data_9A4A # _entry.id 9A4A # loop_ _atom_type.symbol C H N O S # loop_ _audit_author.name _audit_author.pdbx_ordinal "Stahl, K." 1 "Brock, O." 2 "Rappsilber, J." 3 # loop_ _audit_conform.dict_location _audit_conform.dict_name _audit_conform.dict_version https://mmcif.wwpdb.org/dictionaries/ascii/mmcif_ihm_ext.dic mmcif_ihm_ext.dic 1.26 http://mmcif.wwpdb.org/dictionaries/ascii/mmcif_pdbx_v50.dic mmcif_pdbx.dic 5.395 # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 9A4A _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2023-12-19 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2024-09-18 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 9A4A pdb_00009a4a 10.2210/pdb9a4a/pdb PDB-Dev PDBDEV_00000231 PDBDEV_00000231 ? # _ihm_entry_collection.id PDBDEV_G_1000003 _ihm_entry_collection.name . _ihm_entry_collection.details 'Collection of entries belonging to the publication: "Modelling protein complexes with crosslinking mass spectrometry and deep learning"' # _ihm_entry_collection_mapping.collection_id PDBDEV_G_1000003 _ihm_entry_collection_mapping.entry_id 9A4A # loop_ _chem_comp.formula _chem_comp.formula_weight _chem_comp.id _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.type "C3 H7 N O2" 89.094 ALA . ALANINE . "L-peptide linking" "C6 H15 N4 O2 1" 175.212 ARG . ARGININE . "L-peptide linking" "C4 H8 N2 O3" 132.119 ASN . ASPARAGINE . "L-peptide linking" "C4 H7 N O4" 133.103 ASP . "ASPARTIC ACID" . "L-peptide linking" "C3 H7 N O2 S" 121.154 CYS . CYSTEINE . "L-peptide linking" "C5 H10 N2 O3" 146.146 GLN . GLUTAMINE . "L-peptide linking" "C5 H9 N O4" 147.13 GLU . "GLUTAMIC ACID" . "L-peptide linking" "C2 H5 N O2" 75.067 GLY . GLYCINE . "peptide linking" "C6 H10 N3 O2 1" 156.165 HIS . HISTIDINE . "L-peptide linking" "C6 H13 N O2" 131.175 ILE . ISOLEUCINE . "L-peptide linking" "C6 H13 N O2" 131.175 LEU . LEUCINE . "L-peptide linking" "C6 H15 N2 O2 1" 147.198 LYS . LYSINE . "L-peptide linking" "C5 H11 N O2 S" 149.208 MET . METHIONINE . "L-peptide linking" "C9 H11 N O2" 165.192 PHE . PHENYLALANINE . "L-peptide linking" "C5 H9 N O2" 115.132 PRO . PROLINE . "L-peptide linking" "C3 H7 N O3" 105.093 SER . SERINE . "L-peptide linking" "C4 H9 N O3" 119.12 THR . THREONINE . "L-peptide linking" "C11 H12 N2 O2" 204.229 TRP . TRYPTOPHAN . "L-peptide linking" "C9 H11 N O3" 181.191 TYR . TYROSINE . "L-peptide linking" "C5 H11 N O2" 117.148 VAL . VALINE . "L-peptide linking" # _citation.country . _citation.id 1 _citation.journal_abbrev "Nat. Commun." _citation.journal_id_ASTM . _citation.journal_id_CSD . _citation.journal_id_ISSN . _citation.journal_issue . _citation.journal_volume 15 _citation.page_first 7866 _citation.page_last . _citation.pdbx_database_id_DOI 10.1038/s41467-024-51771-2 _citation.pdbx_database_id_PubMed 39251624 _citation.title "Modelling protein complexes with crosslinking mass spectrometry and deep learning" _citation.year 2024 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal 1 "Stahl, K." 1 1 "Warneke, R." 2 1 "Demann, L." 3 1 "Bremenkamp, R." 4 1 "Hormes, B." 5 1 "Brock, O." 6 1 "Stulke, J." 7 1 "Rappsilber, J." 8 # loop_ _entity.details _entity.formula_weight _entity.id _entity.pdbx_description _entity.pdbx_number_of_molecules _entity.src_method _entity.type . 12414.015 1 YLAN_BACSU 1 MAN POLYMER . 20125.277 2 FUR_BACSU 1 MAN POLYMER # loop_ _entity_poly.entity_id _entity_poly.nstd_chirality _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_sequence_evidence_code _entity_poly.pdbx_strand_id _entity_poly.type 1 . NO NO MASEMIVDHRQKAFELLKVDAEKILKLIRVQMDNLTMPQCPLYEEVLDTQMFGLSREIDFAVRLGLVDEKDGKDLLYTLERELSALHDAFTAK MASEMIVDHRQKAFELLKVDAEKILKLIRVQMDNLTMPQCPLYEEVLDTQMFGLSREIDFAVRLGLVDEKDGKDLLYTLERELSALHDAFTAK . A polypeptide(L) 2 . NO NO MENRIDRIKKQLHSSSYKLTPQREATVRVLLENEEDHLSAEDVYLLVKEKSPEIGLATVYRTLELLTELKVVDKINFGDGVSRYDLRKEGAAHFHHHLVCMECGAVDEIEEDLLEDVEEIIERDWKFKIKDHRLTFHGICHRCNGKETE MENRIDRIKKQLHSSSYKLTPQREATVRVLLENEEDHLSAEDVYLLVKEKSPEIGLATVYRTLELLTELKVVDKINFGDGVSRYDLRKEGAAHFHHHLVCMECGAVDEIEEDLLEDVEEIIERDWKFKIKDHRLTFHGICHRCNGKETE . B polypeptide(L) # loop_ _entity_poly_seq.entity_id _entity_poly_seq.hetero _entity_poly_seq.mon_id _entity_poly_seq.num 1 . MET 1 1 . ALA 2 1 . SER 3 1 . GLU 4 1 . MET 5 1 . ILE 6 1 . VAL 7 1 . ASP 8 1 . HIS 9 1 . ARG 10 1 . GLN 11 1 . LYS 12 1 . ALA 13 1 . PHE 14 1 . GLU 15 1 . LEU 16 1 . LEU 17 1 . LYS 18 1 . VAL 19 1 . ASP 20 1 . ALA 21 1 . GLU 22 1 . LYS 23 1 . ILE 24 1 . LEU 25 1 . LYS 26 1 . LEU 27 1 . ILE 28 1 . ARG 29 1 . VAL 30 1 . GLN 31 1 . MET 32 1 . ASP 33 1 . ASN 34 1 . LEU 35 1 . THR 36 1 . MET 37 1 . PRO 38 1 . GLN 39 1 . CYS 40 1 . PRO 41 1 . LEU 42 1 . TYR 43 1 . GLU 44 1 . GLU 45 1 . VAL 46 1 . LEU 47 1 . ASP 48 1 . THR 49 1 . GLN 50 1 . MET 51 1 . PHE 52 1 . GLY 53 1 . LEU 54 1 . SER 55 1 . ARG 56 1 . GLU 57 1 . ILE 58 1 . ASP 59 1 . PHE 60 1 . ALA 61 1 . VAL 62 1 . ARG 63 1 . LEU 64 1 . GLY 65 1 . LEU 66 1 . VAL 67 1 . ASP 68 1 . GLU 69 1 . LYS 70 1 . ASP 71 1 . GLY 72 1 . LYS 73 1 . ASP 74 1 . LEU 75 1 . LEU 76 1 . TYR 77 1 . THR 78 1 . LEU 79 1 . GLU 80 1 . ARG 81 1 . GLU 82 1 . LEU 83 1 . SER 84 1 . ALA 85 1 . LEU 86 1 . HIS 87 1 . ASP 88 1 . ALA 89 1 . PHE 90 1 . THR 91 1 . ALA 92 1 . LYS 93 2 . MET 1 2 . GLU 2 2 . ASN 3 2 . ARG 4 2 . ILE 5 2 . ASP 6 2 . ARG 7 2 . ILE 8 2 . LYS 9 2 . LYS 10 2 . GLN 11 2 . LEU 12 2 . HIS 13 2 . SER 14 2 . SER 15 2 . SER 16 2 . TYR 17 2 . LYS 18 2 . LEU 19 2 . THR 20 2 . PRO 21 2 . GLN 22 2 . ARG 23 2 . GLU 24 2 . ALA 25 2 . THR 26 2 . VAL 27 2 . ARG 28 2 . VAL 29 2 . LEU 30 2 . LEU 31 2 . GLU 32 2 . ASN 33 2 . GLU 34 2 . GLU 35 2 . ASP 36 2 . HIS 37 2 . LEU 38 2 . SER 39 2 . ALA 40 2 . GLU 41 2 . ASP 42 2 . VAL 43 2 . TYR 44 2 . LEU 45 2 . LEU 46 2 . VAL 47 2 . LYS 48 2 . GLU 49 2 . LYS 50 2 . SER 51 2 . PRO 52 2 . GLU 53 2 . ILE 54 2 . GLY 55 2 . LEU 56 2 . ALA 57 2 . THR 58 2 . VAL 59 2 . TYR 60 2 . ARG 61 2 . THR 62 2 . LEU 63 2 . GLU 64 2 . LEU 65 2 . LEU 66 2 . THR 67 2 . GLU 68 2 . LEU 69 2 . LYS 70 2 . VAL 71 2 . VAL 72 2 . ASP 73 2 . LYS 74 2 . ILE 75 2 . ASN 76 2 . PHE 77 2 . GLY 78 2 . ASP 79 2 . GLY 80 2 . VAL 81 2 . SER 82 2 . ARG 83 2 . TYR 84 2 . ASP 85 2 . LEU 86 2 . ARG 87 2 . LYS 88 2 . GLU 89 2 . GLY 90 2 . ALA 91 2 . ALA 92 2 . HIS 93 2 . PHE 94 2 . HIS 95 2 . HIS 96 2 . HIS 97 2 . LEU 98 2 . VAL 99 2 . CYS 100 2 . MET 101 2 . GLU 102 2 . CYS 103 2 . GLY 104 2 . ALA 105 2 . VAL 106 2 . ASP 107 2 . GLU 108 2 . ILE 109 2 . GLU 110 2 . GLU 111 2 . ASP 112 2 . LEU 113 2 . LEU 114 2 . GLU 115 2 . ASP 116 2 . VAL 117 2 . GLU 118 2 . GLU 119 2 . ILE 120 2 . ILE 121 2 . GLU 122 2 . ARG 123 2 . ASP 124 2 . TRP 125 2 . LYS 126 2 . PHE 127 2 . LYS 128 2 . ILE 129 2 . LYS 130 2 . ASP 131 2 . HIS 132 2 . ARG 133 2 . LEU 134 2 . THR 135 2 . PHE 136 2 . HIS 137 2 . GLY 138 2 . ILE 139 2 . CYS 140 2 . HIS 141 2 . ARG 142 2 . CYS 143 2 . ASN 144 2 . GLY 145 2 . LYS 146 2 . GLU 147 2 . THR 148 2 . GLU 149 # _ihm_chemical_component_descriptor.auth_name SDA _ihm_chemical_component_descriptor.chemical_name "succinimidyl 4,4'-azipentanoate" _ihm_chemical_component_descriptor.common_name . _ihm_chemical_component_descriptor.details . _ihm_chemical_component_descriptor.id 1 _ihm_chemical_component_descriptor.inchi 1S/C9H11N3O4/c1-9(10-11-9)5-4-8(15)16-12-6(13)2-3-7(12)14/h2-5H2,1H3 _ihm_chemical_component_descriptor.inchi_key " SYYLQNPWAPHRFV-UHFFFAOYSA-N" _ihm_chemical_component_descriptor.smiles CC1(N=N1)CCC(ON2C(CCC2=O)=O)=O _ihm_chemical_component_descriptor.smiles_canonical . # loop_ _ihm_cross_link_list.comp_id_1 _ihm_cross_link_list.comp_id_2 _ihm_cross_link_list.dataset_list_id _ihm_cross_link_list.details _ihm_cross_link_list.entity_description_1 _ihm_cross_link_list.entity_description_2 _ihm_cross_link_list.entity_id_1 _ihm_cross_link_list.entity_id_2 _ihm_cross_link_list.group_id _ihm_cross_link_list.id _ihm_cross_link_list.linker_chem_comp_descriptor_id _ihm_cross_link_list.linker_type _ihm_cross_link_list.seq_id_1 _ihm_cross_link_list.seq_id_2 LYS LYS 1 . YLAN_BACSU FUR_BACSU 1 2 1 1 1 SDA 23 74 LYS LYS 1 . YLAN_BACSU FUR_BACSU 1 2 2 2 1 SDA 26 74 # loop_ _ihm_cross_link_restraint.asym_id_1 _ihm_cross_link_restraint.asym_id_2 _ihm_cross_link_restraint.atom_id_1 _ihm_cross_link_restraint.atom_id_2 _ihm_cross_link_restraint.comp_id_1 _ihm_cross_link_restraint.comp_id_2 _ihm_cross_link_restraint.conditional_crosslink_flag _ihm_cross_link_restraint.distance_threshold _ihm_cross_link_restraint.entity_id_1 _ihm_cross_link_restraint.entity_id_2 _ihm_cross_link_restraint.group_id _ihm_cross_link_restraint.id _ihm_cross_link_restraint.model_granularity _ihm_cross_link_restraint.pseudo_site_flag _ihm_cross_link_restraint.psi _ihm_cross_link_restraint.restraint_type _ihm_cross_link_restraint.seq_id_1 _ihm_cross_link_restraint.seq_id_2 _ihm_cross_link_restraint.sigma_1 _ihm_cross_link_restraint.sigma_2 A B . . LYS LYS . 25 1 2 1 1 by-residue NO 0.95 "upper bound" 23 74 . . A B . . LYS LYS . 25 1 2 2 2 by-residue NO 0.95 "upper bound" 26 74 . . # _ihm_dataset_group.application . _ihm_dataset_group.details . _ihm_dataset_group.id 1 _ihm_dataset_group.name . # _ihm_dataset_group_link.dataset_list_id 1 _ihm_dataset_group_link.group_id 1 # _ihm_dataset_list.data_type "Crosslinking-MS data" _ihm_dataset_list.database_hosted YES _ihm_dataset_list.details . _ihm_dataset_list.id 1 # _ihm_dataset_related_db_reference.accession_code PXD035508 _ihm_dataset_related_db_reference.dataset_list_id 1 _ihm_dataset_related_db_reference.db_name PRIDE _ihm_dataset_related_db_reference.details . _ihm_dataset_related_db_reference.id 1 _ihm_dataset_related_db_reference.version . # loop_ _ihm_entity_poly_segment.comp_id_begin _ihm_entity_poly_segment.comp_id_end _ihm_entity_poly_segment.entity_id _ihm_entity_poly_segment.id _ihm_entity_poly_segment.seq_id_begin _ihm_entity_poly_segment.seq_id_end MET LYS 1 1 1 93 MET GLU 2 2 1 149 # _ihm_model_group.details . _ihm_model_group.id 1 _ihm_model_group.name . # _ihm_model_group_link.group_id 1 _ihm_model_group_link.model_id 1 # _ihm_model_list.assembly_id 1 _ihm_model_list.model_id 1 _ihm_model_list.model_name . _ihm_model_list.protocol_id 1 _ihm_model_list.representation_id 1 # _ihm_model_representation.details . _ihm_model_representation.id 1 _ihm_model_representation.name . # loop_ _ihm_model_representation_details.description _ihm_model_representation_details.entity_asym_id _ihm_model_representation_details.entity_description _ihm_model_representation_details.entity_id _ihm_model_representation_details.entity_poly_segment_id _ihm_model_representation_details.id _ihm_model_representation_details.model_granularity _ihm_model_representation_details.model_mode _ihm_model_representation_details.model_object_count _ihm_model_representation_details.model_object_primitive _ihm_model_representation_details.representation_id _ihm_model_representation_details.starting_model_id . A YLAN_BACSU 1 1 1 by-atom flexible . atomistic 1 . . B FUR_BACSU 2 2 2 by-atom flexible . atomistic 1 . # _ihm_modeling_protocol.details . _ihm_modeling_protocol.id 1 _ihm_modeling_protocol.num_steps 1 _ihm_modeling_protocol.protocol_name AlphaLink2 # _ihm_modeling_protocol_details.dataset_group_id 1 _ihm_modeling_protocol_details.description . _ihm_modeling_protocol_details.ensemble_flag NO _ihm_modeling_protocol_details.id 1 _ihm_modeling_protocol_details.multi_scale_flag NO _ihm_modeling_protocol_details.multi_state_flag NO _ihm_modeling_protocol_details.num_models_begin 0 _ihm_modeling_protocol_details.num_models_end 1 _ihm_modeling_protocol_details.ordered_flag NO _ihm_modeling_protocol_details.protocol_id 1 _ihm_modeling_protocol_details.script_file_id . _ihm_modeling_protocol_details.software_id 1 _ihm_modeling_protocol_details.step_id 1 _ihm_modeling_protocol_details.step_method AlphaLink2 _ihm_modeling_protocol_details.step_name AlphaLink2 _ihm_modeling_protocol_details.struct_assembly_description . _ihm_modeling_protocol_details.struct_assembly_id 1 # _ihm_struct_assembly.description "Integrative model of YLAN-FUR by crosslinking MS and deep learning" _ihm_struct_assembly.id 1 _ihm_struct_assembly.name YLAN-FUR # loop_ _ihm_struct_assembly_details.assembly_id _ihm_struct_assembly_details.asym_id _ihm_struct_assembly_details.entity_description _ihm_struct_assembly_details.entity_id _ihm_struct_assembly_details.entity_poly_segment_id _ihm_struct_assembly_details.id _ihm_struct_assembly_details.parent_assembly_id 1 A YLAN_BACSU 1 1 1 1 1 B FUR_BACSU 2 2 2 1 # _software.citation_id 1 _software.classification "model building" _software.description "Modelling protein complexes with crosslinking mass spectrometry and deep learning" _software.location https://github.com/Rappsilber-Laboratory/AlphaLink2 _software.name AlphaLink2 _software.pdbx_ordinal 1 _software.type program _software.version 1.0 # _struct.entry_id 9A4A _struct.pdbx_CASP_flag . _struct.pdbx_descriptor . _struct.pdbx_details . _struct.pdbx_model_details . _struct.pdbx_model_type_details . _struct.pdbx_structure_determination_methodology integrative _struct.title "Model of YLAN-FUR by crosslinking MS and deep learning" # loop_ _struct_asym.details _struct_asym.entity_id _struct_asym.id _struct_asym.pdbx_PDB_id _struct_asym.pdbx_alt_id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.pdbx_order _struct_asym.pdbx_type YLAN_BACSU 1 A . . . . . . FUR_BACSU 2 B . . . . . . # loop_ _struct_ref.db_code _struct_ref.db_name _struct_ref.details _struct_ref.entity_id _struct_ref.id _struct_ref.pdbx_align_begin _struct_ref.pdbx_align_end _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.pdbx_seq_one_letter_code A UNP . 1 1 1 . O07638 . MASEMIVDHRQKAFELLKVDAEKILKLIRVQMDNLTMPQCPLYEEVLDTQMFGLSREIDFAVRLGLVDEKDGKDLLYTLERELSALHDAFTAK B UNP . 2 2 1 . P54574 . MENRIDRIKKQLHSSSYKLTPQREATVRVLLENEEDHLSAEDVYLLVKEKSPEIGLATVYRTLELLTELKVVDKINFGDGVSRYDLRKEGAAHFHHHLVCMECGAVDEIEEDLLEDVEEIIERDWKFKIKDHRLTFHGICHRCNGKETE # loop_ _struct_ref_seq.align_id _struct_ref_seq.db_align_beg _struct_ref_seq.db_align_end _struct_ref_seq.ref_id _struct_ref_seq.seq_align_beg _struct_ref_seq.seq_align_end 1 1 93 1 1 93 2 1 149 2 1 149 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code A 1 1 MET 1 1 MET MET A . A 1 2 ALA 2 2 ALA ALA A . A 1 3 SER 3 3 SER SER A . A 1 4 GLU 4 4 GLU GLU A . A 1 5 MET 5 5 MET MET A . A 1 6 ILE 6 6 ILE ILE A . A 1 7 VAL 7 7 VAL VAL A . A 1 8 ASP 8 8 ASP ASP A . A 1 9 HIS 9 9 HIS HIS A . A 1 10 ARG 10 10 ARG ARG A . A 1 11 GLN 11 11 GLN GLN A . A 1 12 LYS 12 12 LYS LYS A . A 1 13 ALA 13 13 ALA ALA A . A 1 14 PHE 14 14 PHE PHE A . A 1 15 GLU 15 15 GLU GLU A . A 1 16 LEU 16 16 LEU LEU A . A 1 17 LEU 17 17 LEU LEU A . A 1 18 LYS 18 18 LYS LYS A . A 1 19 VAL 19 19 VAL VAL A . A 1 20 ASP 20 20 ASP ASP A . A 1 21 ALA 21 21 ALA ALA A . A 1 22 GLU 22 22 GLU GLU A . A 1 23 LYS 23 23 LYS LYS A . A 1 24 ILE 24 24 ILE ILE A . A 1 25 LEU 25 25 LEU LEU A . A 1 26 LYS 26 26 LYS LYS A . A 1 27 LEU 27 27 LEU LEU A . A 1 28 ILE 28 28 ILE ILE A . A 1 29 ARG 29 29 ARG ARG A . A 1 30 VAL 30 30 VAL VAL A . A 1 31 GLN 31 31 GLN GLN A . A 1 32 MET 32 32 MET MET A . A 1 33 ASP 33 33 ASP ASP A . A 1 34 ASN 34 34 ASN ASN A . A 1 35 LEU 35 35 LEU LEU A . A 1 36 THR 36 36 THR THR A . A 1 37 MET 37 37 MET MET A . A 1 38 PRO 38 38 PRO PRO A . A 1 39 GLN 39 39 GLN GLN A . A 1 40 CYS 40 40 CYS CYS A . A 1 41 PRO 41 41 PRO PRO A . A 1 42 LEU 42 42 LEU LEU A . A 1 43 TYR 43 43 TYR TYR A . A 1 44 GLU 44 44 GLU GLU A . A 1 45 GLU 45 45 GLU GLU A . A 1 46 VAL 46 46 VAL VAL A . A 1 47 LEU 47 47 LEU LEU A . A 1 48 ASP 48 48 ASP ASP A . A 1 49 THR 49 49 THR THR A . A 1 50 GLN 50 50 GLN GLN A . A 1 51 MET 51 51 MET MET A . A 1 52 PHE 52 52 PHE PHE A . A 1 53 GLY 53 53 GLY GLY A . A 1 54 LEU 54 54 LEU LEU A . A 1 55 SER 55 55 SER SER A . A 1 56 ARG 56 56 ARG ARG A . A 1 57 GLU 57 57 GLU GLU A . A 1 58 ILE 58 58 ILE ILE A . A 1 59 ASP 59 59 ASP ASP A . A 1 60 PHE 60 60 PHE PHE A . A 1 61 ALA 61 61 ALA ALA A . A 1 62 VAL 62 62 VAL VAL A . A 1 63 ARG 63 63 ARG ARG A . A 1 64 LEU 64 64 LEU LEU A . A 1 65 GLY 65 65 GLY GLY A . A 1 66 LEU 66 66 LEU LEU A . A 1 67 VAL 67 67 VAL VAL A . A 1 68 ASP 68 68 ASP ASP A . A 1 69 GLU 69 69 GLU GLU A . A 1 70 LYS 70 70 LYS LYS A . A 1 71 ASP 71 71 ASP ASP A . A 1 72 GLY 72 72 GLY GLY A . A 1 73 LYS 73 73 LYS LYS A . A 1 74 ASP 74 74 ASP ASP A . A 1 75 LEU 75 75 LEU LEU A . A 1 76 LEU 76 76 LEU LEU A . A 1 77 TYR 77 77 TYR TYR A . A 1 78 THR 78 78 THR THR A . A 1 79 LEU 79 79 LEU LEU A . A 1 80 GLU 80 80 GLU GLU A . A 1 81 ARG 81 81 ARG ARG A . A 1 82 GLU 82 82 GLU GLU A . A 1 83 LEU 83 83 LEU LEU A . A 1 84 SER 84 84 SER SER A . A 1 85 ALA 85 85 ALA ALA A . A 1 86 LEU 86 86 LEU LEU A . A 1 87 HIS 87 87 HIS HIS A . A 1 88 ASP 88 88 ASP ASP A . A 1 89 ALA 89 89 ALA ALA A . A 1 90 PHE 90 90 PHE PHE A . A 1 91 THR 91 91 THR THR A . A 1 92 ALA 92 92 ALA ALA A . A 1 93 LYS 93 93 LYS LYS A . B 2 1 MET 1 1 MET MET B . B 2 2 GLU 2 2 GLU GLU B . B 2 3 ASN 3 3 ASN ASN B . B 2 4 ARG 4 4 ARG ARG B . B 2 5 ILE 5 5 ILE ILE B . B 2 6 ASP 6 6 ASP ASP B . B 2 7 ARG 7 7 ARG ARG B . B 2 8 ILE 8 8 ILE ILE B . B 2 9 LYS 9 9 LYS LYS B . B 2 10 LYS 10 10 LYS LYS B . B 2 11 GLN 11 11 GLN GLN B . B 2 12 LEU 12 12 LEU LEU B . B 2 13 HIS 13 13 HIS HIS B . B 2 14 SER 14 14 SER SER B . B 2 15 SER 15 15 SER SER B . B 2 16 SER 16 16 SER SER B . B 2 17 TYR 17 17 TYR TYR B . B 2 18 LYS 18 18 LYS LYS B . B 2 19 LEU 19 19 LEU LEU B . B 2 20 THR 20 20 THR THR B . B 2 21 PRO 21 21 PRO PRO B . B 2 22 GLN 22 22 GLN GLN B . B 2 23 ARG 23 23 ARG ARG B . B 2 24 GLU 24 24 GLU GLU B . B 2 25 ALA 25 25 ALA ALA B . B 2 26 THR 26 26 THR THR B . B 2 27 VAL 27 27 VAL VAL B . B 2 28 ARG 28 28 ARG ARG B . B 2 29 VAL 29 29 VAL VAL B . B 2 30 LEU 30 30 LEU LEU B . B 2 31 LEU 31 31 LEU LEU B . B 2 32 GLU 32 32 GLU GLU B . B 2 33 ASN 33 33 ASN ASN B . B 2 34 GLU 34 34 GLU GLU B . B 2 35 GLU 35 35 GLU GLU B . B 2 36 ASP 36 36 ASP ASP B . B 2 37 HIS 37 37 HIS HIS B . B 2 38 LEU 38 38 LEU LEU B . B 2 39 SER 39 39 SER SER B . B 2 40 ALA 40 40 ALA ALA B . B 2 41 GLU 41 41 GLU GLU B . B 2 42 ASP 42 42 ASP ASP B . B 2 43 VAL 43 43 VAL VAL B . B 2 44 TYR 44 44 TYR TYR B . B 2 45 LEU 45 45 LEU LEU B . B 2 46 LEU 46 46 LEU LEU B . B 2 47 VAL 47 47 VAL VAL B . B 2 48 LYS 48 48 LYS LYS B . B 2 49 GLU 49 49 GLU GLU B . B 2 50 LYS 50 50 LYS LYS B . B 2 51 SER 51 51 SER SER B . B 2 52 PRO 52 52 PRO PRO B . B 2 53 GLU 53 53 GLU GLU B . B 2 54 ILE 54 54 ILE ILE B . B 2 55 GLY 55 55 GLY GLY B . B 2 56 LEU 56 56 LEU LEU B . B 2 57 ALA 57 57 ALA ALA B . B 2 58 THR 58 58 THR THR B . B 2 59 VAL 59 59 VAL VAL B . B 2 60 TYR 60 60 TYR TYR B . B 2 61 ARG 61 61 ARG ARG B . B 2 62 THR 62 62 THR THR B . B 2 63 LEU 63 63 LEU LEU B . B 2 64 GLU 64 64 GLU GLU B . B 2 65 LEU 65 65 LEU LEU B . B 2 66 LEU 66 66 LEU LEU B . B 2 67 THR 67 67 THR THR B . B 2 68 GLU 68 68 GLU GLU B . B 2 69 LEU 69 69 LEU LEU B . B 2 70 LYS 70 70 LYS LYS B . B 2 71 VAL 71 71 VAL VAL B . B 2 72 VAL 72 72 VAL VAL B . B 2 73 ASP 73 73 ASP ASP B . B 2 74 LYS 74 74 LYS LYS B . B 2 75 ILE 75 75 ILE ILE B . B 2 76 ASN 76 76 ASN ASN B . B 2 77 PHE 77 77 PHE PHE B . B 2 78 GLY 78 78 GLY GLY B . B 2 79 ASP 79 79 ASP ASP B . B 2 80 GLY 80 80 GLY GLY B . B 2 81 VAL 81 81 VAL VAL B . B 2 82 SER 82 82 SER SER B . B 2 83 ARG 83 83 ARG ARG B . B 2 84 TYR 84 84 TYR TYR B . B 2 85 ASP 85 85 ASP ASP B . B 2 86 LEU 86 86 LEU LEU B . B 2 87 ARG 87 87 ARG ARG B . B 2 88 LYS 88 88 LYS LYS B . B 2 89 GLU 89 89 GLU GLU B . B 2 90 GLY 90 90 GLY GLY B . B 2 91 ALA 91 91 ALA ALA B . B 2 92 ALA 92 92 ALA ALA B . B 2 93 HIS 93 93 HIS HIS B . B 2 94 PHE 94 94 PHE PHE B . B 2 95 HIS 95 95 HIS HIS B . B 2 96 HIS 96 96 HIS HIS B . B 2 97 HIS 97 97 HIS HIS B . B 2 98 LEU 98 98 LEU LEU B . B 2 99 VAL 99 99 VAL VAL B . B 2 100 CYS 100 100 CYS CYS B . B 2 101 MET 101 101 MET MET B . B 2 102 GLU 102 102 GLU GLU B . B 2 103 CYS 103 103 CYS CYS B . B 2 104 GLY 104 104 GLY GLY B . B 2 105 ALA 105 105 ALA ALA B . B 2 106 VAL 106 106 VAL VAL B . B 2 107 ASP 107 107 ASP ASP B . B 2 108 GLU 108 108 GLU GLU B . B 2 109 ILE 109 109 ILE ILE B . B 2 110 GLU 110 110 GLU GLU B . B 2 111 GLU 111 111 GLU GLU B . B 2 112 ASP 112 112 ASP ASP B . B 2 113 LEU 113 113 LEU LEU B . B 2 114 LEU 114 114 LEU LEU B . B 2 115 GLU 115 115 GLU GLU B . B 2 116 ASP 116 116 ASP ASP B . B 2 117 VAL 117 117 VAL VAL B . B 2 118 GLU 118 118 GLU GLU B . B 2 119 GLU 119 119 GLU GLU B . B 2 120 ILE 120 120 ILE ILE B . B 2 121 ILE 121 121 ILE ILE B . B 2 122 GLU 122 122 GLU GLU B . B 2 123 ARG 123 123 ARG ARG B . B 2 124 ASP 124 124 ASP ASP B . B 2 125 TRP 125 125 TRP TRP B . B 2 126 LYS 126 126 LYS LYS B . B 2 127 PHE 127 127 PHE PHE B . B 2 128 LYS 128 128 LYS LYS B . B 2 129 ILE 129 129 ILE ILE B . B 2 130 LYS 130 130 LYS LYS B . B 2 131 ASP 131 131 ASP ASP B . B 2 132 HIS 132 132 HIS HIS B . B 2 133 ARG 133 133 ARG ARG B . B 2 134 LEU 134 134 LEU LEU B . B 2 135 THR 135 135 THR THR B . B 2 136 PHE 136 136 PHE PHE B . B 2 137 HIS 137 137 HIS HIS B . B 2 138 GLY 138 138 GLY GLY B . B 2 139 ILE 139 139 ILE ILE B . B 2 140 CYS 140 140 CYS CYS B . B 2 141 HIS 141 141 HIS HIS B . B 2 142 ARG 142 142 ARG ARG B . B 2 143 CYS 143 143 CYS CYS B . B 2 144 ASN 144 144 ASN ASN B . B 2 145 GLY 145 145 GLY GLY B . B 2 146 LYS 146 146 LYS LYS B . B 2 147 GLU 147 147 GLU GLU B . B 2 148 THR 148 148 THR THR B . B 2 149 GLU 149 149 GLU GLU B . # # loop_ # #