222 MET 222 222 MET MET A . A 1 223 GLU 223 223 GLU GLU A . A 1 224 VAL 224 224 VAL VAL A . A 1 225 HIS 225 225 HIS HIS A . A 1 226 TYR 226 226 TYR TYR A . A 1 227 ALA 227 227 ALA ALA A . A 1 228 ARG 228 228 ARG ARG A . A 1 229 PRO 229 229 PRO PRO A . A 1 230 ILE 230 230 ILE ILE A . A 1 231 ILE 231 231 ILE ILE A . A 1 232 ILE 232 232 ILE ILE A . A 1 233 LEU 233 233 LEU LEU A . A 1 234 GLY 234 234 GLY GLY A . A 1 235 PRO 235 235 PRO PRO A . A 1 236 THR 236 236 THR THR A . A 1 237 LYS 237 237 LYS LYS A . A 1 238 ASP 238 238 ASP ASP A . A 1 239 ARG 239 239 ARG ARG A . A 1 240 ALA 240 240 ALA ALA A . A 1 241 ASN 241 241 ASN ASN A . A 1 242 ASP 242 242 ASP ASP A . A 1 243 ASP 243 243 ASP ASP A . A 1 244 LEU 244 244 LEU LEU A . A 1 245 LEU 245 245 LEU LEU A . A 1 246 SER 246 246 SER SER A . A 1 247 GLU 247 247 GLU GLU A . A 1 248 PHE 248 248 PHE PHE A . A 1 249 PRO 249 249 PRO PRO A . A 1 250 ASP 250 250 ASP ASP A . A 1 251 LYS 251 251 LYS LYS A . A 1 252 PHE 252 252 PHE PHE A . A 1 253 GLY 253 253 GLY GLY A . A 1 254 SER 254 254 SER SER A . A 1 255 CYS 255 255 CYS CYS A . A 1 256 VAL 256 256 VAL VAL A . A 1 257 PRO 257 257 PRO PRO A . A 1 258 HIS 258 258 HIS HIS A . A 1 259 THR 259 259 THR THR A . A 1 260 THR 260 260 THR THR A . A 1 261 ARG 261 261 ARG ARG A . A 1 262 PRO 262 262 PRO PRO A . A 1 263 LYS 263 263 LYS LYS A . A 1 264 ARG 264 264 ARG ARG A . A 1 265 GLU 265 265 GLU GLU A . A 1 266 TYR 266 266 TYR TYR A . A 1 267 GLU 267 267 GLU GLU A . A 1 268 ILE 268 268 ILE ILE A . A 1 269 ASP 269 269 ASP ASP A . A 1 270 GLY 270 270 GLY GLY A . A 1 271 ARG 271 271 ARG ARG A . A 1 272 ASP 272 272 ASP ASP A . A 1 273 TYR 273 273 TYR TYR A . A 1 274 HIS 274 274 HIS HIS A . A 1 275 PHE 275 275 PHE PHE A . A 1 276 VAL 276 276 VAL VAL A . A 1 277 SER 277 277 SER SER A . A 1 278 SER 278 278 SER SER A . A 1 279 ARG 279 279 ARG ARG A . A 1 280 GLU 280 280 GLU GLU A . A 1 281 LYS 281 281 LYS LYS A . A 1 282 MET 282 282 MET MET A . A 1 283 GLU 283 283 GLU GLU A . A 1 284 LYS 284 284 LYS LYS A . A 1 285 ASP 285 285 ASP ASP A . A 1 286 ILE 286 286 ILE ILE A . A 1 287 GLN 287 287 GLN GLN A . A 1 288 ALA 288 288 ALA ALA A . A 1 289 HIS 289 289 HIS HIS A . A 1 290 LYS 290 290 LYS LYS A . A 1 291 PHE 291 291 PHE PHE A . A 1 292 ILE 292 292 ILE ILE A . A 1 293 GLU 293 293 GLU GLU A . A 1 294 ALA 294 294 ALA ALA A . A 1 295 GLY 295 295 GLY GLY A . A 1 296 GLN 296 296 GLN GLN A . A 1 297 TYR 297 297 TYR TYR A . A 1 298 ASN 298 298 ASN ASN A . A 1 299 SER 299 299 SER SER A . A 1 300 HIS 300 300 HIS HIS A . A 1 301 LEU 301 301 LEU LEU A . A 1 302 TYR 302 302 TYR TYR A . A 1 303 GLY 303 303 GLY GLY A . A 1 304 THR 304 304 THR THR A . A 1 305 SER 305 305 SER SER A . A 1 306 VAL 306 306 VAL VAL A . A 1 307 GLN 307 307 GLN GLN A . A 1 308 SER 308 308 SER SER A . A 1 309 VAL 309 309 VAL VAL A . A 1 310 ARG 310 310 ARG ARG A . A 1 311 GLU 311 311 GLU GLU A . A 1 312 VAL 312 312 VAL VAL A . A 1 313 ALA 313 313 ALA ALA A . A 1 314 GLU 314 314 GLU GLU A . A 1 315 GLN 315 315 GLN GLN A . A 1 316 GLY 316 316 GLY GLY A . A 1 317 LYS 317 317 LYS LYS A . A 1 318 HIS 318 318 HIS HIS A . A 1 319 CYS 319 319 CYS CYS A . A 1 320 ILE 320 320 ILE ILE A . A 1 321 LEU 321 321 LEU LEU A . A 1 322 ASP 322 322 ASP ASP A . A 1 323 VAL 323 323 VAL VAL A . A 1 324 SER 324 324 SER SER A . A 1 325 ALA 325 325 ALA ALA A . A 1 326 ASN 326 326 ASN ASN A . A 1 327 ALA 327 327 ALA ALA A . A 1 328 VAL 328 328 VAL VAL A . A 1 329 ARG 329 329 ARG ARG A . A 1 330 ARG 330 330 ARG ARG A . A 1 331 LEU 331 331 LEU LEU A . A 1 332 GLN 332 332 GLN GLN A . A 1 333 ALA 333 333 ALA ALA A . A 1 334 ALA 334 334 ALA ALA A . A 1 335 HIS 335 335 HIS HIS A . A 1 336 LEU 336 336 LEU LEU A . A 1 337 HIS 337 337 HIS HIS A . A 1 338 PRO 338 338 PRO PRO A . A 1 339 ILE 339 339 ILE ILE A . A 1 340 ALA 340 340 ALA ALA A . A 1 341 ILE 341 341 ILE ILE A . A 1 342 PHE 342 342 PHE PHE A . A 1 343 ILE 343 343 ILE ILE A . A 1 344 ARG 344 344 ARG ARG A . A 1 345 PRO 345 345 PRO PRO A . A 1 346 ARG 346 346 ARG ARG A . A 1 347 SER 347 347 SER SER A . A 1 348 LEU 348 348 LEU LEU A . A 1 349 GLU 349 349 GLU GLU A . A 1 350 ASN 350 350 ASN ASN A . A 1 351 VAL 351 351 VAL VAL A . A 1 352 LEU 352 352 LEU LEU A . A 1 353 GLU 353 353 GLU GLU A . A 1 354 ILE 354 354 ILE ILE A . A 1 355 ASN 355 355 ASN ASN A . A 1 356 LYS 356 356 LYS LYS A . A 1 357 ARG 357 357 ARG ARG A . A 1 358 ILE 358 358 ILE ILE A . A 1 359 THR 359 359 THR THR A . A 1 360 GLU 360 360 GLU GLU A . A 1 361 GLU 361 361 GLU GLU A . A 1 362 GLN 362 362 GLN GLN A . A 1 363 ALA 363 363 ALA ALA A . A 1 364 ARG 364 364 ARG ARG A . A 1 365 LYS 365 365 LYS LYS A . A 1 366 ALA 366 366 ALA ALA A . A 1 367 PHE 367 367 PHE PHE A . A 1 368 ASP 368 368 ASP ASP A . A 1 369 ARG 369 369 ARG ARG A . A 1 370 ALA 370 370 ALA ALA A . A 1 371 THR 371 371 THR THR A . A 1 372 LYS 372 372 LYS LYS A . A 1 373 LEU 373 373 LEU LEU A . A 1 374 GLU 374 374 GLU GLU A . A 1 375 GLN 375 375 GLN GLN A . A 1 376 GLU 376 376 GLU GLU A . A 1 377 PHE 377 377 PHE PHE A . A 1 378 THR 378 378 THR THR A . A 1 379 GLU 379 379 GLU GLU A . A 1 380 CYS 380 380 CYS CYS A . A 1 381 PHE 381 381 PHE PHE A . A 1 382 SER 382 382 SER SER A . A 1 383 ALA 383 383 ALA ALA A . A 1 384 ILE 384 384 ILE ILE A . A 1 385 VAL 385 385 VAL VAL A . A 1 386 GLU 386 386 GLU GLU A . A 1 387 GLY 387 387 GLY GLY A . A 1 388 ASP 388 388 ASP ASP A . A 1 389 SER 389 389 SER SER A . A 1 390 PHE 390 390 PHE PHE A . A 1 391 GLU 391 391 GLU GLU A . A 1 392 GLU 392 392 GLU GLU A . A 1 393 ILE 393 393 ILE ILE A . A 1 394 TYR 394 394 TYR TYR A . A 1 395 HIS 395 395 HIS HIS A . A 1 396 LYS 396 396 LYS LYS A . A 1 397 VAL 397 397 VAL VAL A . A 1 398 LYS 398 398 LYS LYS A . A 1 399 ARG 399 399 ARG ARG A . A 1 400 VAL 400 400 VAL VAL A . A 1 401 ILE 401 401 ILE ILE A . A 1 402 GLU 402 402 GLU GLU A . A 1 403 ASP 403 403 ASP ASP A . A 1 404 LEU 404 404 LEU LEU A . A 1 405 SER 405 405 SER SER A . A 1 406 GLY 406 406 GLY GLY A . A 1 407 PRO 407 407 PRO PRO A . A 1 408 TYR 408 408 TYR TYR A . A 1 409 ILE 409 409 ILE ILE A . A 1 410 TRP 410 410 TRP TRP A . A 1 411 VAL 411 411 VAL VAL A . A 1 412 PRO 412 412 PRO PRO A . A 1 413 ALA 413 413 ALA ALA A . A 1 414 ARG 414 414 ARG ARG A . A 1 415 GLU 415 415 GLU GLU A . A 1 416 ARG 416 416 ARG ARG A . A 1 417 LEU 417 417 LEU LEU A . # # loop_ # # # loop_ _flr_experiment.ordinal_id _flr_experiment.id _flr_experiment.instrument_id _flr_experiment.inst_setting_id _flr_experiment.exp_condition_id _flr_experiment.sample_id _flr_experiment.details 1 1 1 1 1 1 'Sub-ensemble time-correlated single-photon-counting (seTCSPC) FRET measurements' 2 1 1 1 1 2 'Sub-ensemble time-correlated single-photon-counting (seTCSPC) FRET measurements' 3 1 1 1 1 3 'Sub-ensemble time-correlated single-photon-counting (seTCSPC) FRET measurements' 4 1 1 1 1 4 'Sub-ensemble time-correlated single-photon-counting (seTCSPC) FRET measurements' 5 1 1 1 1 5 'Sub-ensemble time-correlated single-photon-counting (seTCSPC) FRET measurements' 6 1 1 1 1 6 'Sub-ensemble time-correlated single-photon-counting (seTCSPC) FRET measurements' 7 1 1 1 1 7 'Sub-ensemble time-correlated single-photon-counting (seTCSPC) FRET measurements' 8 1 1 1 1 8 'Sub-ensemble time-correlated single-photon-counting (seTCSPC) FRET measurements' 9 1 1 1 1 9 'Sub-ensemble time-correlated single-photon-counting (seTCSPC) FRET measurements' 10 1 1 1 1 10 'Sub-ensemble time-correlated single-photon-counting (seTCSPC) FRET measurements' 11 1 1 1 1 11 'Sub-ensemble time-correlated single-photon-counting (seTCSPC) FRET measurements' 12 1 1 1 1 12 'Sub-ensemble time-correlated single-photon-counting (seTCSPC) FRET measurements' 13 1 1 1 1 13 'Sub-ensemble time-correlated single-photon-counting (seTCSPC) FRET measurements' 14 1 1 1 1 14 'Sub-ensemble time-correlated single-photon-counting (seTCSPC) FRET measurements' 15 1 1 1 1 15 'Sub-ensemble time-correlated single-photon-counting (seTCSPC) FRET measurements' 16 1 1 1 1 16 'Sub-ensemble time-correlated single-photon-counting (seTCSPC) FRET measurements' 17 1 1 1 1 17 'Sub-ensemble time-correlated single-photon-counting (seTCSPC) FRET measurements' 18 1 1 1 1 18 'Sub-ensemble time-correlated single-photon-counting (seTCSPC) FRET measurements' 19 1 1 1 1 19 'Sub-ensemble time-correlated single-photon-counting (seTCSPC) FRET measurements' 20 1 1 1 1 20 'Sub-ensemble time-correlated single-photon-counting (seTCSPC) FRET measurements' 21 1 1 1 1 21 'Sub-ensemble time-correlated single-photon-counting (seTCSPC) FRET measurements' 22 1 1 1 1 22 'Sub-ensemble time-correlated single-photon-counting (seTCSPC) FRET measurements' 23 1 1 1 1 23 'Sub-ensemble time-correlated single-photon-counting (seTCSPC) FRET measurements' 24 1 1 1 1 24 'Sub-ensemble time-correlated single-photon-counting (seTCSPC) FRET measurements' # # loop_ _flr_inst_setting.id _flr_inst_setting.details 1 'Two confocal setups were used, as indicated in the publication corresponding to these structures. In the first setup, freely diffusing molecules were excited as they passed through the focal volume of a 60x, 1.2NA collar corrected Olympus objective. Excitation was achieved via pulsed interleaved excitation with diode lasers (PicoQuant, Germany) at 485 nm (80 uW) and 640 (32 uW) nm for donor and acceptor, respectively, pulsed at 20MHz. Emission was spatially filtered with a 60um or 100um pinhole, separated into color and polarization channels via ET525/50 and ET720/150 band pass filters (Chroma Technology Co.), and collected into four detectors (one for each channel), PMA Hybrid 40 (PicoQuant, Germany) for donor and PMA Hybrid 50 (PicoQuant, Germany) for acceptor. Temporal data registration was achieved vi HydraHarp 400 TCSPC module (PicoQuant, Germany). The second confocal setup was similar but utilized PIE at 32MHz with the same laser lines. Data registration utilized 4 detectors per color channel, APD SPCM-AQR-14 (Perkin Elmer, Germany) for red and tau-SPAD (PicoQuant, Germany) for green. ' # # loop_ _flr_exp_condition.id _flr_exp_condition.details 1 'Measurements carried out at room temperature.' # # loop_ _flr_instrument.id _flr_instrument.details 1 'Samples were measured on a home-built multiparameter fluorescence detection setup. Samples were excited via pulsed-interleaved excitation and fluorescence emission was collected in 4 collection channels corresponding to polarization and color separation useing time-correlated single-photon counting electronics.' # # loop_ _flr_entity_assembly.ordinal_id _flr_entity_assembly.assembly_id _flr_entity_assembly.entity_id _flr_entity_assembly.num_copies _flr_entity_assembly.entity_description 1 1 1 1 . 2 2 2 1 . # # loop_ _flr_sample_condition.id _flr_sample_condition.details 1 'PBS pH 7.5, ~10pM sample' # # loop_ _flr_sample.id _flr_sample.entity_assembly_id _flr_sample.num_of_probes _flr_sample.sample_condition_id _flr_sample.sample_description _flr_sample.sample_details _flr_sample.solvent_phase 1 1 2 1 'State A Restraint for PSD95 R313C-S606C' . liquid 2 1 2 1 'State A Restraint for PSD95 R313C-E618C' . liquid 3 1 2 1 'State A Restraint for PSD95 R313C-E621C' . liquid 4 1 2 1 'State A Restraint for PSD95 Q374C-R492C' . liquid 5 1 2 1 'State A Restraint for PSD95 Q374C-K591C' . liquid 6 1 2 1 'State A Restraint for PSD95 Q374C-R671C' . liquid 7 1 2 1 'State A Restraint for PSD95 S398C-R492C' . liquid 8 1 2 1 'State A Restraint for PSD95 S398C-E621C' . liquid 9 1 2 1 'State A Restraint for PSD95 S398C-A640C' . liquid 10 1 3 1 'State A Restraint for PSD95 R492C-R671C' . liquid 11 1 4 1 'State A Restraint for PSD95 S510C-K591C' . liquid 12 1 5 1 'State A Restraint for PSD95 H477C-K591C' . liquid 13 1 2 1 'State B Restraint for PSD95 R313C-S606C' . liquid 14 1 2 1 'State B Restraint for PSD95 R313C-E618C' . liquid 15 1 2 1 'State B Restraint for PSD95 R313C-E621C' . liquid 16 1 2 1 'State B Restraint for PSD95 Q374C-R492C' . liquid 17 1 2 1 'State B Restraint for PSD95 Q374C-K591C' . liquid 18 1 2 1 'State B Restraint for PSD95 Q374C-R671C' . liquid 19 1 2 1 'State B Restraint for PSD95 S398C-R492C' . liquid 20 1 2 1 'State B Restraint for PSD95 S398C-E621C' . liquid 21 1 2 1 'State B Restraint for PSD95 S398C-A640C' . liquid 22 1 3 1 'State B Restraint for PSD95 R492C-R671C' . liquid 23 1 4 1 'State B Restraint for PSD95 S510C-K591C' . liquid 24 1 5 1 'State B Restraint for PSD95 H477C-K591C' . liquid 25 2 1 1 'Donor-only subensemble' . liquid # # loop_ _flr_probe_list.probe_id _flr_probe_list.chromophore_name _flr_probe_list.reactive_probe_flag _flr_probe_list.reactive_probe_name _flr_probe_list.probe_origin _flr_probe_list.probe_link_type 1 'Alexa-488 C5-maleimide' YES 'Alexa-488 C5-maleimide' intrinsic covalent 2 'Alexa-647 C2-maleimide' YES 'Alexa-647 C2-maleimide' extrinsic covalent 3 'Alexa-488 C5-maleimide' YES 'Alexa-488 C5-maleimide' extrinsic covalent # # loop_ _flr_probe_descriptor.probe_id _flr_probe_descriptor.reactive_probe_chem_descriptor_id _flr_probe_descriptor.chromophore_chem_descriptor_id _flr_probe_descriptor.chromophore_center_atom 1 1 2 . 2 3 4 . 3 1 2 . # # loop_ _flr_sample_probe_details.sample_probe_id _flr_sample_probe_details.sample_id _flr_sample_probe_details.probe_id _flr_sample_probe_details.fluorophore_type _flr_sample_probe_details.description _flr_sample_probe_details.poly_probe_position_id 1 1 1 donor 'Donor for PSD95 R313C-S606C' 1 2 1 2 acceptor 'Acceptor for PSD95 R313C-S606C' 2 3 2 1 donor 'Donor for PSD95 R313C-E618C' 1 4 2 2 acceptor 'Acceptor for PSD95 R313C-E618C' 3 5 3 1 donor 'Donor for PSD95 R313C-E621C' 1 6 3 2 acceptor 'Acceptor for PSD95 R313C-E621C' 4 7 4 1 donor 'Donor for PSD95 Q374C-R492C' 5 8 4 2 acceptor 'Acceptor for PSD95 Q374C-R492C' 6 9 5 1 donor 'Donor for PSD95 Q374C-K591C' 5 10 5 2 acceptor 'Acceptor for PSD95 Q374C-K591C' 7 11 6 1 donor 'Donor for PSD95 R492C-R671C' 5 12 6 2 acceptor 'Acceptor for PSD95 R492C-R671C' 8 13 7 1 donor 'Donor for PSD95 S510C-K591C' 9 14 7 2 acceptor 'Acceptor for PSD95 S510C-K591C' 6 15 8 1 donor 'Donor for PSD95 H477C-K591C' 9 16 8 2 acceptor 'Acceptor for PSD95 H477C-K591C' 4 17 9 1 donor 'Donor for PSD95 S398C-A640C' 9 18 9 2 acceptor 'Acceptor for PSD95 S398C-A640C' 10 19 10 1 donor 'Donor for PSD95 S398C-A640C' 6 20 10 2 acceptor 'Acceptor for PSD95 S398C-A640C' 8 21 11 1 donor 'Donor for PSD95 S398C-A640C' 11 22 11 2 acceptor 'Acceptor for PSD95 S398C-A640C' 7 23 12 1 donor 'Donor for PSD95 S398C-A640C' 12 24 12 2 acceptor 'Acceptor for PSD95 S398C-A640C' 7 25 13 1 donor 'Donor for PSD95 R313C-S606C' 1 26 13 2 acceptor 'Acceptor for PSD95 R313C-S606C' 2 27 14 1 donor 'Donor for PSD95 R313C-E618C' 1 28 14 2 acceptor 'Acceptor for PSD95 R313C-E618C' 3 29 15 1 donor 'Donor for PSD95 R313C-E621C' 1 30 15 2 acceptor 'Acceptor for PSD95 R313C-E621C' 4 31 16 1 donor 'Donor for PSD95 Q374C-R492C' 5 32 16 2 acceptor 'Acceptor for PSD95 Q374C-R492C' 6 33 17 1 donor 'Donor for PSD95 Q374C-K591C' 5 34 17 2 acceptor 'Acceptor for PSD95 Q374C-K591C' 7 35 18 1 donor 'Donor for PSD95 Q374C-R671C' 5 36 18 2 acceptor 'Acceptor for PSD95 Q374C-R671C' 8 37 19 1 donor 'Donor for PSD95 S398C-R492C' 9 38 19 2 acceptor 'Acceptor for PSD95 S398C-R492C' 6 39 20 1 donor 'Donor for PSD95 S398C-E621C' 9 40 20 2 acceptor 'Acceptor for PSD95 S398C-E621C' 4 41 21 1 donor 'Donor for PSD95 S398C-A640C' 9 42 21 2 acceptor 'Acceptor for PSD95 S398C-A640C' 10 43 22 1 donor 'Donor for PSD95 R492C-R671C' 6 44 22 2 acceptor 'Acceptor for PSD95 R492C-R671C' 8 45 23 1 donor 'Donor for PSD95 S510C-K591C' 11 46 23 2 acceptor 'Acceptor for PSD95 S510C-K591C' 7 47 24 1 donor 'Donor for PSD95 H477C-K591C' 12 48 24 2 acceptor 'Acceptor for PSD95 H477C-K591C' 7 49 25 3 donor 'Donor Reference PSD95 R313C-S606C Mutant' 13 50 25 3 donor 'Donor Reference PSD95 R313C-E618C Mutant' 14 51 25 3 donor 'Donor Reference PSD95 R313C-E621C Mutant' 15 52 25 3 donor 'Donor Reference PSD95 Q374C-R492C Mutant' 16 53 25 3 donor 'Donor Reference PSD95 Q374C-K591C Mutant' 17 54 25 3 donor 'Donor Reference PSD95 Q374C-R671C Mutant' 18 55 25 3 donor 'Donor Reference PSD95 S398C-R492C Mutant' 19 56 25 3 donor 'Donor Reference PSD95 S398C-E621C Mutant' 20 57 25 3 donor 'Donor Reference PSD95 S398C-A640C Mutant' 21 58 25 3 donor 'Donor Reference PSD95 R492C-R671C Mutant' 22 59 25 3 donor 'Donor Reference PSD95 S510C-K591C Mutant' 23 60 25 3 donor 'Donor Reference PSD95 H477C-K591C Mutant' 24 # # loop_ _flr_poly_probe_position.id _flr_poly_probe_position.entity_id _flr_poly_probe_position.entity_description _flr_poly_probe_position.asym_id _flr_poly_probe_position.seq_id _flr_poly_probe_position.comp_id _flr_poly_probe_position.atom_id _flr_poly_probe_position.mutation_flag _flr_poly_probe_position.modification_flag _flr_poly_probe_position.auth_name 1 1 . A 6 ARG SG YES NO 6 2 1 . A 299 SER SG YES NO 299 3 1 . A 311 GLU SG YES NO 311 4 1 . A 314 GLU SG YES NO 314 5 1 . A 67 GLN SG YES NO 67 6 1 . A 185 ARG SG YES NO 185 7 1 . A 284 LYS SG YES NO 284 8 1 . A 364 ARG SG YES NO 364 9 1 . A 91 SER SG YES NO 91 10 1 . A 333 ALA SG YES NO 333 11 1 . A 203 SER SG YES NO 203 12 1 . A 170 HIS SG YES NO 170 13 1 . A 6 ARG SG YES NO R313C-S606C 14 1 . A 6 ARG SG YES NO R313C-E618C 15 1 . A 6 ARG SG YES NO R313C-E621C 16 1 . A 67 GLN SG YES NO Q374C-R492C 17 1 . A 67 GLN SG YES NO Q374C-K591C 18 1 . A 67 GLN SG YES NO Q374C-R671C 19 1 . A 91 SER SG YES NO S398C-R492C 20 1 . A 91 SER SG YES NO S398C-E621C 21 1 . A 91 SER SG YES NO S398C-A640C 22 1 . A 185 ARG SG YES NO R492C-R671C 23 1 . A 203 SER SG YES NO S510C-K591C 24 1 . A 170 HIS SG YES NO H477C-K591C # # loop_ _flr_poly_probe_position_mutated.id _flr_poly_probe_position_mutated.chem_comp_id _flr_poly_probe_position_mutated.atom_id 1 CYS SG 2 CYS SG 3 CYS SG 4 CYS SG 5 CYS SG 6 CYS SG 7 CYS SG 8 CYS SG 9 CYS SG 10 CYS SG 11 CYS SG 12 CYS SG 13 CYS SG 14 CYS SG 15 CYS SG 16 CYS SG 17 CYS SG 18 CYS SG 19 CYS SG 20 CYS SG 21 CYS SG 22 CYS SG 23 CYS SG 24 CYS SG # # loop_ _flr_poly_probe_conjugate.id _flr_poly_probe_conjugate.sample_probe_id _flr_poly_probe_conjugate.chem_descriptor_id _flr_poly_probe_conjugate.ambiguous_stoichiometry_flag _flr_poly_probe_conjugate.probe_stoichiometry 1 49 5 YES . 2 50 5 YES . 3 51 5 YES . 4 52 5 YES . 5 53 5 YES . 6 54 5 YES . 7 55 5 YES . 8 56 5 YES . 9 57 5 YES . 10 58 5 YES . 11 59 5 YES . 12 60 5 YES . 13 1 5 YES . 14 3 5 YES . 15 5 5 YES . 16 7 5 YES . 17 9 5 YES . 18 11 5 YES . 19 13 5 YES . 20 15 5 YES . 21 17 5 YES . 22 19 5 YES . 23 21 5 YES . 24 23 5 YES . 25 25 5 YES . 26 27 5 YES . 27 29 5 YES . 28 31 5 YES . 29 33 5 YES . 30 35 5 YES . 31 37 5 YES . 32 39 5 YES . 33 41 5 YES . 34 43 5 YES . 35 45 5 YES . 36 47 5 YES . 37 2 6 YES . 38 4 6 YES . 39 6 6 YES . 40 8 6 YES . 41 10 6 YES . 42 12 6 YES . 43 14 6 YES . 44 16 6 YES . 45 18 6 YES . 46 20 6 YES . 47 22 6 YES . 48 24 6 YES . 49 26 6 YES . 50 28 6 YES . 51 30 6 YES . 52 32 6 YES . 53 34 6 YES . 54 36 6 YES . 55 38 6 YES . 56 40 6 YES . 57 42 6 YES . 58 44 6 YES . 59 46 6 YES . 60 48 6 YES . # # loop_ _flr_fret_forster_radius.id _flr_fret_forster_radius.donor_probe_id _flr_fret_forster_radius.acceptor_probe_id _flr_fret_forster_radius.forster_radius _flr_fret_forster_radius.reduced_forster_radius 1 1 2 52.000 . 2 1 2 52.000 . 3 1 2 52.000 . 4 1 2 52.000 . 5 1 2 52.000 . 6 1 2 52.000 . 7 1 2 52.000 . 8 1 2 52.000 . 9 1 2 52.000 . 10 1 2 52.000 . 11 1 2 52.000 . 12 1 2 52.000 . 13 1 2 52.000 . 14 1 2 52.000 . 15 1 2 52.000 . 16 1 2 52.000 . 17 1 2 52.000 . 18 1 2 52.000 . 19 1 2 52.000 . 20 1 2 52.000 . 21 1 2 52.000 . 22 1 2 52.000 . 23 1 2 52.000 . 24 1 2 52.000 . # # loop_ _flr_lifetime_fit_model.id _flr_lifetime_fit_model.name _flr_lifetime_fit_model.description _flr_lifetime_fit_model.external_file_id _flr_lifetime_fit_model.citation_id 1 'Repeated fitting of FRET-sensitized donor fluorescence decay curves using subsets of samples. Reported Chi^2 parameter corresponds to representative global fit of all datasets simultaneously. Distance restraints correspond to restraints from repeated fitting procedure described in Citation 1' . . 1 2 'Repeated fitting of FRET-sensitized donor fluorescence decay curves using subsets of samples. Reported Chi^2 parameter corresponds to representative global fit of all datasets simultaneously. Distance restraints correspond to restraints from repeated fitting procedure described in Citation 2' . . 1 3 'Repeated fitting of FRET-sensitized donor fluorescence decay curves using subsets of samples. Reported Chi^2 parameter corresponds to representative global fit of all datasets simultaneously. Distance restraints correspond to restraints from repeated fitting procedure described in Citation 3' . . 1 4 'Repeated fitting of FRET-sensitized donor fluorescence decay curves using subsets of samples. Reported Chi^2 parameter corresponds to representative global fit of all datasets simultaneously. Distance restraints correspond to restraints from repeated fitting procedure described in Citation 4' . . 1 5 'Repeated fitting of FRET-sensitized donor fluorescence decay curves using subsets of samples. Reported Chi^2 parameter corresponds to representative global fit of all datasets simultaneously. Distance restraints correspond to restraints from repeated fitting procedure described in Citation 5' . . 1 6 'Repeated fitting of FRET-sensitized donor fluorescence decay curves using subsets of samples. Reported Chi^2 parameter corresponds to representative global fit of all datasets simultaneously. Distance restraints correspond to restraints from repeated fitting procedure described in Citation 6' . . 1 7 'Repeated fitting of FRET-sensitized donor fluorescence decay curves using subsets of samples. Reported Chi^2 parameter corresponds to representative global fit of all datasets simultaneously. Distance restraints correspond to restraints from repeated fitting procedure described in Citation 7' . . 1 8 'Repeated fitting of FRET-sensitized donor fluorescence decay curves using subsets of samples. Reported Chi^2 parameter corresponds to representative global fit of all datasets simultaneously. Distance restraints correspond to restraints from repeated fitting procedure described in Citation 8' . . 1 9 'Repeated fitting of FRET-sensitized donor fluorescence decay curves using subsets of samples. Reported Chi^2 parameter corresponds to representative global fit of all datasets simultaneously. Distance restraints correspond to restraints from repeated fitting procedure described in Citation 9' . . 1 10 'Repeated fitting of FRET-sensitized donor fluorescence decay curves using subsets of samples. Reported Chi^2 parameter corresponds to representative global fit of all datasets simultaneously. Distance restraints correspond to restraints from repeated fitting procedure described in Citation 10' . . 1 11 'Repeated fitting of FRET-sensitized donor fluorescence decay curves using subsets of samples. Reported Chi^2 parameter corresponds to representative global fit of all datasets simultaneously. Distance restraints correspond to restraints from repeated fitting procedure described in Citation 11' . . 1 12 'Repeated fitting of FRET-sensitized donor fluorescence decay curves using subsets of samples. Reported Chi^2 parameter corresponds to representative global fit of all datasets simultaneously. Distance restraints correspond to restraints from repeated fitting procedure described in Citation 12' . . 1 13 'Repeated fitting of FRET-sensitized donor fluorescence decay curves using subsets of samples. Reported Chi^2 parameter corresponds to representative global fit of all datasets simultaneously. Distance restraints correspond to restraints from repeated fitting procedure described in Citation 13' . . 1 14 'Repeated fitting of FRET-sensitized donor fluorescence decay curves using subsets of samples. Reported Chi^2 parameter corresponds to representative global fit of all datasets simultaneously. Distance restraints correspond to restraints from repeated fitting procedure described in Citation 14' . . 1 15 'Repeated fitting of FRET-sensitized donor fluorescence decay curves using subsets of samples. Reported Chi^2 parameter corresponds to representative global fit of all datasets simultaneously. Distance restraints correspond to restraints from repeated fitting procedure described in Citation 15' . . 1 16 'Repeated fitting of FRET-sensitized donor fluorescence decay curves using subsets of samples. Reported Chi^2 parameter corresponds to representative global fit of all datasets simultaneously. Distance restraints correspond to restraints from repeated fitting procedure described in Citation 16' . . 1 17 'Repeated fitting of FRET-sensitized donor fluorescence decay curves using subsets of samples. Reported Chi^2 parameter corresponds to representative global fit of all datasets simultaneously. Distance restraints correspond to restraints from repeated fitting procedure described in Citation 17' . . 1 18 'Repeated fitting of FRET-sensitized donor fluorescence decay curves using subsets of samples. Reported Chi^2 parameter corresponds to representative global fit of all datasets simultaneously. Distance restraints correspond to restraints from repeated fitting procedure described in Citation 18' . . 1 19 'Repeated fitting of FRET-sensitized donor fluorescence decay curves using subsets of samples. Reported Chi^2 parameter corresponds to representative global fit of all datasets simultaneously. Distance restraints correspond to restraints from repeated fitting procedure described in Citation 19' . . 1 20 'Repeated fitting of FRET-sensitized donor fluorescence decay curves using subsets of samples. Reported Chi^2 parameter corresponds to representative global fit of all datasets simultaneously. Distance restraints correspond to restraints from repeated fitting procedure described in Citation 20' . . 1 21 'Repeated fitting of FRET-sensitized donor fluorescence decay curves using subsets of samples. Reported Chi^2 parameter corresponds to representative global fit of all datasets simultaneously. Distance restraints correspond to restraints from repeated fitting procedure described in Citation 21' . . 1 22 'Repeated fitting of FRET-sensitized donor fluorescence decay curves using subsets of samples. Reported Chi^2 parameter corresponds to representative global fit of all datasets simultaneously. Distance restraints correspond to restraints from repeated fitting procedure described in Citation 22' . . 1 23 'Repeated fitting of FRET-sensitized donor fluorescence decay curves using subsets of samples. Reported Chi^2 parameter corresponds to representative global fit of all datasets simultaneously. Distance restraints correspond to restraints from repeated fitting procedure described in Citation 23' . . 1 24 'Repeated fitting of FRET-sensitized donor fluorescence decay curves using subsets of samples. Reported Chi^2 parameter corresponds to representative global fit of all datasets simultaneously. Distance restraints correspond to restraints from repeated fitting procedure described in Citation 24' . . 1 # # loop_ _flr_reference_measurement_group.id _flr_reference_measurement_group.num_measurements _flr_reference_measurement_group.details 1 1 1 2 1 2 3 1 3 4 1 4 5 1 5 6 1 6 7 1 7 8 1 8 9 1 9 10 1 10 11 1 11 12 1 12 # # loop_ _flr_reference_measurement_group_link.group_id _flr_reference_measurement_group_link.reference_measurement_id 1 1 2 2 3 3 4 4 5 5 6 6 7 7 8 8 9 9 10 10 11 11 12 12 # # loop_ _flr_reference_measurement.id _flr_reference_measurement.reference_sample_probe_id _flr_reference_measurement.num_species _flr_reference_measurement.details 1 49 1 'Donly for PSD95 R313C-S606C Mutant' 2 50 1 'Donly for PSD95 R313C-E618C Mutant' 3 51 1 'Donly for PSD95 R313C-E621C Mutant' 4 52 1 'Donly for PSD95 Q374C-R492C Mutant' 5 53 1 'Donly for PSD95 Q374C-K591C Mutant' 6 54 1 'Donly for PSD95 Q374C-R671C Mutant' 7 55 1 'Donly for PSD95 S398C-R492C Mutant' 8 56 1 'Donly for PSD95 S398C-E621C Mutant' 9 57 1 'Donly for PSD95 S398C-A640C Mutant' 10 58 1 'Donly for PSD95 R492C-R671C Mutant' 11 59 1 'Donly for PSD95 S510C-K591C Mutant' 12 60 1 'Donly for PSD95 H477C-K591C Mutant' # # loop_ _flr_reference_measurement_lifetime.ordinal_id _flr_reference_measurement_lifetime.reference_measurement_id _flr_reference_measurement_lifetime.species_name _flr_reference_measurement_lifetime.species_fraction _flr_reference_measurement_lifetime.lifetime 1 1 . 1.000 3.769 2 2 . 1.000 3.559 3 3 . 1.000 3.792 4 4 . 1.000 3.375 5 5 . 1.000 3.590 6 6 . 1.000 3.598 7 7 . 1.000 4.040 8 8 . 1.000 3.759 9 9 . 1.000 3.855 10 10 . 1.000 3.495 11 11 . 1.000 3.555 12 12 . 1.000 3.637 # # loop_ _flr_fret_analysis.id _flr_fret_analysis.experiment_id _flr_fret_analysis.type _flr_fret_analysis.sample_probe_id_1 _flr_fret_analysis.sample_probe_id_2 _flr_fret_analysis.forster_radius_id _flr_fret_analysis.dataset_list_id _flr_fret_analysis.external_file_id _flr_fret_analysis.software_id 1 1 lifetime-based 1 2 1 2 1 1 2 1 lifetime-based 3 4 2 2 2 1 3 1 lifetime-based 5 6 3 2 3 1 4 1 lifetime-based 7 8 4 2 4 1 5 1 lifetime-based 9 10 5 2 5 1 6 1 lifetime-based 11 12 6 2 6 1 7 1 lifetime-based 13 14 7 2 7 1 8 1 lifetime-based 15 16 8 2 8 1 9 1 lifetime-based 17 18 9 2 9 1 10 1 lifetime-based 19 20 10 2 10 1 11 1 lifetime-based 21 22 11 2 11 1 12 1 lifetime-based 23 24 12 2 12 1 13 1 lifetime-based 25 26 13 2 1 1 14 1 lifetime-based 27 28 14 2 2 1 15 1 lifetime-based 29 30 15 2 3 1 16 1 lifetime-based 31 32 16 2 4 1 17 1 lifetime-based 33 34 17 2 5 1 18 1 lifetime-based 35 36 18 2 6 1 19 1 lifetime-based 37 38 19 2 7 1 20 1 lifetime-based 39 40 20 2 8 1 21 1 lifetime-based 41 42 21 2 9 1 22 1 lifetime-based 43 44 22 2 10 1 23 1 lifetime-based 45 46 23 2 11 1 24 1 lifetime-based 47 48 24 2 12 1 # # loop_ _flr_fret_analysis_lifetime.ordinal_id _flr_fret_analysis_lifetime.analysis_id _flr_fret_analysis_lifetime.reference_measurement_group_id _flr_fret_analysis_lifetime.lifetime_fit_model_id _flr_fret_analysis_lifetime.donor_only_fraction _flr_fret_analysis_lifetime.chi_square_reduced _flr_fret_analysis_lifetime.method_name _flr_fret_analysis_lifetime.details 1 1 1 1 . 1.150 'Lifetime Fit' . 2 2 2 2 . 2.120 'Lifetime Fit' . 3 3 3 3 . 2.110 'Lifetime Fit' . 4 4 4 4 . 1.960 'Lifetime Fit' . 5 5 5 5 . 1.220 'Lifetime Fit' . 6 6 6 6 . 2.540 'Lifetime Fit' . 7 7 7 7 . 0.450 'Lifetime Fit' . 8 8 8 8 . 1.490 'Lifetime Fit' . 9 9 9 9 . 1.130 'Lifetime Fit' . 10 10 10 10 . 0.920 'Lifetime Fit' . 11 11 11 11 . 1.840 'Lifetime Fit' . 12 12 12 12 . 1.610 'Lifetime Fit' . 13 13 1 13 . 1.150 'Lifetime Fit' . 14 14 2 14 . 2.120 'Lifetime Fit' . 15 15 3 15 . 2.110 'Lifetime Fit' . 16 16 4 16 . 1.960 'Lifetime Fit' . 17 17 5 17 . 1.220 'Lifetime Fit' . 18 18 6 18 . 2.540 'Lifetime Fit' . 19 19 7 19 . 0.450 'Lifetime Fit' . 20 20 8 20 . 1.490 'Lifetime Fit' . 21 21 9 21 . 1.130 'Lifetime Fit' . 22 22 10 22 . 0.920 'Lifetime Fit' . 23 23 11 23 . 1.840 'Lifetime Fit' . 24 24 12 24 . 1.610 'Lifetime Fit' . # # loop_ _flr_peak_assignment.id _flr_peak_assignment.method_name _flr_peak_assignment.details 1 Population 'In global fit, peaks were assigned to states through setting of a global population fraction parameter per state' # # loop_ _flr_fret_distance_restraint.ordinal_id _flr_fret_distance_restraint.id _flr_fret_distance_restraint.group_id _flr_fret_distance_restraint.sample_probe_id_1 _flr_fret_distance_restraint.sample_probe_id_2 _flr_fret_distance_restraint.state_id _flr_fret_distance_restraint.analysis_id _flr_fret_distance_restraint.distance _flr_fret_distance_restraint.distance_error_plus _flr_fret_distance_restraint.distance_error_minus _flr_fret_distance_restraint.distance_type _flr_fret_distance_restraint.population_fraction _flr_fret_distance_restraint.peak_assignment_id 1 1 1 1 2 1 1 77.300 5.600 5.600 0.461 1 2 2 1 3 4 1 2 85.800 6.300 6.300 0.461 1 3 3 1 5 6 1 3 75.400 5.500 5.500 0.461 1 4 4 1 7 8 1 4 36.900 2.700 2.700 0.461 1 5 5 1 9 10 1 5 81.600 6.000 6.000 0.461 1 6 6 1 11 12 1 6 68.100 5.000 5.000 0.461 1 7 7 1 13 14 1 7 28.300 2.100 2.100 0.461 1 8 8 1 15 16 1 8 66.300 4.800 4.800 0.461 1 9 9 1 17 18 1 9 64.300 4.700 4.700 0.461 1 10 10 1 19 20 1 10 33.400 2.400 2.400 0.461 1 11 11 1 21 22 1 11 38.800 2.800 2.800 0.461 1 12 12 1 23 24 1 12 65.900 4.800 4.800 0.461 1 13 13 2 25 26 2 13 27.200 2.400 2.400 0.539 1 14 14 2 27 28 2 14 41.400 3.600 3.600 0.539 1 15 15 2 29 30 2 15 34.100 3.000 3.000 0.539 1 16 16 2 31 32 2 16 59.100 5.100 5.100 0.539 1 17 17 2 33 34 2 17 34.500 3.000 3.000 0.539 1 18 18 2 35 36 2 18 37.700 3.300 3.300 0.539 1 19 19 2 37 38 2 19 52.000 4.500 4.500 0.539 1 20 20 2 39 40 2 20 35.600 3.100 3.100 0.539 1 21 21 2 41 42 2 21 41.000 3.600 3.600 0.539 1 22 22 2 43 44 2 22 53.500 4.700 4.700 0.539 1 23 23 2 45 46 2 23 73.200 6.400 6.400 0.539 1 24 24 2 47 48 2 24 33.700 2.900 2.900 0.539 1 # # loop_ _flr_fret_model_quality.model_id _flr_fret_model_quality.chi_square_reduced _flr_fret_model_quality.dataset_group_id _flr_fret_model_quality.method _flr_fret_model_quality.details 1 0.700 2 Chi-square 'Calculated using all 12 FRET distances for the model relative to the restraint in FLR' 2 0.840 2 Chi-square 'Calculated using all 12 FRET distances for the model relative to the restraint in FLR' 3 0.850 2 Chi-square 'Calculated using all 12 FRET distances for the model relative to the restraint in FLR' 4 0.860 2 Chi-square 'Calculated using all 12 FRET distances for the model relative to the restraint in FLR' 5 0.880 2 Chi-square 'Calculated using all 12 FRET distances for the model relative to the restraint in FLR' 6 0.910 2 Chi-square 'Calculated using all 12 FRET distances for the model relative to the restraint in FLR' 7 0.920 2 Chi-square 'Calculated using all 12 FRET distances for the model relative to the restraint in FLR' 8 0.950 2 Chi-square 'Calculated using all 12 FRET distances for the model relative to the restraint in FLR' 9 0.980 2 Chi-square 'Calculated using all 12 FRET distances for the model relative to the restraint in FLR' 10 1.000 2 Chi-square 'Calculated using all 12 FRET distances for the model relative to the restraint in FLR' 11 1.000 2 Chi-square 'Calculated using all 12 FRET distances for the model relative to the restraint in FLR' 12 1.020 2 Chi-square 'Calculated using all 12 FRET distances for the model relative to the restraint in FLR' 13 1.060 2 Chi-square 'Calculated using all 12 FRET distances for the model relative to the restraint in FLR' 14 1.060 2 Chi-square 'Calculated using all 12 FRET distances for the model relative to the restraint in FLR' 15 1.070 2 Chi-square 'Calculated using all 12 FRET distances for the model relative to the restraint in FLR' 16 1.070 2 Chi-square 'Calculated using all 12 FRET distances for the model relative to the restraint in FLR' 17 1.080 2 Chi-square 'Calculated using all 12 FRET distances for the model relative to the restraint in FLR' 18 1.090 2 Chi-square 'Calculated using all 12 FRET distances for the model relative to the restraint in FLR' 19 1.100 2 Chi-square 'Calculated using all 12 FRET distances for the model relative to the restraint in FLR' 20 1.100 2 Chi-square 'Calculated using all 12 FRET distances for the model relative to the restraint in FLR' 21 1.110 2 Chi-square 'Calculated using all 12 FRET distances for the model relative to the restraint in FLR' 22 1.120 2 Chi-square 'Calculated using all 12 FRET distances for the model relative to the restraint in FLR' 23 1.120 2 Chi-square 'Calculated using all 12 FRET distances for the model relative to the restraint in FLR' 24 1.120 2 Chi-square 'Calculated using all 12 FRET distances for the model relative to the restraint in FLR' 25 1.120 2 Chi-square 'Calculated using all 12 FRET distances for the model relative to the restraint in FLR' 26 1.120 2 Chi-square 'Calculated using all 12 FRET distances for the model relative to the restraint in FLR' 27 1.130 2 Chi-square 'Calculated using all 12 FRET distances for the model relative to the restraint in FLR' 28 1.140 2 Chi-square 'Calculated using all 12 FRET distances for the model relative to the restraint in FLR' 29 1.140 2 Chi-square 'Calculated using all 12 FRET distances for the model relative to the restraint in FLR' 30 1.140 2 Chi-square 'Calculated using all 12 FRET distances for the model relative to the restraint in FLR' 31 1.140 2 Chi-square 'Calculated using all 12 FRET distances for the model relative to the restraint in FLR' 32 1.150 2 Chi-square 'Calculated using all 12 FRET distances for the model relative to the restraint in FLR' 33 1.150 2 Chi-square 'Calculated using all 12 FRET distances for the model relative to the restraint in FLR' 34 1.150 2 Chi-square 'Calculated using all 12 FRET distances for the model relative to the restraint in FLR' 35 1.160 2 Chi-square 'Calculated using all 12 FRET distances for the model relative to the restraint in FLR' 36 1.160 2 Chi-square 'Calculated using all 12 FRET distances for the model relative to the restraint in FLR' 37 1.170 2 Chi-square 'Calculated using all 12 FRET distances for the model relative to the restraint in FLR' 38 1.170 2 Chi-square 'Calculated using all 12 FRET distances for the model relative to the restraint in FLR' 39 1.170 2 Chi-square 'Calculated using all 12 FRET distances for the model relative to the restraint in FLR' 40 1.190 2 Chi-square 'Calculated using all 12 FRET distances for the model relative to the restraint in FLR' 41 1.190 2 Chi-square 'Calculated using all 12 FRET distances for the model relative to the restraint in FLR' 42 1.190 2 Chi-square 'Calculated using all 12 FRET distances for the model relative to the restraint in FLR' 43 1.190 2 Chi-square 'Calculated using all 12 FRET distances for the model relative to the restraint in FLR' 44 1.200 2 Chi-square 'Calculated using all 12 FRET distances for the model relative to the restraint in FLR' 45 1.200 2 Chi-square 'Calculated using all 12 FRET distances for the model relative to the restraint in FLR' 46 1.210 2 Chi-square 'Calculated using all 12 FRET distances for the model relative to the restraint in FLR' 47 1.210 2 Chi-square 'Calculated using all 12 FRET distances for the model relative to the restraint in FLR' 48 1.210 2 Chi-square 'Calculated using all 12 FRET distances for the model relative to the restraint in FLR' 49 1.220 2 Chi-square 'Calculated using all 12 FRET distances for the model relative to the restraint in FLR' 50 1.220 2 Chi-square 'Calculated using all 12 FRET distances for the model relative to the restraint in FLR' 51 1.230 2 Chi-square 'Calculated using all 12 FRET distances for the model relative to the restraint in FLR' 52 1.230 2 Chi-square 'Calculated using all 12 FRET distances for the model relative to the restraint in FLR' 53 1.230 2 Chi-square 'Calculated using all 12 FRET distances for the model relative to the restraint in FLR' 54 1.230 2 Chi-square 'Calculated using all 12 FRET distances for the model relative to the restraint in FLR' 55 1.230 2 Chi-square 'Calculated using all 12 FRET distances for the model relative to the restraint in FLR' 56 1.230 2 Chi-square 'Calculated using all 12 FRET distances for the model relative to the restraint in FLR' 57 1.230 2 Chi-square 'Calculated using all 12 FRET distances for the model relative to the restraint in FLR' 58 1.240 2 Chi-square 'Calculated using all 12 FRET distances for the model relative to the restraint in FLR' 59 1.240 2 Chi-square 'Calculated using all 12 FRET distances for the model relative to the restraint in FLR' 60 1.240 2 Chi-square 'Calculated using all 12 FRET distances for the model relative to the restraint in FLR' 61 1.240 2 Chi-square 'Calculated using all 12 FRET distances for the model relative to the restraint in FLR' 62 1.250 2 Chi-square 'Calculated using all 12 FRET distances for the model relative to the restraint in FLR' 63 1.250 2 Chi-square 'Calculated using all 12 FRET distances for the model relative to the restraint in FLR' 64 1.250 2 Chi-square 'Calculated using all 12 FRET distances for the model relative to the restraint in FLR' 65 1.250 2 Chi-square 'Calculated using all 12 FRET distances for the model relative to the restraint in FLR' 66 1.250 2 Chi-square 'Calculated using all 12 FRET distances for the model relative to the restraint in FLR' 67 1.260 2 Chi-square 'Calculated using all 12 FRET distances for the model relative to the restraint in FLR' 68 1.260 2 Chi-square 'Calculated using all 12 FRET distances for the model relative to the restraint in FLR' 69 1.260 2 Chi-square 'Calculated using all 12 FRET distances for the model relative to the restraint in FLR' 70 1.260 2 Chi-square 'Calculated using all 12 FRET distances for the model relative to the restraint in FLR' 71 1.260 2 Chi-square 'Calculated using all 12 FRET distances for the model relative to the restraint in FLR' 72 1.260 2 Chi-square 'Calculated using all 12 FRET distances for the model relative to the restraint in FLR' 73 1.260 2 Chi-square 'Calculated using all 12 FRET distances for the model relative to the restraint in FLR' 74 1.270 2 Chi-square 'Calculated using all 12 FRET distances for the model relative to the restraint in FLR' 75 1.270 2 Chi-square 'Calculated using all 12 FRET distances for the model relative to the restraint in FLR' 76 1.280 2 Chi-square 'Calculated using all 12 FRET distances for the model relative to the restraint in FLR' 77 1.280 2 Chi-square 'Calculated using all 12 FRET distances for the model relative to the restraint in FLR' 78 1.280 2 Chi-square 'Calculated using all 12 FRET distances for the model relative to the restraint in FLR' 79 1.290 2 Chi-square 'Calculated using all 12 FRET distances for the model relative to the restraint in FLR' 80 1.290 2 Chi-square 'Calculated using all 12 FRET distances for the model relative to the restraint in FLR' 81 1.290 2 Chi-square 'Calculated using all 12 FRET distances for the model relative to the restraint in FLR' 82 1.290 2 Chi-square 'Calculated using all 12 FRET distances for the model relative to the restraint in FLR' 83 1.290 2 Chi-square 'Calculated using all 12 FRET distances for the model relative to the restraint in FLR' 84 1.290 2 Chi-square 'Calculated using all 12 FRET distances for the model relative to the restraint in FLR' 85 1.290 2 Chi-square 'Calculated using all 12 FRET distances for the model relative to the restraint in FLR' 86 1.300 2 Chi-square 'Calculated using all 12 FRET distances for the model relative to the restraint in FLR' 87 1.300 2 Chi-square 'Calculated using all 12 FRET distances for the model relative to the restraint in FLR' 88 1.300 2 Chi-square 'Calculated using all 12 FRET distances for the model relative to the restraint in FLR' 89 1.310 2 Chi-square 'Calculated using all 12 FRET distances for the model relative to the restraint in FLR' 90 1.310 2 Chi-square 'Calculated using all 12 FRET distances for the model relative to the restraint in FLR' 91 1.310 2 Chi-square 'Calculated using all 12 FRET distances for the model relative to the restraint in FLR' 92 1.310 2 Chi-square 'Calculated using all 12 FRET distances for the model relative to the restraint in FLR' 93 1.310 2 Chi-square 'Calculated using all 12 FRET distances for the model relative to the restraint in FLR' 94 1.320 2 Chi-square 'Calculated using all 12 FRET distances for the model relative to the restraint in FLR' 95 1.320 2 Chi-square 'Calculated using all 12 FRET distances for the model relative to the restraint in FLR' 96 1.320 2 Chi-square 'Calculated using all 12 FRET distances for the model relative to the restraint in FLR' 97 1.320 2 Chi-square 'Calculated using all 12 FRET distances for the model relative to the restraint in FLR' 98 1.320 2 Chi-square 'Calculated using all 12 FRET distances for the model relative to the restraint in FLR' 99 1.320 2 Chi-square 'Calculated using all 12 FRET distances for the model relative to the restraint in FLR' 100 1.330 2 Chi-square 'Calculated using all 12 FRET distances for the model relative to the restraint in FLR' 101 1.660 1 Chi-square 'Calculated using all 12 FRET distances for the model relative to the restraint in FLR' 102 1.700 1 Chi-square 'Calculated using all 12 FRET distances for the model relative to the restraint in FLR' 103 1.820 1 Chi-square 'Calculated using all 12 FRET distances for the model relative to the restraint in FLR' 104 1.840 1 Chi-square 'Calculated using all 12 FRET distances for the model relative to the restraint in FLR' 105 1.840 1 Chi-square 'Calculated using all 12 FRET distances for the model relative to the restraint in FLR' 106 1.870 1 Chi-square 'Calculated using all 12 FRET distances for the model relative to the restraint in FLR' 107 1.880 1 Chi-square 'Calculated using all 12 FRET distances for the model relative to the restraint in FLR' 108 1.890 1 Chi-square 'Calculated using all 12 FRET distances for the model relative to the restraint in FLR' 109 1.890 1 Chi-square 'Calculated using all 12 FRET distances for the model relative to the restraint in FLR' 110 1.890 1 Chi-square 'Calculated using all 12 FRET distances for the model relative to the restraint in FLR' 111 1.900 1 Chi-square 'Calculated using all 12 FRET distances for the model relative to the restraint in FLR' 112 1.910 1 Chi-square 'Calculated using all 12 FRET distances for the model relative to the restraint in FLR' 113 1.920 1 Chi-square 'Calculated using all 12 FRET distances for the model relative to the restraint in FLR' 114 1.930 1 Chi-square 'Calculated using all 12 FRET distances for the model relative to the restraint in FLR' 115 1.960 1 Chi-square 'Calculated using all 12 FRET distances for the model relative to the restraint in FLR' 116 1.980 1 Chi-square 'Calculated using all 12 FRET distances for the model relative to the restraint in FLR' 117 1.990 1 Chi-square 'Calculated using all 12 FRET distances for the model relative to the restraint in FLR' 118 1.990 1 Chi-square 'Calculated using all 12 FRET distances for the model relative to the restraint in FLR' 119 1.990 1 Chi-square 'Calculated using all 12 FRET distances for the model relative to the restraint in FLR' 120 2.000 1 Chi-square 'Calculated using all 12 FRET distances for the model relative to the restraint in FLR' 121 2.000 1 Chi-square 'Calculated using all 12 FRET distances for the model relative to the restraint in FLR' 122 2.010 1 Chi-square 'Calculated using all 12 FRET distances for the model relative to the restraint in FLR' 123 2.020 1 Chi-square 'Calculated using all 12 FRET distances for the model relative to the restraint in FLR' 124 2.020 1 Chi-square 'Calculated using all 12 FRET distances for the model relative to the restraint in FLR' 125 2.020 1 Chi-square 'Calculated using all 12 FRET distances for the model relative to the restraint in FLR' 126 2.020 1 Chi-square 'Calculated using all 12 FRET distances for the model relative to the restraint in FLR' 127 2.020 1 Chi-square 'Calculated using all 12 FRET distances for the model relative to the restraint in FLR' 128 2.030 1 Chi-square 'Calculated using all 12 FRET distances for the model relative to the restraint in FLR' 129 2.030 1 Chi-square 'Calculated using all 12 FRET distances for the model relative to the restraint in FLR' 130 2.030 1 Chi-square 'Calculated using all 12 FRET distances for the model relative to the restraint in FLR' 131 2.040 1 Chi-square 'Calculated using all 12 FRET distances for the model relative to the restraint in FLR' 132 2.050 1 Chi-square 'Calculated using all 12 FRET distances for the model relative to the restraint in FLR' 133 2.060 1 Chi-square 'Calculated using all 12 FRET distances for the model relative to the restraint in FLR' 134 2.070 1 Chi-square 'Calculated using all 12 FRET distances for the model relative to the restraint in FLR' 135 2.080 1 Chi-square 'Calculated using all 12 FRET distances for the model relative to the restraint in FLR' 136 2.080 1 Chi-square 'Calculated using all 12 FRET distances for the model relative to the restraint in FLR' 137 2.100 1 Chi-square 'Calculated using all 12 FRET distances for the model relative to the restraint in FLR' 138 2.120 1 Chi-square 'Calculated using all 12 FRET distances for the model relative to the restraint in FLR' 139 2.130 1 Chi-square 'Calculated using all 12 FRET distances for the model relative to the restraint in FLR' 140 2.140 1 Chi-square 'Calculated using all 12 FRET distances for the model relative to the restraint in FLR' 141 2.140 1 Chi-square 'Calculated using all 12 FRET distances for the model relative to the restraint in FLR' 142 2.150 1 Chi-square 'Calculated using all 12 FRET distances for the model relative to the restraint in FLR' 143 2.150 1 Chi-square 'Calculated using all 12 FRET distances for the model relative to the restraint in FLR' 144 2.150 1 Chi-square 'Calculated using all 12 FRET distances for the model relative to the restraint in FLR' 145 2.160 1 Chi-square 'Calculated using all 12 FRET distances for the model relative to the restraint in FLR' 146 2.170 1 Chi-square 'Calculated using all 12 FRET distances for the model relative to the restraint in FLR' 147 2.170 1 Chi-square 'Calculated using all 12 FRET distances for the model relative to the restraint in FLR' 148 2.170 1 Chi-square 'Calculated using all 12 FRET distances for the model relative to the restraint in FLR' 149 2.190 1 Chi-square 'Calculated using all 12 FRET distances for the model relative to the restraint in FLR' 150 2.190 1 Chi-square 'Calculated using all 12 FRET distances for the model relative to the restraint in FLR' 151 2.190 1 Chi-square 'Calculated using all 12 FRET distances for the model relative to the restraint in FLR' 152 2.200 1 Chi-square 'Calculated using all 12 FRET distances for the model relative to the restraint in FLR' 153 2.200 1 Chi-square 'Calculated using all 12 FRET distances for the model relative to the restraint in FLR' 154 2.200 1 Chi-square 'Calculated using all 12 FRET distances for the model relative to the restraint in FLR' 155 2.210 1 Chi-square 'Calculated using all 12 FRET distances for the model relative to the restraint in FLR' 156 2.210 1 Chi-square 'Calculated using all 12 FRET distances for the model relative to the restraint in FLR' 157 2.210 1 Chi-square 'Calculated using all 12 FRET distances for the model relative to the restraint in FLR' 158 2.210 1 Chi-square 'Calculated using all 12 FRET distances for the model relative to the restraint in FLR' 159 2.220 1 Chi-square 'Calculated using all 12 FRET distances for the model relative to the restraint in FLR' 160 2.220 1 Chi-square 'Calculated using all 12 FRET distances for the model relative to the restraint in FLR' 161 2.230 1 Chi-square 'Calculated using all 12 FRET distances for the model relative to the restraint in FLR' 162 2.230 1 Chi-square 'Calculated using all 12 FRET distances for the model relative to the restraint in FLR' 163 2.240 1 Chi-square 'Calculated using all 12 FRET distances for the model relative to the restraint in FLR' 164 2.250 1 Chi-square 'Calculated using all 12 FRET distances for the model relative to the restraint in FLR' 165 2.260 1 Chi-square 'Calculated using all 12 FRET distances for the model relative to the restraint in FLR' 166 2.260 1 Chi-square 'Calculated using all 12 FRET distances for the model relative to the restraint in FLR' 167 2.260 1 Chi-square 'Calculated using all 12 FRET distances for the model relative to the restraint in FLR' 168 2.270 1 Chi-square 'Calculated using all 12 FRET distances for the model relative to the restraint in FLR' 169 2.270 1 Chi-square 'Calculated using all 12 FRET distances for the model relative to the restraint in FLR' 170 2.280 1 Chi-square 'Calculated using all 12 FRET distances for the model relative to the restraint in FLR' 171 2.290 1 Chi-square 'Calculated using all 12 FRET distances for the model relative to the restraint in FLR' 172 2.290 1 Chi-square 'Calculated using all 12 FRET distances for the model relative to the restraint in FLR' 173 2.300 1 Chi-square 'Calculated using all 12 FRET distances for the model relative to the restraint in FLR' 174 2.300 1 Chi-square 'Calculated using all 12 FRET distances for the model relative to the restraint in FLR' 175 2.320 1 Chi-square 'Calculated using all 12 FRET distances for the model relative to the restraint in FLR' 176 2.320 1 Chi-square 'Calculated using all 12 FRET distances for the model relative to the restraint in FLR' 177 2.330 1 Chi-square 'Calculated using all 12 FRET distances for the model relative to the restraint in FLR' 178 2.330 1 Chi-square 'Calculated using all 12 FRET distances for the model relative to the restraint in FLR' 179 2.340 1 Chi-square 'Calculated using all 12 FRET distances for the model relative to the restraint in FLR' 180 2.350 1 Chi-square 'Calculated using all 12 FRET distances for the model relative to the restraint in FLR' 181 2.350 1 Chi-square 'Calculated using all 12 FRET distances for the model relative to the restraint in FLR' 182 2.370 1 Chi-square 'Calculated using all 12 FRET distances for the model relative to the restraint in FLR' 183 2.370 1 Chi-square 'Calculated using all 12 FRET distances for the model relative to the restraint in FLR' 184 2.380 1 Chi-square 'Calculated using all 12 FRET distances for the model relative to the restraint in FLR' 185 2.410 1 Chi-square 'Calculated using all 12 FRET distances for the model relative to the restraint in FLR' 186 2.420 1 Chi-square 'Calculated using all 12 FRET distances for the model relative to the restraint in FLR' 187 2.420 1 Chi-square 'Calculated using all 12 FRET distances for the model relative to the restraint in FLR' 188 2.450 1 Chi-square 'Calculated using all 12 FRET distances for the model relative to the restraint in FLR' 189 2.450 1 Chi-square 'Calculated using all 12 FRET distances for the model relative to the restraint in FLR' 190 2.460 1 Chi-square 'Calculated using all 12 FRET distances for the model relative to the restraint in FLR' 191 2.520 1 Chi-square 'Calculated using all 12 FRET distances for the model relative to the restraint in FLR' 192 2.530 1 Chi-square 'Calculated using all 12 FRET distances for the model relative to the restraint in FLR' 193 2.530 1 Chi-square 'Calculated using all 12 FRET distances for the model relative to the restraint in FLR' 194 2.530 1 Chi-square 'Calculated using all 12 FRET distances for the model relative to the restraint in FLR' 195 2.540 1 Chi-square 'Calculated using all 12 FRET distances for the model relative to the restraint in FLR' 196 2.600 1 Chi-square 'Calculated using all 12 FRET distances for the model relative to the restraint in FLR' 197 2.620 1 Chi-square 'Calculated using all 12 FRET distances for the model relative to the restraint in FLR' 198 2.630 1 Chi-square 'Calculated using all 12 FRET distances for the model relative to the restraint in FLR' 199 2.670 1 Chi-square 'Calculated using all 12 FRET distances for the model relative to the restraint in FLR' 200 2.770 1 Chi-square 'Calculated using all 12 FRET distances for the model relative to the restraint in FLR' # # loop_ _flr_fret_model_distance.id _flr_fret_model_distance.restraint_id _flr_fret_model_distance.model_id _flr_fret_model_distance.distance _flr_fret_model_distance.distance_deviation 1 1 1 70.400 6.900 2 2 1 68.160 17.640 3 3 1 38.100 37.300 4 4 1 30.180 6.720 5 5 1 84.550 -2.950 6 6 1 82.560 -14.460 7 7 1 72.860 -44.560 8 8 1 53.910 12.390 9 9 1 84.600 -20.300 10 10 1 46.550 -13.150 11 11 1 51.450 -12.650 12 12 1 63.150 2.750 13 1 2 60.460 16.840 14 2 2 61.980 23.820 15 3 2 33.930 41.470 16 4 2 20.450 16.450 17 5 2 89.920 -8.320 18 6 2 89.620 -21.520 19 7 2 78.650 -50.350 20 8 2 44.070 22.230 21 9 2 75.130 -10.830 22 10 2 44.780 -11.380 23 11 2 46.620 -7.820 24 12 2 66.130 -0.230 25 1 3 67.880 9.420 26 2 3 69.110 16.690 27 3 3 36.620 38.780 28 4 3 30.980 5.920 29 5 3 88.700 -7.100 30 6 3 86.390 -18.290 31 7 3 79.960 -51.660 32 8 3 49.790 16.510 33 9 3 90.700 -26.400 34 10 3 51.050 -17.650 35 11 3 45.810 -7.010 36 12 3 66.470 -0.570 37 1 4 55.850 21.450 38 2 4 73.300 12.500 39 3 4 41.960 33.440 40 4 4 29.710 7.190 41 5 4 89.280 -7.680 42 6 4 88.500 -20.400 43 7 4 87.040 -58.740 44 8 4 53.170 13.130 45 9 4 81.280 -16.980 46 10 4 49.780 -16.380 47 11 4 47.620 -8.820 48 12 4 63.630 2.270 49 1 5 58.830 18.470 50 2 5 76.370 9.430 51 3 5 34.130 41.270 52 4 5 33.610 3.290 53 5 5 89.250 -7.650 54 6 5 87.080 -18.980 55 7 5 76.510 -48.210 56 8 5 56.000 10.300 57 9 5 89.230 -24.930 58 10 5 49.330 -15.930 59 11 5 48.560 -9.760 60 12 5 64.160 1.740 61 1 6 72.000 5.300 62 2 6 67.200 18.600 63 3 6 34.850 40.550 64 4 6 34.310 2.590 65 5 6 87.230 -5.630 66 6 6 86.100 -18.000 67 7 6 79.990 -51.690 68 8 6 49.510 16.790 69 9 6 82.150 -17.850 70 10 6 46.020 -12.620 71 11 6 55.820 -17.020 72 12 6 66.570 -0.670 73 1 7 60.160 17.140 74 2 7 66.760 19.040 75 3 7 38.500 36.900 76 4 7 27.230 9.670 77 5 7 86.140 -4.540 78 6 7 84.910 -16.810 79 7 7 80.610 -52.310 80 8 7 46.410 19.890 81 9 7 80.170 -15.870 82 10 7 50.820 -17.420 83 11 7 49.170 -10.370 84 12 7 67.260 -1.360 85 1 8 74.530 2.770 86 2 8 66.160 19.640 87 3 8 44.300 31.100 88 4 8 37.350 -0.450 89 5 8 74.250 7.350 90 6 8 73.750 -5.650 91 7 8 82.080 -53.780 92 8 8 54.840 11.460 93 9 8 69.860 -5.560 94 10 8 49.550 -16.150 95 11 8 40.710 -1.910 96 12 8 66.940 -1.040 97 1 9 60.290 17.010 98 2 9 63.750 22.050 99 3 9 42.240 33.160 100 4 9 28.390 8.510 101 5 9 86.370 -4.770 102 6 9 85.620 -17.520 103 7 9 89.140 -60.840 104 8 9 51.370 14.930 105 9 9 73.270 -8.970 106 10 9 54.310 -20.910 107 11 9 44.290 -5.490 108 12 9 65.790 0.110 109 1 10 64.320 12.980 110 2 10 72.270 13.530 111 3 10 42.850 32.550 112 4 10 30.600 6.300 113 5 10 84.270 -2.670 114 6 10 82.610 -14.510 115 7 10 78.220 -49.920 116 8 10 54.570 11.730 117 9 10 81.120 -16.820 118 10 10 51.230 -17.830 119 11 10 54.710 -15.910 120 12 10 66.380 -0.480 121 1 11 63.650 13.650 122 2 11 63.010 22.790 123 3 11 45.020 30.380 124 4 11 27.220 9.680 125 5 11 87.420 -5.820 126 6 11 87.590 -19.490 127 7 11 80.680 -52.380 128 8 11 43.990 22.310 129 9 11 70.060 -5.760 130 10 11 41.190 -7.790 131 11 11 56.660 -17.860 132 12 11 65.430 0.470 133 1 12 61.670 15.630 134 2 12 64.820 20.980 135 3 12 47.140 28.260 136 4 12 24.890 12.010 137 5 12 93.080 -11.480 138 6 12 92.740 -24.640 139 7 12 80.610 -52.310 140 8 12 47.300 19.000 141 9 12 77.530 -13.230 142 10 12 42.240 -8.840 143 11 12 56.440 -17.640 144 12 12 63.000 2.900 145 1 13 61.400 15.900 146 2 13 70.700 15.100 147 3 13 34.190 41.210 148 4 13 31.720 5.180 149 5 13 91.220 -9.620 150 6 13 91.020 -22.920 151 7 13 63.260 -34.960 152 8 13 56.970 9.330 153 9 13 76.650 -12.350 154 10 13 48.200 -14.800 155 11 13 55.490 -16.690 156 12 13 64.480 1.420 157 1 14 58.930 18.370 158 2 14 66.830 18.970 159 3 14 39.670 35.730 160 4 14 24.420 12.480 161 5 14 91.760 -10.160 162 6 14 91.280 -23.180 163 7 14 86.460 -58.160 164 8 14 48.280 18.020 165 9 14 81.020 -16.720 166 10 14 54.580 -21.180 167 11 14 43.170 -4.370 168 12 14 65.830 0.070 169 1 15 62.670 14.630 170 2 15 64.330 21.470 171 3 15 43.100 32.300 172 4 15 28.260 8.640 173 5 15 91.640 -10.040 174 6 15 90.550 -22.450 175 7 15 85.460 -57.160 176 8 15 44.340 21.960 177 9 15 85.600 -21.300 178 10 15 48.130 -14.730 179 11 15 53.240 -14.440 180 12 15 66.720 -0.820 181 1 16 51.100 26.200 182 2 16 65.900 19.900 183 3 16 39.770 35.630 184 4 16 32.610 4.290 185 5 16 92.030 -10.430 186 6 16 91.700 -23.600 187 7 16 79.740 -51.440 188 8 16 49.660 16.640 189 9 16 77.880 -13.580 190 10 16 53.310 -19.910 191 11 16 38.640 0.160 192 12 16 65.360 0.540 193 1 17 64.140 13.160 194 2 17 76.470 9.330 195 3 17 39.070 36.330 196 4 17 28.430 8.470 197 5 17 92.080 -10.480 198 6 17 91.440 -23.340 199 7 17 63.690 -35.390 200 8 17 62.230 4.070 201 9 17 78.520 -14.220 202 10 17 51.070 -17.670 203 11 17 53.290 -14.490 204 12 17 65.920 -0.020 205 1 18 62.470 14.830 206 2 18 65.200 20.600 207 3 18 48.240 27.160 208 4 18 23.660 13.240 209 5 18 87.750 -6.150 210 6 18 87.690 -19.590 211 7 18 93.480 -65.180 212 8 18 50.320 15.980 213 9 18 72.290 -7.990 214 10 18 48.650 -15.250 215 11 18 52.420 -13.620 216 12 18 66.720 -0.820 217 1 19 62.980 14.320 218 2 19 60.850 24.950 219 3 19 36.050 39.350 220 4 19 30.360 6.540 221 5 19 93.430 -11.830 222 6 19 92.330 -24.230 223 7 19 86.370 -58.070 224 8 19 40.220 26.080 225 9 19 86.560 -22.260 226 10 19 48.420 -15.020 227 11 19 49.200 -10.400 228 12 19 66.930 -1.030 229 1 20 59.870 17.430 230 2 20 76.860 8.940 231 3 20 41.710 33.690 232 4 20 35.160 1.740 233 5 20 81.360 0.240 234 6 20 81.630 -13.530 235 7 20 80.970 -52.670 236 8 20 62.420 3.880 237 9 20 64.960 -0.660 238 10 20 53.510 -20.110 239 11 20 48.110 -9.310 240 12 20 65.920 -0.020 241 1 21 72.860 4.440 242 2 21 68.280 17.520 243 3 21 44.960 30.440 244 4 21 35.910 0.990 245 5 21 76.980 4.620 246 6 21 74.590 -6.490 247 7 21 74.640 -46.340 248 8 21 51.360 14.940 249 9 21 78.930 -14.630 250 10 21 47.080 -13.680 251 11 21 55.480 -16.680 252 12 21 65.000 0.900 253 1 22 52.670 24.630 254 2 22 70.180 15.620 255 3 22 36.890 38.510 256 4 22 29.790 7.110 257 5 22 87.790 -6.190 258 6 22 86.170 -18.070 259 7 22 72.790 -44.490 260 8 22 54.740 11.560 261 9 22 86.090 -21.790 262 10 22 52.900 -19.500 263 11 22 51.280 -12.480 264 12 22 65.790 0.110 265 1 23 65.860 11.440 266 2 23 66.440 19.360 267 3 23 45.600 29.800 268 4 23 21.580 15.320 269 5 23 87.010 -5.410 270 6 23 85.790 -17.690 271 7 23 88.950 -60.650 272 8 23 48.490 17.810 273 9 23 76.390 -12.090 274 10 23 53.690 -20.290 275 11 23 47.360 -8.560 276 12 23 66.350 -0.450 277 1 24 59.950 17.350 278 2 24 70.960 14.840 279 3 24 36.030 39.370 280 4 24 30.180 6.720 281 5 24 90.720 -9.120 282 6 24 89.070 -20.970 283 7 24 62.410 -34.110 284 8 24 54.620 11.680 285 9 24 86.530 -22.230 286 10 24 54.360 -20.960 287 11 24 43.820 -5.020 288 12 24 65.720 0.180 289 1 25 64.160 13.140 290 2 25 66.280 19.520 291 3 25 42.960 32.440 292 4 25 19.780 17.120 293 5 25 89.520 -7.920 294 6 25 87.950 -19.850 295 7 25 92.280 -63.980 296 8 25 50.270 16.030 297 9 25 80.610 -16.310 298 10 25 41.220 -7.820 299 11 25 60.520 -21.720 300 12 25 67.040 -1.140 301 1 26 54.580 22.720 302 2 26 75.210 10.590 303 3 26 43.200 32.200 304 4 26 31.110 5.790 305 5 26 85.750 -4.150 306 6 26 85.110 -17.010 307 7 26 86.630 -58.330 308 8 26 55.430 10.870 309 9 26 77.920 -13.620 310 10 26 51.040 -17.640 311 11 26 54.510 -15.710 312 12 26 64.690 1.210 313 1 27 51.610 25.690 314 2 27 68.410 17.390 315 3 27 36.200 39.200 316 4 27 29.790 7.110 317 5 27 85.690 -4.090 318 6 27 82.370 -14.270 319 7 27 83.880 -55.580 320 8 27 54.770 11.530 321 9 27 100.180 -35.880 322 10 27 49.070 -15.670 323 11 27 50.460 -11.660 324 12 27 64.580 1.320 325 1 28 44.170 33.130 326 2 28 73.270 12.530 327 3 28 38.080 37.320 328 4 28 33.510 3.390 329 5 28 87.980 -6.380 330 6 28 85.270 -17.170 331 7 28 77.820 -49.520 332 8 28 57.840 8.460 333 9 28 96.820 -32.520 334 10 28 48.340 -14.940 335 11 28 44.320 -5.520 336 12 28 66.540 -0.640 337 1 29 63.080 14.220 338 2 29 67.040 18.760 339 3 29 44.740 30.660 340 4 29 30.910 5.990 341 5 29 84.340 -2.740 342 6 29 83.170 -15.070 343 7 29 77.780 -49.480 344 8 29 52.200 14.100 345 9 29 74.890 -10.590 346 10 29 53.110 -19.710 347 11 29 54.420 -15.620 348 12 29 67.550 -1.650 349 1 30 63.070 14.230 350 2 30 72.220 13.580 351 3 30 40.580 34.820 352 4 30 28.180 8.720 353 5 30 77.380 4.220 354 6 30 76.720 -8.620 355 7 30 85.300 -57.000 356 8 30 51.240 15.060 357 9 30 72.360 -8.060 358 10 30 54.080 -20.680 359 11 30 50.860 -12.060 360 12 30 66.710 -0.810 361 1 31 61.510 15.790 362 2 31 62.030 23.770 363 3 31 45.970 29.430 364 4 31 26.020 10.880 365 5 31 82.290 -0.690 366 6 31 82.380 -14.280 367 7 31 79.010 -50.710 368 8 31 46.270 20.030 369 9 31 69.520 -5.220 370 10 31 50.190 -16.790 371 11 31 52.390 -13.590 372 12 31 66.760 -0.860 373 1 32 58.580 18.720 374 2 32 67.660 18.140 375 3 32 35.760 39.640 376 4 32 22.070 14.830 377 5 32 91.680 -10.080 378 6 32 91.500 -23.400 379 7 32 82.140 -53.840 380 8 32 49.070 17.230 381 9 32 77.660 -13.360 382 10 32 47.460 -14.060 383 11 32 58.370 -19.570 384 12 32 65.560 0.340 385 1 33 47.940 29.360 386 2 33 70.780 15.020 387 3 33 34.370 41.030 388 4 33 35.450 1.450 389 5 33 86.230 -4.630 390 6 33 82.460 -14.360 391 7 33 82.020 -53.720 392 8 33 57.430 8.870 393 9 33 101.660 -37.360 394 10 33 45.710 -12.310 395 11 33 48.810 -10.010 396 12 33 64.290 1.610 397 1 34 53.260 24.040 398 2 34 65.800 20.000 399 3 34 30.610 44.790 400 4 34 27.540 9.360 401 5 34 89.330 -7.730 402 6 34 87.330 -19.230 403 7 34 68.840 -40.540 404 8 34 50.720 15.580 405 9 34 90.090 -25.790 406 10 34 51.650 -18.250 407 11 34 47.980 -9.180 408 12 34 65.920 -0.020 409 1 35 59.510 17.790 410 2 35 69.340 16.460 411 3 35 46.010 29.390 412 4 35 19.930 16.970 413 5 35 85.230 -3.630 414 6 35 84.440 -16.340 415 7 35 95.930 -67.630 416 8 35 54.550 11.750 417 9 35 77.320 -13.020 418 10 35 52.160 -18.760 419 11 35 49.080 -10.280 420 12 35 64.390 1.510 421 1 36 52.700 24.600 422 2 36 79.000 6.800 423 3 36 37.740 37.660 424 4 36 34.280 2.620 425 5 36 96.240 -14.640 426 6 36 94.900 -26.800 427 7 36 62.850 -34.550 428 8 36 60.060 6.240 429 9 36 87.540 -23.240 430 10 36 47.580 -14.180 431 11 36 48.040 -9.240 432 12 36 65.730 0.170 433 1 37 74.150 3.150 434 2 37 66.330 19.470 435 3 37 41.500 33.900 436 4 37 32.130 4.770 437 5 37 68.120 13.480 438 6 37 64.360 3.740 439 7 37 93.000 -64.700 440 8 37 51.030 15.270 441 9 37 89.710 -25.410 442 10 37 47.080 -13.680 443 11 37 46.490 -7.690 444 12 37 67.380 -1.480 445 1 38 73.490 3.810 446 2 38 66.420 19.380 447 3 38 41.700 33.700 448 4 38 32.870 4.030 449 5 38 69.910 11.690 450 6 38 68.720 -0.620 451 7 38 78.000 -49.700 452 8 38 55.160 11.140 453 9 38 63.690 0.610 454 10 38 45.870 -12.470 455 11 38 55.120 -16.320 456 12 38 67.380 -1.480 457 1 39 53.370 23.930 458 2 39 75.680 10.120 459 3 39 41.760 33.640 460 4 39 28.520 8.380 461 5 39 93.820 -12.220 462 6 39 92.730 -24.630 463 7 39 66.810 -38.510 464 8 39 56.680 9.620 465 9 39 81.340 -17.040 466 10 39 52.180 -18.780 467 11 39 49.730 -10.930 468 12 39 66.050 -0.150 469 1 40 52.240 25.060 470 2 40 71.020 14.780 471 3 40 47.300 28.100 472 4 40 28.380 8.520 473 5 40 87.880 -6.280 474 6 40 85.950 -17.850 475 7 40 79.720 -51.420 476 8 40 58.170 8.130 477 9 40 87.410 -23.110 478 10 40 53.120 -19.720 479 11 40 50.810 -12.010 480 12 40 65.440 0.460 481 1 41 43.990 33.310 482 2 41 72.410 13.390 483 3 41 37.810 37.590 484 4 41 34.360 2.540 485 5 41 87.730 -6.130 486 6 41 84.860 -16.760 487 7 41 75.780 -47.480 488 8 41 56.820 9.480 489 9 41 95.360 -31.060 490 10 41 49.130 -15.730 491 11 41 45.620 -6.820 492 12 41 67.430 -1.530 493 1 42 64.500 12.800 494 2 42 64.620 21.180 495 3 42 33.590 41.810 496 4 42 27.770 9.130 497 5 42 80.630 0.970 498 6 42 79.590 -11.490 499 7 42 79.860 -51.560 500 8 42 43.480 22.820 501 9 42 70.350 -6.050 502 10 42 48.970 -15.570 503 11 42 56.430 -17.630 504 12 42 66.750 -0.850 505 1 43 61.530 15.770 506 2 43 60.990 24.810 507 3 43 44.470 30.930 508 4 43 30.090 6.810 509 5 43 83.670 -2.070 510 6 43 82.570 -14.470 511 7 43 83.440 -55.140 512 8 43 44.550 21.750 513 9 43 81.120 -16.820 514 10 43 50.000 -16.600 515 11 43 54.970 -16.170 516 12 43 66.450 -0.550 517 1 44 60.670 16.630 518 2 44 69.580 16.220 519 3 44 44.270 31.130 520 4 44 29.650 7.250 521 5 44 77.570 4.030 522 6 44 77.360 -9.260 523 7 44 86.070 -57.770 524 8 44 56.650 9.650 525 9 44 67.330 -3.030 526 10 44 50.850 -17.450 527 11 44 56.750 -17.950 528 12 44 65.980 -0.080 529 1 45 56.510 20.790 530 2 45 65.220 20.580 531 3 45 45.890 29.510 532 4 45 29.910 6.990 533 5 45 96.890 -15.290 534 6 45 96.330 -28.230 535 7 45 68.150 -39.850 536 8 45 43.380 22.920 537 9 45 86.800 -22.500 538 10 45 45.660 -12.260 539 11 45 48.910 -10.110 540 12 45 63.940 1.960 541 1 46 61.200 16.100 542 2 46 69.450 16.350 543 3 46 43.910 31.490 544 4 46 23.360 13.540 545 5 46 87.020 -5.420 546 6 46 87.450 -19.350 547 7 46 82.670 -54.370 548 8 46 50.850 15.450 549 9 46 66.830 -2.530 550 10 46 49.000 -15.600 551 11 46 58.050 -19.250 552 12 46 66.430 -0.530 553 1 47 56.380 20.920 554 2 47 66.630 19.170 555 3 47 48.350 27.050 556 4 47 28.480 8.420 557 5 47 88.110 -6.510 558 6 47 87.420 -19.320 559 7 47 87.340 -59.040 560 8 47 48.500 17.800 561 9 47 76.500 -12.200 562 10 47 54.540 -21.140 563 11 47 45.670 -6.870 564 12 47 64.740 1.160 565 1 48 60.410 16.890 566 2 48 74.310 11.490 567 3 48 30.550 44.850 568 4 48 27.980 8.920 569 5 48 99.860 -18.260 570 6 48 99.100 -31.000 571 7 48 66.360 -38.060 572 8 48 56.630 9.670 573 9 48 85.180 -20.880 574 10 48 45.850 -12.450 575 11 48 56.600 -17.800 576 12 48 64.340 1.560 577 1 49 49.380 27.920 578 2 49 66.080 19.720 579 3 49 50.540 24.860 580 4 49 30.160 6.740 581 5 49 85.800 -4.200 582 6 49 84.960 -16.860 583 7 49 80.550 -52.250 584 8 49 52.100 14.200 585 9 49 82.980 -18.680 586 10 49 49.950 -16.550 587 11 49 50.290 -11.490 588 12 49 65.900 0 589 1 50 59.090 18.210 590 2 50 70.170 15.630 591 3 50 40.170 35.230 592 4 50 22.430 14.470 593 5 50 76.750 4.850 594 6 50 76.750 -8.650 595 7 50 85.570 -57.270 596 8 50 57.340 8.960 597 9 50 63.280 1.020 598 10 50 51.600 -18.200 599 11 50 54.250 -15.450 600 12 50 65.210 0.690 601 1 51 49.460 27.840 602 2 51 72.050 13.750 603 3 51 36.020 39.380 604 4 51 33.910 2.990 605 5 51 89.110 -7.510 606 6 51 87.680 -19.580 607 7 51 64.720 -36.420 608 8 51 56.680 9.620 609 9 51 82.220 -17.920 610 10 51 50.830 -17.430 611 11 51 51.860 -13.060 612 12 51 67.340 -1.440 613 1 52 58.670 18.630 614 2 52 75.950 9.850 615 3 52 39.910 35.490 616 4 52 39.560 -2.660 617 5 52 77.440 4.160 618 6 52 77.520 -9.420 619 7 52 78.130 -49.830 620 8 52 66.110 0.190 621 9 52 63.700 0.600 622 10 52 52.030 -18.630 623 11 52 48.520 -9.720 624 12 52 62.840 3.060 625 1 53 66.900 10.400 626 2 53 66.330 19.470 627 3 53 39.140 36.260 628 4 53 22.610 14.290 629 5 53 88.180 -6.580 630 6 53 87.540 -19.440 631 7 53 79.160 -50.860 632 8 53 53.030 13.270 633 9 53 77.270 -12.970 634 10 53 57.640 -24.240 635 11 53 51.070 -12.270 636 12 53 66.170 -0.270 637 1 54 46.120 31.180 638 2 54 66.040 19.760 639 3 54 47.290 28.110 640 4 54 28.080 8.820 641 5 54 81.970 -0.370 642 6 54 82.070 -13.970 643 7 54 76.740 -48.440 644 8 54 47.110 19.190 645 9 54 66.680 -2.380 646 10 54 44.480 -11.080 647 11 54 51.770 -12.970 648 12 54 66.390 -0.490 649 1 55 60.400 16.900 650 2 55 63.040 22.760 651 3 55 44.030 31.370 652 4 55 23.610 13.290 653 5 55 93.930 -12.330 654 6 55 93.750 -25.650 655 7 55 84.940 -56.640 656 8 55 44.570 21.730 657 9 55 78.670 -14.370 658 10 55 48.670 -15.270 659 11 55 55.290 -16.490 660 12 55 66.650 -0.750 661 1 56 57.680 19.620 662 2 56 68.550 17.250 663 3 56 45.740 29.660 664 4 56 29.470 7.430 665 5 56 87.290 -5.690 666 6 56 86.490 -18.390 667 7 56 86.080 -57.780 668 8 56 50.330 15.970 669 9 56 76.650 -12.350 670 10 56 56.210 -22.810 671 11 56 48.390 -9.590 672 12 56 65.650 0.250 673 1 57 67.640 9.660 674 2 57 61.640 24.160 675 3 57 39.040 36.360 676 4 57 23.450 13.450 677 5 57 83.830 -2.230 678 6 57 83.260 -15.160 679 7 57 77.820 -49.520 680 8 57 45.240 21.060 681 9 57 74.630 -10.330 682 10 57 55.680 -22.280 683 11 57 49.220 -10.420 684 12 57 67.170 -1.270 685 1 58 53.580 23.720 686 2 58 63.840 21.960 687 3 58 32.370 43.030 688 4 58 25.880 11.020 689 5 58 88.440 -6.840 690 6 58 86.350 -18.250 691 7 58 68.700 -40.400 692 8 58 48.520 17.780 693 9 58 90.150 -25.850 694 10 58 52.140 -18.740 695 11 58 49.420 -10.620 696 12 58 67.170 -1.270 697 1 59 79.660 -2.360 698 2 59 62.130 23.670 699 3 59 44.640 30.760 700 4 59 31.950 4.950 701 5 59 76.510 5.090 702 6 59 73.900 -5.800 703 7 59 88.470 -60.170 704 8 59 48.410 17.890 705 9 59 87.470 -23.170 706 10 59 48.660 -15.260 707 11 59 53.610 -14.810 708 12 59 66.220 -0.320 709 1 60 68.220 9.080 710 2 60 64.820 20.980 711 3 60 47.000 28.400 712 4 60 26.680 10.220 713 5 60 80.530 1.070 714 6 60 81.090 -12.990 715 7 60 84.560 -56.260 716 8 60 49.410 16.890 717 9 60 63.370 0.930 718 10 60 46.830 -13.430 719 11 60 58.230 -19.430 720 12 60 65.220 0.680 721 1 61 52.880 24.420 722 2 61 72.610 13.190 723 3 61 38.640 36.760 724 4 61 29.100 7.800 725 5 61 89.180 -7.580 726 6 61 87.830 -19.730 727 7 61 75.430 -47.130 728 8 61 57.480 8.820 729 9 61 85.620 -21.320 730 10 61 56.700 -23.300 731 11 61 49.110 -10.310 732 12 61 67.510 -1.610 733 1 62 74.710 2.590 734 2 62 63.480 22.320 735 3 62 43.490 31.910 736 4 62 30.350 6.550 737 5 62 68.830 12.770 738 6 62 65.140 2.960 739 7 62 88.800 -60.500 740 8 62 46.040 20.260 741 9 62 87.950 -23.650 742 10 62 45.210 -11.810 743 11 62 51.070 -12.270 744 12 62 65.790 0.110 745 1 63 58.970 18.330 746 2 63 69.370 16.430 747 3 63 41.560 33.840 748 4 63 24.450 12.450 749 5 63 84.240 -2.640 750 6 63 84.170 -16.070 751 7 63 84.020 -55.720 752 8 63 50.890 15.410 753 9 63 69.440 -5.140 754 10 63 54.920 -21.520 755 11 63 52.140 -13.340 756 12 63 60.380 5.520 757 1 64 51.670 25.630 758 2 64 68.420 17.380 759 3 64 51.490 23.910 760 4 64 29.970 6.930 761 5 64 84.910 -3.310 762 6 64 85.250 -17.150 763 7 64 82.290 -53.990 764 8 64 50.850 15.450 765 9 64 65.330 -1.030 766 10 64 48.610 -15.210 767 11 64 50.620 -11.820 768 12 64 66.390 -0.490 769 1 65 53.990 23.310 770 2 65 65.960 19.840 771 3 65 42.380 33.020 772 4 65 33.740 3.160 773 5 65 84.030 -2.430 774 6 65 80.940 -12.840 775 7 65 84.540 -56.240 776 8 65 54.150 12.150 777 9 65 99.130 -34.830 778 10 65 52.680 -19.280 779 11 65 47.490 -8.690 780 12 65 67.550 -1.650 781 1 66 80.220 -2.920 782 2 66 64.760 21.040 783 3 66 49.910 25.490 784 4 66 21.350 15.550 785 5 66 77.200 4.400 786 6 66 75.990 -7.890 787 7 66 88.140 -59.840 788 8 66 49.730 16.570 789 9 66 74.420 -10.120 790 10 66 48.670 -15.270 791 11 66 51.330 -12.530 792 12 66 63.940 1.960 793 1 67 57.060 20.240 794 2 67 65.760 20.040 795 3 67 43.630 31.770 796 4 67 32.480 4.420 797 5 67 84.260 -2.660 798 6 67 84.140 -16.040 799 7 67 82.890 -54.590 800 8 67 45.490 20.810 801 9 67 68.520 -4.220 802 10 67 48.950 -15.550 803 11 67 56.230 -17.430 804 12 67 67.430 -1.530 805 1 68 74.510 2.790 806 2 68 62.420 23.380 807 3 68 33.730 41.670 808 4 68 15.400 21.500 809 5 68 84.620 -3.020 810 6 68 83.540 -15.440 811 7 68 78.430 -50.130 812 8 68 48.340 17.960 813 9 68 77.160 -12.860 814 10 68 53.950 -20.550 815 11 68 47.240 -8.440 816 12 68 65.890 0.010 817 1 69 59.540 17.760 818 2 69 60.000 25.800 819 3 69 34.770 40.630 820 4 69 32.250 4.650 821 5 69 81.750 -0.150 822 6 69 81.320 -13.220 823 7 69 81.940 -53.640 824 8 69 42.850 23.450 825 9 69 76.520 -12.220 826 10 69 47.300 -13.900 827 11 69 58.160 -19.360 828 12 69 67.220 -1.320 829 1 70 77.100 0.200 830 2 70 64.280 21.520 831 3 70 47.580 27.820 832 4 70 39.070 -2.170 833 5 70 75.200 6.400 834 6 70 73.990 -5.890 835 7 70 81.030 -52.730 836 8 70 54.480 11.820 837 9 70 70.530 -6.230 838 10 70 50.990 -17.590 839 11 70 49.280 -10.480 840 12 70 65.470 0.430 841 1 71 61.640 15.660 842 2 71 63.330 22.470 843 3 71 48.120 27.280 844 4 71 37.560 -0.660 845 5 71 80.860 0.740 846 6 71 80.940 -12.840 847 7 71 88.860 -60.560 848 8 71 52.680 13.620 849 9 71 64.100 0.200 850 10 71 48.850 -15.450 851 11 71 53.280 -14.480 852 12 71 66.560 -0.660 853 1 72 59.440 17.860 854 2 72 60.950 24.850 855 3 72 28.800 46.600 856 4 72 25.980 10.920 857 5 72 90.460 -8.860 858 6 72 87.910 -19.810 859 7 72 70.800 -42.500 860 8 72 47.370 18.930 861 9 72 92.090 -27.790 862 10 72 51.150 -17.750 863 11 72 51.660 -12.860 864 12 72 66.480 -0.580 865 1 73 42.460 34.840 866 2 73 65.300 20.500 867 3 73 40.080 35.320 868 4 73 26.030 10.870 869 5 73 91.380 -9.780 870 6 73 89.730 -21.630 871 7 73 72.900 -44.600 872 8 73 44.790 21.510 873 9 73 89.690 -25.390 874 10 73 46.040 -12.640 875 11 73 47.100 -8.300 876 12 73 64.800 1.100 877 1 74 60.810 16.490 878 2 74 71.980 13.820 879 3 74 50.660 24.740 880 4 74 37.270 -0.370 881 5 74 82.020 -0.420 882 6 74 82.840 -14.740 883 7 74 80.670 -52.370 884 8 74 56.340 9.960 885 9 74 63.410 0.890 886 10 74 52.010 -18.610 887 11 74 47.400 -8.600 888 12 74 66.930 -1.030 889 1 75 53.190 24.110 890 2 75 66.350 19.450 891 3 75 46.500 28.900 892 4 75 33.920 2.980 893 5 75 97.730 -16.130 894 6 75 97.380 -29.280 895 7 75 80.570 -52.270 896 8 75 48.600 17.700 897 9 75 82.140 -17.840 898 10 75 52.260 -18.860 899 11 75 32.450 6.350 900 12 75 66.900 -1.000 901 1 76 61.400 15.900 902 2 76 76.380 9.420 903 3 76 34.480 40.920 904 4 76 33.370 3.530 905 5 76 90.810 -9.210 906 6 76 90.290 -22.190 907 7 76 60.870 -32.570 908 8 76 62.620 3.680 909 9 76 76.820 -12.520 910 10 76 48.720 -15.320 911 11 76 58.330 -19.530 912 12 76 65.310 0.590 913 1 77 56.550 20.750 914 2 77 63.170 22.630 915 3 77 29.940 45.460 916 4 77 40.510 -3.610 917 5 77 90.810 -9.210 918 6 77 87.860 -19.760 919 7 77 72.980 -44.680 920 8 77 56.170 10.130 921 9 77 97.680 -33.380 922 10 77 46.850 -13.450 923 11 77 52.830 -14.030 924 12 77 67.420 -1.520 925 1 78 47.400 29.900 926 2 78 72.840 12.960 927 3 78 45.100 30.300 928 4 78 37.440 -0.540 929 5 78 90.610 -9.010 930 6 78 90.240 -22.140 931 7 78 75.640 -47.340 932 8 78 52.020 14.280 933 9 78 77.590 -13.290 934 10 78 47.880 -14.480 935 11 78 52.530 -13.730 936 12 78 64.360 1.540 937 1 79 49.270 28.030 938 2 79 64.120 21.680 939 3 79 41.270 34.130 940 4 79 29.430 7.470 941 5 79 93.290 -11.690 942 6 79 91.480 -23.380 943 7 79 76.900 -48.600 944 8 79 44.280 22.020 945 9 79 90.850 -26.550 946 10 79 51.210 -17.810 947 11 79 46.250 -7.450 948 12 79 66.750 -0.850 949 1 80 55.420 21.880 950 2 80 65.750 20.050 951 3 80 39.440 35.960 952 4 80 34.490 2.410 953 5 80 84.080 -2.480 954 6 80 82.230 -14.130 955 7 80 74.240 -45.940 956 8 80 50.260 16.040 957 9 80 85.070 -20.770 958 10 80 51.620 -18.220 959 11 80 56.420 -17.620 960 12 80 64.400 1.500 961 1 81 77.050 0.250 962 2 81 61.160 24.640 963 3 81 45.010 30.390 964 4 81 26.860 10.040 965 5 81 70.860 10.740 966 6 81 67.140 0.960 967 7 81 88.820 -60.520 968 8 81 43.380 22.920 969 9 81 86.540 -22.240 970 10 81 45.960 -12.560 971 11 81 50.310 -11.510 972 12 81 66.830 -0.930 973 1 82 45.950 31.350 974 2 82 76.260 9.540 975 3 82 42.520 32.880 976 4 82 27.890 9.010 977 5 82 88.950 -7.350 978 6 82 87.550 -19.450 979 7 82 63.730 -35.430 980 8 82 63.030 3.270 981 9 82 85.030 -20.730 982 10 82 50.590 -17.190 983 11 82 49.970 -11.170 984 12 82 67.540 -1.640 985 1 83 52.720 24.580 986 2 83 68.750 17.050 987 3 83 38.970 36.430 988 4 83 29.240 7.660 989 5 83 86.330 -4.730 990 6 83 84.630 -16.530 991 7 83 73.740 -45.440 992 8 83 52.310 13.990 993 9 83 85.010 -20.710 994 10 83 50.890 -17.490 995 11 83 58.420 -19.620 996 12 83 66.070 -0.170 997 1 84 71.080 6.220 998 2 84 66.140 19.660 999 3 84 40.220 35.180 1000 4 84 26.740 10.160 1001 5 84 86.530 -4.930 1002 6 84 86.500 -18.400 1003 7 84 82.980 -54.680 1004 8 84 47.620 18.680 1005 9 84 73.390 -9.090 1006 10 84 55.880 -22.480 1007 11 84 53.960 -15.160 1008 12 84 65.050 0.850 1009 1 85 71.150 6.150 1010 2 85 67.410 18.390 1011 3 85 33.500 41.900 1012 4 85 38.650 -1.750 1013 5 85 83.540 -1.940 1014 6 85 82.000 -13.900 1015 7 85 79.620 -51.320 1016 8 85 48.730 17.570 1017 9 85 77.920 -13.620 1018 10 85 51.740 -18.340 1019 11 85 56.670 -17.870 1020 12 85 66.040 -0.140 1021 1 86 59.810 17.490 1022 2 86 64.860 20.940 1023 3 86 38.530 36.870 1024 4 86 18.310 18.590 1025 5 86 91.650 -10.050 1026 6 86 88.710 -20.610 1027 7 86 86.560 -58.260 1028 8 86 47.630 18.670 1029 9 86 97.790 -33.490 1030 10 86 48.300 -14.900 1031 11 86 53.160 -14.360 1032 12 86 67.100 -1.200 1033 1 87 65.490 11.810 1034 2 87 74.140 11.660 1035 3 87 37.490 37.910 1036 4 87 30.190 6.710 1037 5 87 84.920 -3.320 1038 6 87 82.590 -14.490 1039 7 87 78.740 -50.440 1040 8 87 53.570 12.730 1041 9 87 84.690 -20.390 1042 10 87 46.780 -13.380 1043 11 87 64.890 -26.090 1044 12 87 64.760 1.140 1045 1 88 68.890 8.410 1046 2 88 73.170 12.630 1047 3 88 45.610 29.790 1048 4 88 38.400 -1.500 1049 5 88 73.600 8.000 1050 6 88 70.850 -2.750 1051 7 88 66.220 -37.920 1052 8 88 56.480 9.820 1053 9 88 83.710 -19.410 1054 10 88 48.360 -14.960 1055 11 88 52.920 -14.120 1056 12 88 64.230 1.670 1057 1 89 54.300 23.000 1058 2 89 69.870 15.930 1059 3 89 53.980 21.420 1060 4 89 33.600 3.300 1061 5 89 80.320 1.280 1062 6 89 80.640 -12.540 1063 7 89 83.970 -55.670 1064 8 89 51.340 14.960 1065 9 89 63.150 1.150 1066 10 89 45.650 -12.250 1067 11 89 51.310 -12.510 1068 12 89 65.920 -0.020 1069 1 90 58.560 18.740 1070 2 90 69.180 16.620 1071 3 90 54.440 20.960 1072 4 90 30.740 6.160 1073 5 90 84.160 -2.560 1074 6 90 83.250 -15.150 1075 7 90 91.740 -63.440 1076 8 90 51.120 15.180 1077 9 90 74.120 -9.820 1078 10 90 53.250 -19.850 1079 11 90 44.280 -5.480 1080 12 90 65.780 0.120 1081 1 91 56.190 21.110 1082 2 91 67.560 18.240 1083 3 91 40.540 34.860 1084 4 91 25.360 11.540 1085 5 91 90.200 -8.600 1086 6 91 88.420 -20.320 1087 7 91 76.690 -48.390 1088 8 91 50.670 15.630 1089 9 91 89.570 -25.270 1090 10 91 55.730 -22.330 1091 11 91 51.390 -12.590 1092 12 91 66.890 -0.990 1093 1 92 61.390 15.910 1094 2 92 83.020 2.780 1095 3 92 31.750 43.650 1096 4 92 35.070 1.830 1097 5 92 84.770 -3.170 1098 6 92 84.430 -16.330 1099 7 92 62.520 -34.220 1100 8 92 64.770 1.530 1101 9 92 69.940 -5.640 1102 10 92 46.960 -13.560 1103 11 92 57.250 -18.450 1104 12 92 65.330 0.570 1105 1 93 52.730 24.570 1106 2 93 68.380 17.420 1107 3 93 31.460 43.940 1108 4 93 41.510 -4.610 1109 5 93 86.000 -4.400 1110 6 93 82.390 -14.290 1111 7 93 78.370 -50.070 1112 8 93 58.310 7.990 1113 9 93 99.580 -35.280 1114 10 93 50.650 -17.250 1115 11 93 45.280 -6.480 1116 12 93 65.610 0.290 1117 1 94 45.900 31.400 1118 2 94 72.940 12.860 1119 3 94 41.100 34.300 1120 4 94 34.150 2.750 1121 5 94 89.330 -7.730 1122 6 94 88.110 -20.010 1123 7 94 65.410 -37.110 1124 8 94 54.320 11.980 1125 9 94 82.960 -18.660 1126 10 94 48.390 -14.990 1127 11 94 53.260 -14.460 1128 12 94 66.830 -0.930 1129 1 95 63.860 13.440 1130 2 95 65.350 20.450 1131 3 95 50.270 25.130 1132 4 95 22.140 14.760 1133 5 95 88.640 -7.040 1134 6 95 88.000 -19.900 1135 7 95 90.770 -62.470 1136 8 95 47.010 19.290 1137 9 95 81.180 -16.880 1138 10 95 52.270 -18.870 1139 11 95 50.920 -12.120 1140 12 95 65.320 0.580 1141 1 96 52.630 24.670 1142 2 96 61.390 24.410 1143 3 96 34.950 40.450 1144 4 96 31.300 5.600 1145 5 96 88.560 -6.960 1146 6 96 87.240 -19.140 1147 7 96 63.930 -35.630 1148 8 96 48.060 18.240 1149 9 96 83.390 -19.090 1150 10 96 54.960 -21.560 1151 11 96 43.220 -4.420 1152 12 96 66.120 -0.220 1153 1 97 47.110 30.190 1154 2 97 70.580 15.220 1155 3 97 41.970 33.430 1156 4 97 29.390 7.510 1157 5 97 94.780 -13.180 1158 6 97 92.910 -24.810 1159 7 97 73.420 -45.120 1160 8 97 50.080 16.220 1161 9 97 90.940 -26.640 1162 10 97 49.260 -15.860 1163 11 97 51.950 -13.150 1164 12 97 69.040 -3.140 1165 1 98 48.320 28.980 1166 2 98 69.330 16.470 1167 3 98 33.780 41.620 1168 4 98 33.400 3.500 1169 5 98 92.980 -11.380 1170 6 98 91.280 -23.180 1171 7 98 66.110 -37.810 1172 8 98 52.700 13.600 1173 9 98 88.450 -24.150 1174 10 98 43.650 -10.250 1175 11 98 58.170 -19.370 1176 12 98 66.360 -0.460 1177 1 99 75.150 2.150 1178 2 99 65.450 20.350 1179 3 99 50.150 25.250 1180 4 99 26.410 10.490 1181 5 99 73.560 8.040 1182 6 99 69.920 -1.820 1183 7 99 89.260 -60.960 1184 8 99 47.220 19.080 1185 9 99 91.160 -26.860 1186 10 99 45.230 -11.830 1187 11 99 53.270 -14.470 1188 12 99 65.020 0.880 1189 1 100 57.470 19.830 1190 2 100 63.730 22.070 1191 3 100 26.870 48.530 1192 4 100 31.100 5.800 1193 5 100 80.760 0.840 1194 6 100 77.850 -9.750 1195 7 100 66.500 -38.200 1196 8 100 50.220 16.080 1197 9 100 93.550 -29.250 1198 10 100 48.780 -15.380 1199 11 100 53.430 -14.630 1200 12 100 66.560 -0.660 1201 13 101 39.790 -12.590 1202 14 101 41.200 0.200 1203 15 101 36.630 -2.530 1204 16 101 50.890 8.210 1205 17 101 37.390 -2.890 1206 18 101 40.760 -3.060 1207 19 101 35.000 17.000 1208 20 101 33.640 1.960 1209 21 101 30.950 10.050 1210 22 101 54.600 -1.100 1211 23 101 61.840 11.360 1212 24 101 65.890 -32.190 1213 13 102 32.090 -4.890 1214 14 102 37.280 4.120 1215 15 102 60.510 -26.410 1216 16 102 45.610 13.490 1217 17 102 40.250 -5.750 1218 18 102 43.230 -5.530 1219 19 102 40.850 11.150 1220 20 102 21.970 13.630 1221 21 102 30.580 10.420 1222 22 102 51.080 2.420 1223 23 102 66.250 6.950 1224 24 102 66.220 -32.520 1225 13 103 28.160 -0.960 1226 14 103 35.030 6.370 1227 15 103 54.950 -20.850 1228 16 103 46.090 13.010 1229 17 103 38.670 -4.170 1230 18 103 41.660 -3.960 1231 19 103 44.420 7.580 1232 20 103 21.290 14.310 1233 21 103 33.580 7.420 1234 22 103 50.320 3.180 1235 23 103 67.040 6.160 1236 24 103 65.610 -31.910 1237 13 104 31.110 -3.910 1238 14 104 34.930 6.470 1239 15 104 53.800 -19.700 1240 16 104 44.600 14.500 1241 17 104 39.450 -4.950 1242 18 104 42.850 -5.150 1243 19 104 45.850 6.150 1244 20 104 20.840 14.760 1245 21 104 23.690 17.310 1246 22 104 51.510 1.990 1247 23 104 65.210 7.990 1248 24 104 65.710 -32.010 1249 13 105 35.450 -8.250 1250 14 105 36.430 4.970 1251 15 105 60.530 -26.430 1252 16 105 39.160 19.940 1253 17 105 42.920 -8.420 1254 18 105 45.970 -8.270 1255 19 105 36.720 15.280 1256 20 105 21.630 13.970 1257 21 105 30.050 10.950 1258 22 105 53.220 0.280 1259 23 105 65.460 7.740 1260 24 105 66.880 -33.180 1261 13 106 39.520 -12.320 1262 14 106 32.160 9.240 1263 15 106 43.640 -9.540 1264 16 106 49.170 9.930 1265 17 106 38.500 -4.000 1266 18 106 40.610 -2.910 1267 19 106 36.600 15.400 1268 20 106 26.470 9.130 1269 21 106 41.410 -0.410 1270 22 106 56.260 -2.760 1271 23 106 55.900 17.300 1272 24 106 64.590 -30.890 1273 13 107 32.590 -5.390 1274 14 107 39.040 2.360 1275 15 107 68.140 -34.040 1276 16 107 32.320 26.780 1277 17 107 40.090 -5.590 1278 18 107 43.530 -5.830 1279 19 107 43.820 8.180 1280 20 107 27.100 8.500 1281 21 107 23.390 17.610 1282 22 107 56.450 -2.950 1283 23 107 59.970 13.230 1284 24 107 64.910 -31.210 1285 13 108 38.270 -11.070 1286 14 108 36.710 4.690 1287 15 108 40.810 -6.710 1288 16 108 45.120 13.980 1289 17 108 34.950 -0.450 1290 18 108 37.630 0.070 1291 19 108 35.690 16.310 1292 20 108 29.810 5.790 1293 21 108 38.980 2.020 1294 22 108 54.060 -0.560 1295 23 108 61.300 11.900 1296 24 108 67.440 -33.740 1297 13 109 32.100 -4.900 1298 14 109 40.420 0.980 1299 15 109 61.270 -27.170 1300 16 109 32.920 26.180 1301 17 109 41.950 -7.450 1302 18 109 45.380 -7.680 1303 19 109 45.710 6.290 1304 20 109 24.220 11.380 1305 21 109 23.680 17.320 1306 22 109 55.770 -2.270 1307 23 109 63.110 10.090 1308 24 109 64.010 -30.310 1309 13 110 31.220 -4.020 1310 14 110 42.920 -1.520 1311 15 110 33.750 0.350 1312 16 110 43.620 15.480 1313 17 110 41.380 -6.880 1314 18 110 42.930 -5.230 1315 19 110 39.140 12.860 1316 20 110 28.090 7.510 1317 21 110 33.720 7.280 1318 22 110 52.380 1.120 1319 23 110 62.540 10.660 1320 24 110 63.890 -30.190 1321 13 111 34.330 -7.130 1322 14 111 37.720 3.680 1323 15 111 38.770 -4.670 1324 16 111 45.790 13.310 1325 17 111 39.980 -5.480 1326 18 111 43.680 -5.980 1327 19 111 32.980 19.020 1328 20 111 29.160 6.440 1329 21 111 29.610 11.390 1330 22 111 52.240 1.260 1331 23 111 58.380 14.820 1332 24 111 67.790 -34.090 1333 13 112 25.920 1.280 1334 14 112 34.420 6.980 1335 15 112 49.630 -15.530 1336 16 112 50.140 8.960 1337 17 112 43.150 -8.650 1338 18 112 45.790 -8.090 1339 19 112 49.170 2.830 1340 20 112 22.040 13.560 1341 21 112 23.370 17.630 1342 22 112 53.350 0.150 1343 23 112 65.600 7.600 1344 24 112 63.720 -30.020 1345 13 113 38.800 -11.600 1346 14 113 34.380 7.020 1347 15 113 46.500 -12.400 1348 16 113 43.440 15.660 1349 17 113 42.560 -8.060 1350 18 113 45.150 -7.450 1351 19 113 28.280 23.720 1352 20 113 26.540 9.060 1353 21 113 40.040 0.960 1354 22 113 53.740 -0.240 1355 23 113 55.890 17.310 1356 24 113 64.610 -30.910 1357 13 114 31.990 -4.790 1358 14 114 45.930 -4.530 1359 15 114 39.550 -5.450 1360 16 114 41.960 17.140 1361 17 114 42.120 -7.620 1362 18 114 43.160 -5.460 1363 19 114 35.470 16.530 1364 20 114 30.990 4.610 1365 21 114 39.370 1.630 1366 22 114 53.120 0.380 1367 23 114 57.700 15.500 1368 24 114 63.960 -30.260 1369 13 115 32.110 -4.910 1370 14 115 39.300 2.100 1371 15 115 68.120 -34.020 1372 16 115 35.200 23.900 1373 17 115 37.040 -2.540 1374 18 115 40.490 -2.790 1375 19 115 45.060 6.940 1376 20 115 25.040 10.560 1377 21 115 28.630 12.370 1378 22 115 59.440 -5.940 1379 23 115 58.270 14.930 1380 24 115 65.950 -32.250 1381 13 116 41.280 -14.080 1382 14 116 32.710 8.690 1383 15 116 39.010 -4.910 1384 16 116 48.840 10.260 1385 17 116 41.530 -7.030 1386 18 116 44.620 -6.920 1387 19 116 31.140 20.860 1388 20 116 28.270 7.330 1389 21 116 37.740 3.260 1390 22 116 50.600 2.900 1391 23 116 65.590 7.610 1392 24 116 67.700 -34.000 1393 13 117 28.070 -0.870 1394 14 117 34.570 6.830 1395 15 117 49.670 -15.570 1396 16 117 42.530 16.570 1397 17 117 44.300 -9.800 1398 18 117 47.630 -9.930 1399 19 117 45.170 6.830 1400 20 117 20.880 14.720 1401 21 117 26.930 14.070 1402 22 117 49.150 4.350 1403 23 117 69.750 3.450 1404 24 117 65.270 -31.570 1405 13 118 28.770 -1.570 1406 14 118 45.560 -4.160 1407 15 118 41.100 -7.000 1408 16 118 46.300 12.800 1409 17 118 37.370 -2.870 1410 18 118 38.410 -0.710 1411 19 118 40.860 11.140 1412 20 118 29.940 5.660 1413 21 118 36.820 4.180 1414 22 118 52.560 0.940 1415 23 118 58.920 14.280 1416 24 118 66.660 -32.960 1417 13 119 40.050 -12.850 1418 14 119 40.590 0.810 1419 15 119 35.160 -1.060 1420 16 119 40.870 18.230 1421 17 119 41.830 -7.330 1422 18 119 44.740 -7.040 1423 19 119 31.790 20.210 1424 20 119 32.690 2.910 1425 21 119 38.350 2.650 1426 22 119 49.370 4.130 1427 23 119 64.030 9.170 1428 24 119 65.690 -31.990 1429 13 120 37.290 -10.090 1430 14 120 39.870 1.530 1431 15 120 38.150 -4.050 1432 16 120 37.350 21.750 1433 17 120 39.140 -4.640 1434 18 120 41.730 -4.030 1435 19 120 30.750 21.250 1436 20 120 31.140 4.460 1437 21 120 39.960 1.040 1438 22 120 52.450 1.050 1439 23 120 60.040 13.160 1440 24 120 65.390 -31.690 1441 13 121 35.450 -8.250 1442 14 121 35.730 5.670 1443 15 121 43.730 -9.630 1444 16 121 48.540 10.560 1445 17 121 40.520 -6.020 1446 18 121 43.620 -5.920 1447 19 121 33.150 18.850 1448 20 121 27.630 7.970 1449 21 121 33.370 7.630 1450 22 121 52.830 0.670 1451 23 121 53.670 19.530 1452 24 121 68.950 -35.250 1453 13 122 24.410 2.790 1454 14 122 34.270 7.130 1455 15 122 48.540 -14.440 1456 16 122 43.710 15.390 1457 17 122 41.750 -7.250 1458 18 122 44.310 -6.610 1459 19 122 48.030 3.970 1460 20 122 20.330 15.270 1461 21 122 25.330 15.670 1462 22 122 51.790 1.710 1463 23 122 71.920 1.280 1464 24 122 64.590 -30.890 1465 13 123 37.670 -10.470 1466 14 123 35.050 6.350 1467 15 123 61.790 -27.690 1468 16 123 37.540 21.560 1469 17 123 38.120 -3.620 1470 18 123 40.650 -2.950 1471 19 123 37.520 14.480 1472 20 123 20.320 15.280 1473 21 123 35.300 5.700 1474 22 123 52.480 1.020 1475 23 123 70.740 2.460 1476 24 123 68.760 -35.060 1477 13 124 34.670 -7.470 1478 14 124 32.220 9.180 1479 15 124 63.500 -29.400 1480 16 124 35.420 23.680 1481 17 124 42.100 -7.600 1482 18 124 44.790 -7.090 1483 19 124 39.420 12.580 1484 20 124 18.590 17.010 1485 21 124 32.700 8.300 1486 22 124 56.340 -2.840 1487 23 124 66.970 6.230 1488 24 124 66.090 -32.390 1489 13 125 28.440 -1.240 1490 14 125 42.160 -0.760 1491 15 125 57.590 -23.490 1492 16 125 37.180 21.920 1493 17 125 38.340 -3.840 1494 18 125 41.210 -3.510 1495 19 125 46.640 5.360 1496 20 125 26.370 9.230 1497 21 125 32.200 8.800 1498 22 125 49.740 3.760 1499 23 125 67.230 5.970 1500 24 125 68.020 -34.320 1501 13 126 35.560 -8.360 1502 14 126 34.600 6.800 1503 15 126 56.660 -22.560 1504 16 126 34.850 24.250 1505 17 126 42.830 -8.330 1506 18 126 46.230 -8.530 1507 19 126 43.840 8.160 1508 20 126 20.360 15.240 1509 21 126 27.370 13.630 1510 22 126 52.490 1.010 1511 23 126 68.320 4.880 1512 24 126 66.550 -32.850 1513 13 127 34.210 -7.010 1514 14 127 37.180 4.220 1515 15 127 68.260 -34.160 1516 16 127 39.580 19.520 1517 17 127 41.430 -6.930 1518 18 127 44.870 -7.170 1519 19 127 45.840 6.160 1520 20 127 24.840 10.760 1521 21 127 24.040 16.960 1522 22 127 53.270 0.230 1523 23 127 57.560 15.640 1524 24 127 67.360 -33.660 1525 13 128 24.840 2.360 1526 14 128 35.510 5.890 1527 15 128 56.470 -22.370 1528 16 128 49.840 9.260 1529 17 128 37.850 -3.350 1530 18 128 41.280 -3.580 1531 19 128 48.010 3.990 1532 20 128 20.880 14.720 1533 21 128 26.090 14.910 1534 22 128 54.500 -1.000 1535 23 128 69.420 3.780 1536 24 128 67.500 -33.800 1537 13 129 35.650 -8.450 1538 14 129 41.320 0.080 1539 15 129 40.750 -6.650 1540 16 129 45.270 13.830 1541 17 129 45.000 -10.500 1542 18 129 48.530 -10.830 1543 19 129 31.500 20.500 1544 20 129 31.930 3.670 1545 21 129 37.070 3.930 1546 22 129 49.660 3.840 1547 23 129 52.100 21.100 1548 24 129 65.220 -31.520 1549 13 130 28.520 -1.320 1550 14 130 31.340 10.060 1551 15 130 55.950 -21.850 1552 16 130 50.920 8.180 1553 17 130 41.610 -7.110 1554 18 130 45.270 -7.570 1555 19 130 44.770 7.230 1556 20 130 18.960 16.640 1557 21 130 25.780 15.220 1558 22 130 51.180 2.320 1559 23 130 65.830 7.370 1560 24 130 67.270 -33.570 1561 13 131 38.010 -10.810 1562 14 131 30.990 10.410 1563 15 131 60.860 -26.760 1564 16 131 40.700 18.400 1565 17 131 44.410 -9.910 1566 18 131 48.210 -10.510 1567 19 131 41.630 10.370 1568 20 131 17.770 17.830 1569 21 131 27.090 13.910 1570 22 131 52.940 0.560 1571 23 131 65.790 7.410 1572 24 131 66.230 -32.530 1573 13 132 33.130 -5.930 1574 14 132 42.550 -1.150 1575 15 132 41.420 -7.320 1576 16 132 38.710 20.390 1577 17 132 41.760 -7.260 1578 18 132 42.960 -5.260 1579 19 132 34.200 17.800 1580 20 132 28.590 7.010 1581 21 132 39.000 2.000 1582 22 132 55.640 -2.140 1583 23 132 56.860 16.340 1584 24 132 65.920 -32.220 1585 13 133 37.250 -10.050 1586 14 133 42.170 -0.770 1587 15 133 36.040 -1.940 1588 16 133 39.750 19.350 1589 17 133 35.510 -1.010 1590 18 133 38.010 -0.310 1591 19 133 29.950 22.050 1592 20 133 32.340 3.260 1593 21 133 39.730 1.270 1594 22 133 49.290 4.210 1595 23 133 59.980 13.220 1596 24 133 66.070 -32.370 1597 13 134 25.790 1.410 1598 14 134 37.250 4.150 1599 15 134 51.800 -17.700 1600 16 134 42.810 16.290 1601 17 134 43.030 -8.530 1602 18 134 45.870 -8.170 1603 19 134 48.660 3.340 1604 20 134 22.640 12.960 1605 21 134 22.790 18.210 1606 22 134 53.620 -0.120 1607 23 134 63.410 9.790 1608 24 134 65.680 -31.980 1609 13 135 34.560 -7.360 1610 14 135 34.190 7.210 1611 15 135 57.660 -23.560 1612 16 135 35.030 24.070 1613 17 135 41.990 -7.490 1614 18 135 44.980 -7.280 1615 19 135 39.550 12.450 1616 20 135 19.560 16.040 1617 21 135 28.830 12.170 1618 22 135 52.670 0.830 1619 23 135 63.040 10.160 1620 24 135 67.640 -33.940 1621 13 136 28.290 -1.090 1622 14 136 41.730 -0.330 1623 15 136 58.370 -24.270 1624 16 136 34.860 24.240 1625 17 136 39.510 -5.010 1626 18 136 43.070 -5.370 1627 19 136 45.210 6.790 1628 20 136 24.590 11.010 1629 21 136 25.390 15.610 1630 22 136 51.800 1.700 1631 23 136 63.260 9.940 1632 24 136 67.650 -33.950 1633 13 137 35.560 -8.360 1634 14 137 35.760 5.640 1635 15 137 31.600 2.500 1636 16 137 44.870 14.230 1637 17 137 36.320 -1.820 1638 18 137 40.130 -2.430 1639 19 137 35.710 16.290 1640 20 137 28.100 7.500 1641 21 137 36.810 4.190 1642 22 137 48.580 4.920 1643 23 137 64.650 8.550 1644 24 137 67.150 -33.450 1645 13 138 44.190 -16.990 1646 14 138 33.100 8.300 1647 15 138 68.920 -34.820 1648 16 138 35.100 24.000 1649 17 138 38.400 -3.900 1650 18 138 41.600 -3.900 1651 19 138 37.800 14.200 1652 20 138 20.520 15.080 1653 21 138 28.330 12.670 1654 22 138 51.910 1.590 1655 23 138 67.940 5.260 1656 24 138 68.990 -35.290 1657 13 139 27.910 -0.710 1658 14 139 32.090 9.310 1659 15 139 56.180 -22.080 1660 16 139 48.610 10.490 1661 17 139 44.220 -9.720 1662 18 139 47.330 -9.630 1663 19 139 44.990 7.010 1664 20 139 19.220 16.380 1665 21 139 27.410 13.590 1666 22 139 51.860 1.640 1667 23 139 61.130 12.070 1668 24 139 67.120 -33.420 1669 13 140 38.010 -10.810 1670 14 140 37.400 4.000 1671 15 140 37.510 -3.410 1672 16 140 43.900 15.200 1673 17 140 39.670 -5.170 1674 18 140 41.950 -4.250 1675 19 140 34.180 17.820 1676 20 140 29.000 6.600 1677 21 140 46.040 -5.040 1678 22 140 51.810 1.690 1679 23 140 59.990 13.210 1680 24 140 64.670 -30.970 1681 13 141 34.890 -7.690 1682 14 141 33.250 8.150 1683 15 141 56.350 -22.250 1684 16 141 37.910 21.190 1685 17 141 39.100 -4.600 1686 18 141 42.980 -5.280 1687 19 141 45.770 6.230 1688 20 141 20.300 15.300 1689 21 141 22.930 18.070 1690 22 141 53.110 0.390 1691 23 141 67.020 6.180 1692 24 141 68.930 -35.230 1693 13 142 31.940 -4.740 1694 14 142 40.580 0.820 1695 15 142 37.400 -3.300 1696 16 142 29.700 29.400 1697 17 142 50.820 -16.320 1698 18 142 53.140 -15.440 1699 19 142 55.510 -3.510 1700 20 142 29.900 5.700 1701 21 142 27.750 13.250 1702 22 142 54.350 -0.850 1703 23 142 61.380 11.820 1704 24 142 51.470 -17.770 1705 13 143 37.200 -10.000 1706 14 143 33.980 7.420 1707 15 143 35.500 -1.400 1708 16 143 49.090 10.010 1709 17 143 40.500 -6.000 1710 18 143 43.880 -6.180 1711 19 143 32.340 19.660 1712 20 143 27.130 8.470 1713 21 143 33.540 7.460 1714 22 143 49.860 3.640 1715 23 143 54.190 19.010 1716 24 143 68.080 -34.380 1717 13 144 37.100 -9.900 1718 14 144 38.980 2.420 1719 15 144 40.750 -6.650 1720 16 144 40.480 18.620 1721 17 144 36.430 -1.930 1722 18 144 39.840 -2.140 1723 19 144 35.190 16.810 1724 20 144 30.220 5.380 1725 21 144 33.640 7.360 1726 22 144 55.550 -2.050 1727 23 144 49.660 23.540 1728 24 144 68.970 -35.270 1729 13 145 33.120 -5.920 1730 14 145 48.190 -6.790 1731 15 145 38.990 -4.890 1732 16 145 41.990 17.110 1733 17 145 37.650 -3.150 1734 18 145 38.260 -0.560 1735 19 145 34.980 17.020 1736 20 145 32.190 3.410 1737 21 145 41.540 -0.540 1738 22 145 55.400 -1.900 1739 23 145 53.970 19.230 1740 24 145 65.580 -31.880 1741 13 146 29.350 -2.150 1742 14 146 39.280 2.120 1743 15 146 58.180 -24.080 1744 16 146 32.380 26.720 1745 17 146 41.600 -7.100 1746 18 146 45.480 -7.780 1747 19 146 44.280 7.720 1748 20 146 22.790 12.810 1749 21 146 24.050 16.950 1750 22 146 55.460 -1.960 1751 23 146 64.060 9.140 1752 24 146 67.380 -33.680 1753 13 147 35.520 -8.320 1754 14 147 39.340 2.060 1755 15 147 30.550 3.550 1756 16 147 46.560 12.540 1757 17 147 34.160 0.340 1758 18 147 37.530 0.170 1759 19 147 38.990 13.010 1760 20 147 29.250 6.350 1761 21 147 33.860 7.140 1762 22 147 50.660 2.840 1763 23 147 67.460 5.740 1764 24 147 68.980 -35.280 1765 13 148 26.970 0.230 1766 14 148 37.960 3.440 1767 15 148 49.180 -15.080 1768 16 148 48.930 10.170 1769 17 148 41.720 -7.220 1770 18 148 44.880 -7.180 1771 19 148 49.830 2.170 1772 20 148 24.540 11.060 1773 21 148 22.840 18.160 1774 22 148 57.310 -3.810 1775 23 148 59.210 13.990 1776 24 148 67.670 -33.970 1777 13 149 28.930 -1.730 1778 14 149 44.930 -3.530 1779 15 149 38.640 -4.540 1780 16 149 37.240 21.860 1781 17 149 40.140 -5.640 1782 18 149 40.400 -2.700 1783 19 149 40.010 11.990 1784 20 149 29.250 6.350 1785 21 149 40.130 0.870 1786 22 149 54.350 -0.850 1787 23 149 62.260 10.940 1788 24 149 66.040 -32.340 1789 13 150 38.840 -11.640 1790 14 150 31.090 10.310 1791 15 150 55.820 -21.720 1792 16 150 40.700 18.400 1793 17 150 41.520 -7.020 1794 18 150 45.300 -7.600 1795 19 150 45.640 6.360 1796 20 150 17.500 18.100 1797 21 150 23.530 17.470 1798 22 150 52.090 1.410 1799 23 150 67.070 6.130 1800 24 150 68.120 -34.420 1801 13 151 31.300 -4.100 1802 14 151 46.110 -4.710 1803 15 151 36.350 -2.250 1804 16 151 37.550 21.550 1805 17 151 40.740 -6.240 1806 18 151 41.940 -4.240 1807 19 151 35.060 16.940 1808 20 151 30.990 4.610 1809 21 151 33.910 7.090 1810 22 151 53.610 -0.110 1811 23 151 53.370 19.830 1812 24 151 66.490 -32.790 1813 13 152 26.660 0.540 1814 14 152 32.840 8.560 1815 15 152 58.160 -24.060 1816 16 152 39.380 19.720 1817 17 152 40.920 -6.420 1818 18 152 44.480 -6.780 1819 19 152 46.630 5.370 1820 20 152 18.950 16.650 1821 21 152 22.110 18.890 1822 22 152 55.970 -2.470 1823 23 152 58.440 14.760 1824 24 152 65.770 -32.070 1825 13 153 28.330 -1.130 1826 14 153 39.660 1.740 1827 15 153 53.980 -19.880 1828 16 153 36.980 22.120 1829 17 153 43.440 -8.940 1830 18 153 47.490 -9.790 1831 19 153 47.050 4.950 1832 20 153 23.060 12.540 1833 21 153 20.920 20.080 1834 22 153 48.900 4.600 1835 23 153 69.540 3.660 1836 24 153 67.070 -33.370 1837 13 154 30.420 -3.220 1838 14 154 34.190 7.210 1839 15 154 51.470 -17.370 1840 16 154 41.660 17.440 1841 17 154 43.650 -9.150 1842 18 154 46.710 -9.010 1843 19 154 44.800 7.200 1844 20 154 19.640 15.960 1845 21 154 22.690 18.310 1846 22 154 50.140 3.360 1847 23 154 68.150 5.050 1848 24 154 68.370 -34.670 1849 13 155 27.580 -0.380 1850 14 155 35.310 6.090 1851 15 155 45.940 -11.840 1852 16 155 46.210 12.890 1853 17 155 42.180 -7.680 1854 18 155 45.410 -7.710 1855 19 155 47.050 4.950 1856 20 155 20.800 14.800 1857 21 155 22.410 18.590 1858 22 155 50.430 3.070 1859 23 155 69.700 3.500 1860 24 155 67.990 -34.290 1861 13 156 32.890 -5.690 1862 14 156 37.480 3.920 1863 15 156 59.150 -25.050 1864 16 156 36.830 22.270 1865 17 156 40.620 -6.120 1866 18 156 43.370 -5.670 1867 19 156 39.040 12.960 1868 20 156 21.780 13.820 1869 21 156 33.950 7.050 1870 22 156 52.590 0.910 1871 23 156 61.010 12.190 1872 24 156 70.250 -36.550 1873 13 157 43.070 -15.870 1874 14 157 30.450 10.950 1875 15 157 66.610 -32.510 1876 16 157 33.340 25.760 1877 17 157 38.080 -3.580 1878 18 157 41.790 -4.090 1879 19 157 42.510 9.490 1880 20 157 17.750 17.850 1881 21 157 27.410 13.590 1882 22 157 54.760 -1.260 1883 23 157 62.890 10.310 1884 24 157 67.050 -33.350 1885 13 158 25.010 2.190 1886 14 158 31.160 10.240 1887 15 158 53.940 -19.840 1888 16 158 44.720 14.380 1889 17 158 31.990 2.510 1890 18 158 34.150 3.550 1891 19 158 49.520 2.480 1892 20 158 17.550 18.050 1893 21 158 27.690 13.310 1894 22 158 54.390 -0.890 1895 23 158 69.270 3.930 1896 24 158 66.610 -32.910 1897 13 159 26.320 0.880 1898 14 159 37.830 3.570 1899 15 159 51.000 -16.900 1900 16 159 46.750 12.350 1901 17 159 41.020 -6.520 1902 18 159 44.570 -6.870 1903 19 159 49.240 2.760 1904 20 159 22.860 12.740 1905 21 159 21.710 19.290 1906 22 159 53.450 0.050 1907 23 159 70.310 2.890 1908 24 159 68.980 -35.280 1909 13 160 34.380 -7.180 1910 14 160 33.740 7.660 1911 15 160 59.940 -25.840 1912 16 160 38.460 20.640 1913 17 160 45.440 -10.940 1914 18 160 49.670 -11.970 1915 19 160 45.480 6.520 1916 20 160 19.150 16.450 1917 21 160 24.300 16.700 1918 22 160 54.020 -0.520 1919 23 160 66.060 7.140 1920 24 160 67.240 -33.540 1921 13 161 27.560 -0.360 1922 14 161 29.180 12.220 1923 15 161 50.430 -16.330 1924 16 161 43.460 15.640 1925 17 161 41.580 -7.080 1926 18 161 44.880 -7.180 1927 19 161 47.800 4.200 1928 20 161 17.110 18.490 1929 21 161 23.020 17.980 1930 22 161 53.410 0.090 1931 23 161 64.620 8.580 1932 24 161 65.790 -32.090 1933 13 162 39.390 -12.190 1934 14 162 31.470 9.930 1935 15 162 60.440 -26.340 1936 16 162 39.660 19.440 1937 17 162 39.880 -5.380 1938 18 162 42.770 -5.070 1939 19 162 42.730 9.270 1940 20 162 17.670 17.930 1941 21 162 31.750 9.250 1942 22 162 52.080 1.420 1943 23 162 66.280 6.920 1944 24 162 69.870 -36.170 1945 13 163 47.230 -20.030 1946 14 163 34.180 7.220 1947 15 163 64.780 -30.680 1948 16 163 32.590 26.510 1949 17 163 39.160 -4.660 1950 18 163 42.520 -4.820 1951 19 163 39.300 12.700 1952 20 163 21.450 14.150 1953 21 163 33.120 7.880 1954 22 163 50.980 2.520 1955 23 163 60.850 12.350 1956 24 163 68.330 -34.630 1957 13 164 47.400 -20.200 1958 14 164 28.380 13.020 1959 15 164 68.140 -34.040 1960 16 164 37.240 21.860 1961 17 164 40.310 -5.810 1962 18 164 43.570 -5.870 1963 19 164 37.960 14.040 1964 20 164 14.960 20.640 1965 21 164 32.610 8.390 1966 22 164 53.800 -0.300 1967 23 164 64.080 9.120 1968 24 164 65.670 -31.970 1969 13 165 34.120 -6.920 1970 14 165 46.340 -4.940 1971 15 165 34.480 -0.380 1972 16 165 31.090 28.010 1973 17 165 40.400 -5.900 1974 18 165 42.130 -4.430 1975 19 165 43.380 8.620 1976 20 165 34.050 1.550 1977 21 165 35.020 5.980 1978 22 165 54.050 -0.550 1979 23 165 58.060 15.140 1980 24 165 64.950 -31.250 1981 13 166 38.800 -11.600 1982 14 166 33.660 7.740 1983 15 166 65.020 -30.920 1984 16 166 32.490 26.610 1985 17 166 39.650 -5.150 1986 18 166 43.320 -5.620 1987 19 166 44.530 7.470 1988 20 166 20.200 15.400 1989 21 166 25.120 15.880 1990 22 166 52.180 1.320 1991 23 166 62.240 10.960 1992 24 166 68.620 -34.920 1993 13 167 31.440 -4.240 1994 14 167 34.330 7.070 1995 15 167 59.330 -25.230 1996 16 167 35.830 23.270 1997 17 167 41.540 -7.040 1998 18 167 44.910 -7.210 1999 19 167 43.600 8.400 2000 20 167 19.600 16.000 2001 21 167 21.500 19.500 2002 22 167 55.280 -1.780 2003 23 167 60.290 12.910 2004 24 167 68.290 -34.590 2005 13 168 26.540 0.660 2006 14 168 42.310 -0.910 2007 15 168 63.090 -28.990 2008 16 168 36.200 22.900 2009 17 168 39.240 -4.740 2010 18 168 42.380 -4.680 2011 19 168 47.200 4.800 2012 20 168 24.310 11.290 2013 21 168 28.100 12.900 2014 22 168 56.200 -2.700 2015 23 168 60.590 12.610 2016 24 168 68.920 -35.220 2017 13 169 32.920 -5.720 2018 14 169 33.690 7.710 2019 15 169 68.860 -34.760 2020 16 169 36.420 22.680 2021 17 169 39.950 -5.450 2022 18 169 43.400 -5.700 2023 19 169 47.050 4.950 2024 20 169 20.080 15.520 2025 21 169 27.770 13.230 2026 22 169 55.180 -1.680 2027 23 169 59.990 13.210 2028 24 169 68.110 -34.410 2029 13 170 37.660 -10.460 2030 14 170 33.140 8.260 2031 15 170 64.810 -30.710 2032 16 170 35.040 24.060 2033 17 170 39.710 -5.210 2034 18 170 42.170 -4.470 2035 19 170 44.440 7.560 2036 20 170 19.950 15.650 2037 21 170 34.660 6.340 2038 22 170 54.650 -1.150 2039 23 170 60.220 12.980 2040 24 170 68.670 -34.970 2041 13 171 34.980 -7.780 2042 14 171 33.790 7.610 2043 15 171 60.170 -26.070 2044 16 171 36.740 22.360 2045 17 171 41.850 -7.350 2046 18 171 45.370 -7.670 2047 19 171 47.080 4.920 2048 20 171 22.590 13.010 2049 21 171 28.510 12.490 2050 22 171 49.200 4.300 2051 23 171 59.730 13.470 2052 24 171 69.770 -36.070 2053 13 172 30.710 -3.510 2054 14 172 50.210 -8.810 2055 15 172 29.900 4.200 2056 16 172 44.150 14.950 2057 17 172 39.950 -5.450 2058 18 172 41.120 -3.420 2059 19 172 44.770 7.230 2060 20 172 32.870 2.730 2061 21 172 32.990 8.010 2062 22 172 51.750 1.750 2063 23 172 59.730 13.470 2064 24 172 65.530 -31.830 2065 13 173 39.250 -12.050 2066 14 173 36.690 4.710 2067 15 173 34.010 0.090 2068 16 173 47.610 11.490 2069 17 173 34.530 -0.030 2070 18 173 37.190 0.510 2071 19 173 31.930 20.070 2072 20 173 29.190 6.410 2073 21 173 44.770 -3.770 2074 22 173 47.670 5.830 2075 23 173 64.980 8.220 2076 24 173 67.520 -33.820 2077 13 174 27.840 -0.640 2078 14 174 33.150 8.250 2079 15 174 45.340 -11.240 2080 16 174 43.790 15.310 2081 17 174 43.660 -9.160 2082 18 174 46.610 -8.910 2083 19 174 46.640 5.360 2084 20 174 19.840 15.760 2085 21 174 22.530 18.470 2086 22 174 49.600 3.900 2087 23 174 68.380 4.820 2088 24 174 67.830 -34.130 2089 13 175 28.210 -1.010 2090 14 175 35.350 6.050 2091 15 175 44.540 -10.440 2092 16 175 38.270 20.830 2093 17 175 42.550 -8.050 2094 18 175 45.380 -7.680 2095 19 175 48.330 3.670 2096 20 175 21.650 13.950 2097 21 175 22.750 18.250 2098 22 175 50.630 2.870 2099 23 175 66.810 6.390 2100 24 175 67.630 -33.930 2101 13 176 26.960 0.240 2102 14 176 45.750 -4.350 2103 15 176 54.940 -20.840 2104 16 176 29.540 29.560 2105 17 176 41.050 -6.550 2106 18 176 44.430 -6.730 2107 19 176 46.710 5.290 2108 20 176 27.330 8.270 2109 21 176 25.420 15.580 2110 22 176 51.060 2.440 2111 23 176 62.440 10.760 2112 24 176 67.520 -33.820 2113 13 177 22.660 4.540 2114 14 177 34.400 7.000 2115 15 177 46.900 -12.800 2116 16 177 46.300 12.800 2117 17 177 42.520 -8.020 2118 18 177 44.860 -7.160 2119 19 177 50.170 1.830 2120 20 177 20.340 15.260 2121 21 177 23.740 17.260 2122 22 177 52.560 0.940 2123 23 177 65.820 7.380 2124 24 177 66.850 -33.150 2125 13 178 24.080 3.120 2126 14 178 32.060 9.340 2127 15 178 49.630 -15.530 2128 16 178 46.460 12.640 2129 17 178 43.730 -9.230 2130 18 178 46.450 -8.750 2131 19 178 48.200 3.800 2132 20 178 19.400 16.200 2133 21 178 22.660 18.340 2134 22 178 52.290 1.210 2135 23 178 68.630 4.570 2136 24 178 67.630 -33.930 2137 13 179 39.770 -12.570 2138 14 179 32.250 9.150 2139 15 179 54.990 -20.890 2140 16 179 37.720 21.380 2141 17 179 44.630 -10.130 2142 18 179 48.300 -10.600 2143 19 179 46.240 5.760 2144 20 179 17.780 17.820 2145 21 179 23.850 17.150 2146 22 179 50.970 2.530 2147 23 179 63.370 9.830 2148 24 179 67.850 -34.150 2149 13 180 37.480 -10.280 2150 14 180 30.270 11.130 2151 15 180 65.390 -31.290 2152 16 180 34.490 24.610 2153 17 180 37.300 -2.800 2154 18 180 40.490 -2.790 2155 19 180 43.230 8.770 2156 20 180 15.380 20.220 2157 21 180 29.160 11.840 2158 22 180 53.910 -0.410 2159 23 180 60.840 12.360 2160 24 180 68.090 -34.390 2161 13 181 40.910 -13.710 2162 14 181 30.540 10.860 2163 15 181 69.210 -35.110 2164 16 181 36.540 22.560 2165 17 181 42.120 -7.620 2166 18 181 44.860 -7.160 2167 19 181 41.180 10.820 2168 20 181 16.270 19.330 2169 21 181 30.860 10.140 2170 22 181 54.390 -0.890 2171 23 181 59.080 14.120 2172 24 181 67.710 -34.010 2173 13 182 45.560 -18.360 2174 14 182 29.930 11.470 2175 15 182 65.560 -31.460 2176 16 182 32.440 26.660 2177 17 182 40.090 -5.590 2178 18 182 44.020 -6.320 2179 19 182 39.970 12.030 2180 20 182 15.820 19.780 2181 21 182 28.370 12.630 2182 22 182 55.220 -1.720 2183 23 182 59.720 13.480 2184 24 182 66.820 -33.120 2185 13 183 35.880 -8.680 2186 14 183 31.290 10.110 2187 15 183 64.230 -30.130 2188 16 183 32.470 26.630 2189 17 183 42.050 -7.550 2190 18 183 45.660 -7.960 2191 19 183 44.770 7.230 2192 20 183 16.510 19.090 2193 21 183 26.230 14.770 2194 22 183 54.230 -0.730 2195 23 183 60.010 13.190 2196 24 183 66.850 -33.150 2197 13 184 37.880 -10.680 2198 14 184 36.600 4.800 2199 15 184 38.630 -4.530 2200 16 184 39.500 19.600 2201 17 184 40.530 -6.030 2202 18 184 42.460 -4.760 2203 19 184 38.410 13.590 2204 20 184 28.250 7.350 2205 21 184 38.500 2.500 2206 22 184 58.010 -4.510 2207 23 184 47.700 25.500 2208 24 184 67.890 -34.190 2209 13 185 36.330 -9.130 2210 14 185 41.180 0.220 2211 15 185 65.250 -31.150 2212 16 185 23.870 35.230 2213 17 185 40.060 -5.560 2214 18 185 43.920 -6.220 2215 19 185 44.610 7.390 2216 20 185 28.660 6.940 2217 21 185 23.630 17.370 2218 22 185 56.730 -3.230 2219 23 185 60.790 12.410 2220 24 185 69.040 -35.340 2221 13 186 35.690 -8.490 2222 14 186 32.560 8.840 2223 15 186 67.200 -33.100 2224 16 186 31.890 27.210 2225 17 186 43.770 -9.270 2226 18 186 47.700 -10.000 2227 19 186 44.750 7.250 2228 20 186 20.300 15.300 2229 21 186 23.200 17.800 2230 22 186 58.080 -4.580 2231 23 186 61.550 11.650 2232 24 186 68.140 -34.440 2233 13 187 41.590 -14.390 2234 14 187 32.160 9.240 2235 15 187 35.910 -1.810 2236 16 187 41.610 17.490 2237 17 187 43.200 -8.700 2238 18 187 45.050 -7.350 2239 19 187 48.770 3.230 2240 20 187 20.590 15.010 2241 21 187 33.050 7.950 2242 22 187 56.910 -3.410 2243 23 187 64.540 8.660 2244 24 187 66.740 -33.040 2245 13 188 38.070 -10.870 2246 14 188 32.120 9.280 2247 15 188 68.170 -34.070 2248 16 188 33.800 25.300 2249 17 188 37.670 -3.170 2250 18 188 40.510 -2.810 2251 19 188 42.480 9.520 2252 20 188 19.520 16.080 2253 21 188 33.940 7.060 2254 22 188 54.380 -0.880 2255 23 188 60.380 12.820 2256 24 188 70.640 -36.940 2257 13 189 36.890 -9.690 2258 14 189 34.170 7.230 2259 15 189 37.990 -3.890 2260 16 189 45.240 13.860 2261 17 189 41.800 -7.300 2262 18 189 43.420 -5.720 2263 19 189 32.180 19.820 2264 20 189 25.650 9.950 2265 21 189 48.000 -7.000 2266 22 189 49.820 3.680 2267 23 189 61.050 12.150 2268 24 189 66.600 -32.900 2269 13 190 38.310 -11.110 2270 14 190 44.250 -2.850 2271 15 190 29.310 4.790 2272 16 190 40.240 18.860 2273 17 190 39.450 -4.950 2274 18 190 42.810 -5.110 2275 19 190 35.130 16.870 2276 20 190 35.290 0.310 2277 21 190 39.150 1.850 2278 22 190 52.080 1.420 2279 23 190 56.730 16.470 2280 24 190 68.390 -34.690 2281 13 191 26.870 0.330 2282 14 191 45.770 -4.370 2283 15 191 56.910 -22.810 2284 16 191 28.590 30.510 2285 17 191 42.610 -8.110 2286 18 191 46.080 -8.380 2287 19 191 47.780 4.220 2288 20 191 30.640 4.960 2289 21 191 19.870 21.130 2290 22 191 59.010 -5.510 2291 23 191 59.260 13.940 2292 24 191 68.230 -34.530 2293 13 192 24.340 2.860 2294 14 192 33.380 8.020 2295 15 192 42.550 -8.450 2296 16 192 41.350 17.750 2297 17 192 42.850 -8.350 2298 18 192 45.480 -7.780 2299 19 192 51.200 0.800 2300 20 192 19.810 15.790 2301 21 192 23.250 17.750 2302 22 192 51.090 2.410 2303 23 192 67.330 5.870 2304 24 192 67.440 -33.740 2305 13 193 47.580 -20.380 2306 14 193 29.370 12.030 2307 15 193 62.560 -28.460 2308 16 193 34.760 24.340 2309 17 193 40.440 -5.940 2310 18 193 43.550 -5.850 2311 19 193 40.870 11.130 2312 20 193 16.040 19.560 2313 21 193 32.470 8.530 2314 22 193 53.580 -0.080 2315 23 193 60.240 12.960 2316 24 193 69.290 -35.590 2317 13 194 40.010 -12.810 2318 14 194 29.060 12.340 2319 15 194 65.040 -30.940 2320 16 194 36.250 22.850 2321 17 194 45.000 -10.500 2322 18 194 48.720 -11.020 2323 19 194 40.980 11.020 2324 20 194 15.330 20.270 2325 21 194 25.460 15.540 2326 22 194 53.370 0.130 2327 23 194 62.840 10.360 2328 24 194 69.220 -35.520 2329 13 195 39.900 -12.700 2330 14 195 39.490 1.910 2331 15 195 31.490 2.610 2332 16 195 42.340 16.760 2333 17 195 40.230 -5.730 2334 18 195 42.540 -4.840 2335 19 195 28.300 23.700 2336 20 195 30.680 4.920 2337 21 195 45.770 -4.770 2338 22 195 48.270 5.230 2339 23 195 67.450 5.750 2340 24 195 67.980 -34.280 2341 13 196 34.020 -6.820 2342 14 196 31.190 10.210 2343 15 196 24.090 10.010 2344 16 196 50.360 8.740 2345 17 196 43.460 -8.960 2346 18 196 46.690 -8.990 2347 19 196 40.910 11.090 2348 20 196 23.930 11.670 2349 21 196 32.710 8.290 2350 22 196 42.410 11.090 2351 23 196 71.580 1.620 2352 24 196 67.090 -33.390 2353 13 197 31.630 -4.430 2354 14 197 27.740 13.660 2355 15 197 59.540 -25.440 2356 16 197 42.880 16.220 2357 17 197 46.180 -11.680 2358 18 197 49.390 -11.690 2359 19 197 45.750 6.250 2360 20 197 15.600 20.000 2361 21 197 25.150 15.850 2362 22 197 52.830 0.670 2363 23 197 64.450 8.750 2364 24 197 70.300 -36.600 2365 13 198 25.260 1.940 2366 14 198 40.750 0.650 2367 15 198 55.580 -21.480 2368 16 198 30.080 29.020 2369 17 198 42.340 -7.840 2370 18 198 45.570 -7.870 2371 19 198 45.950 6.050 2372 20 198 24.440 11.160 2373 21 198 20.860 20.140 2374 22 198 57.700 -4.200 2375 23 198 51.050 22.150 2376 24 198 68.110 -34.410 2377 13 199 51.740 -24.540 2378 14 199 27.900 13.500 2379 15 199 59.350 -25.250 2380 16 199 35.080 24.020 2381 17 199 40.650 -6.150 2382 18 199 43.930 -6.230 2383 19 199 38.820 13.180 2384 20 199 14.760 20.840 2385 21 199 33.080 7.920 2386 22 199 49.220 4.280 2387 23 199 60.960 12.240 2388 24 199 69.040 -35.340 2389 13 200 38.550 -11.350 2390 14 200 48.780 -7.380 2391 15 200 20.260 13.840 2392 16 200 37.820 21.280 2393 17 200 40.620 -6.120 2394 18 200 42.020 -4.320 2395 19 200 35.800 16.200 2396 20 200 33.760 1.840 2397 21 200 37.020 3.980 2398 22 200 46.880 6.620 2399 23 200 57.690 15.510 2400 24 200 65.950 -32.250 #