data_9A4H # _entry.id 9A4H # loop_ _atom_type.symbol C H N O S # loop_ _audit_author.name _audit_author.pdbx_ordinal "Stahl, K." 1 "Brock, O." 2 "Rappsilber, J." 3 # loop_ _audit_conform.dict_location _audit_conform.dict_name _audit_conform.dict_version https://mmcif.wwpdb.org/dictionaries/ascii/mmcif_ihm_ext.dic mmcif_ihm_ext.dic 1.26 http://mmcif.wwpdb.org/dictionaries/ascii/mmcif_pdbx_v50.dic mmcif_pdbx.dic 5.395 # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 9A4H _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2024-01-22 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2024-09-18 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 9A4H pdb_00009a4h 10.2210/pdb9a4h/pdb PDB-Dev PDBDEV_00000238 PDBDEV_00000238 ? # _ihm_entry_collection.id PDBDEV_G_1000003 _ihm_entry_collection.name . _ihm_entry_collection.details 'Collection of entries belonging to the publication: "Modelling protein complexes with crosslinking mass spectrometry and deep learning"' # _ihm_entry_collection_mapping.collection_id PDBDEV_G_1000003 _ihm_entry_collection_mapping.entry_id 9A4H # loop_ _chem_comp.formula _chem_comp.formula_weight _chem_comp.id _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.type "C3 H7 N O2" 89.094 ALA . ALANINE . "L-peptide linking" "C6 H15 N4 O2 1" 175.212 ARG . ARGININE . "L-peptide linking" "C4 H8 N2 O3" 132.119 ASN . ASPARAGINE . "L-peptide linking" "C4 H7 N O4" 133.103 ASP . "ASPARTIC ACID" . "L-peptide linking" "C5 H10 N2 O3" 146.146 GLN . GLUTAMINE . "L-peptide linking" "C5 H9 N O4" 147.13 GLU . "GLUTAMIC ACID" . "L-peptide linking" "C2 H5 N O2" 75.067 GLY . GLYCINE . "peptide linking" "C6 H13 N O2" 131.175 ILE . ISOLEUCINE . "L-peptide linking" "C6 H13 N O2" 131.175 LEU . LEUCINE . "L-peptide linking" "C6 H15 N2 O2 1" 147.198 LYS . LYSINE . "L-peptide linking" "C5 H11 N O2 S" 149.208 MET . METHIONINE . "L-peptide linking" "C9 H11 N O2" 165.192 PHE . PHENYLALANINE . "L-peptide linking" "C5 H9 N O2" 115.132 PRO . PROLINE . "L-peptide linking" "C3 H7 N O3" 105.093 SER . SERINE . "L-peptide linking" "C4 H9 N O3" 119.12 THR . THREONINE . "L-peptide linking" "C9 H11 N O3" 181.191 TYR . TYROSINE . "L-peptide linking" "C5 H11 N O2" 117.148 VAL . VALINE . "L-peptide linking" # _citation.country . _citation.id 1 _citation.journal_abbrev "Nat. Commun." _citation.journal_id_ASTM . _citation.journal_id_CSD . _citation.journal_id_ISSN . _citation.journal_issue . _citation.journal_volume 15 _citation.page_first 7866 _citation.page_last . _citation.pdbx_database_id_DOI 10.1038/s41467-024-51771-2 _citation.pdbx_database_id_PubMed 39251624 _citation.title "Modelling protein complexes with crosslinking mass spectrometry and deep learning" _citation.year 2024 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal 1 "Stahl, K." 1 1 "Warneke, R." 2 1 "Demann, L." 3 1 "Bremenkamp, R." 4 1 "Hormes, B." 5 1 "Brock, O." 6 1 "Stulke, J." 7 1 "Rappsilber, J." 8 # loop_ _entity.details _entity.formula_weight _entity.id _entity.pdbx_description _entity.pdbx_number_of_molecules _entity.src_method _entity.type . 9966.687 1 ACP_BACSU 1 MAN POLYMER . 11539.803 2 DBH1_BACSU 1 MAN POLYMER # loop_ _entity_poly.entity_id _entity_poly.nstd_chirality _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_sequence_evidence_code _entity_poly.pdbx_strand_id _entity_poly.type 1 . NO NO MADTLERVTKIIVDRLGVDEADVKLEASFKEDLGADSLDVVELVMELEDEFDMEISDEDAEKIATVGDAVNYIQNQQ MADTLERVTKIIVDRLGVDEADVKLEASFKEDLGADSLDVVELVMELEDEFDMEISDEDAEKIATVGDAVNYIQNQQ . A polypeptide(L) 2 . NO NO MNKTELINAVAEASELSKKDATKAVDSVFDTILDALKNGDKIQLIGFGNFEVRERSARKGRNPQTGEEIEIPASKVPAFKPGKALKDAVAGK MNKTELINAVAEASELSKKDATKAVDSVFDTILDALKNGDKIQLIGFGNFEVRERSARKGRNPQTGEEIEIPASKVPAFKPGKALKDAVAGK . B polypeptide(L) # loop_ _entity_poly_seq.entity_id _entity_poly_seq.hetero _entity_poly_seq.mon_id _entity_poly_seq.num 1 . MET 1 1 . ALA 2 1 . ASP 3 1 . THR 4 1 . LEU 5 1 . GLU 6 1 . ARG 7 1 . VAL 8 1 . THR 9 1 . LYS 10 1 . ILE 11 1 . ILE 12 1 . VAL 13 1 . ASP 14 1 . ARG 15 1 . LEU 16 1 . GLY 17 1 . VAL 18 1 . ASP 19 1 . GLU 20 1 . ALA 21 1 . ASP 22 1 . VAL 23 1 . LYS 24 1 . LEU 25 1 . GLU 26 1 . ALA 27 1 . SER 28 1 . PHE 29 1 . LYS 30 1 . GLU 31 1 . ASP 32 1 . LEU 33 1 . GLY 34 1 . ALA 35 1 . ASP 36 1 . SER 37 1 . LEU 38 1 . ASP 39 1 . VAL 40 1 . VAL 41 1 . GLU 42 1 . LEU 43 1 . VAL 44 1 . MET 45 1 . GLU 46 1 . LEU 47 1 . GLU 48 1 . ASP 49 1 . GLU 50 1 . PHE 51 1 . ASP 52 1 . MET 53 1 . GLU 54 1 . ILE 55 1 . SER 56 1 . ASP 57 1 . GLU 58 1 . ASP 59 1 . ALA 60 1 . GLU 61 1 . LYS 62 1 . ILE 63 1 . ALA 64 1 . THR 65 1 . VAL 66 1 . GLY 67 1 . ASP 68 1 . ALA 69 1 . VAL 70 1 . ASN 71 1 . TYR 72 1 . ILE 73 1 . GLN 74 1 . ASN 75 1 . GLN 76 1 . GLN 77 2 . MET 1 2 . ASN 2 2 . LYS 3 2 . THR 4 2 . GLU 5 2 . LEU 6 2 . ILE 7 2 . ASN 8 2 . ALA 9 2 . VAL 10 2 . ALA 11 2 . GLU 12 2 . ALA 13 2 . SER 14 2 . GLU 15 2 . LEU 16 2 . SER 17 2 . LYS 18 2 . LYS 19 2 . ASP 20 2 . ALA 21 2 . THR 22 2 . LYS 23 2 . ALA 24 2 . VAL 25 2 . ASP 26 2 . SER 27 2 . VAL 28 2 . PHE 29 2 . ASP 30 2 . THR 31 2 . ILE 32 2 . LEU 33 2 . ASP 34 2 . ALA 35 2 . LEU 36 2 . LYS 37 2 . ASN 38 2 . GLY 39 2 . ASP 40 2 . LYS 41 2 . ILE 42 2 . GLN 43 2 . LEU 44 2 . ILE 45 2 . GLY 46 2 . PHE 47 2 . GLY 48 2 . ASN 49 2 . PHE 50 2 . GLU 51 2 . VAL 52 2 . ARG 53 2 . GLU 54 2 . ARG 55 2 . SER 56 2 . ALA 57 2 . ARG 58 2 . LYS 59 2 . GLY 60 2 . ARG 61 2 . ASN 62 2 . PRO 63 2 . GLN 64 2 . THR 65 2 . GLY 66 2 . GLU 67 2 . GLU 68 2 . ILE 69 2 . GLU 70 2 . ILE 71 2 . PRO 72 2 . ALA 73 2 . SER 74 2 . LYS 75 2 . VAL 76 2 . PRO 77 2 . ALA 78 2 . PHE 79 2 . LYS 80 2 . PRO 81 2 . GLY 82 2 . LYS 83 2 . ALA 84 2 . LEU 85 2 . LYS 86 2 . ASP 87 2 . ALA 88 2 . VAL 89 2 . ALA 90 2 . GLY 91 2 . LYS 92 # _ihm_chemical_component_descriptor.auth_name SDA _ihm_chemical_component_descriptor.chemical_name "succinimidyl 4,4'-azipentanoate" _ihm_chemical_component_descriptor.common_name . _ihm_chemical_component_descriptor.details . _ihm_chemical_component_descriptor.id 1 _ihm_chemical_component_descriptor.inchi 1S/C9H11N3O4/c1-9(10-11-9)5-4-8(15)16-12-6(13)2-3-7(12)14/h2-5H2,1H3 _ihm_chemical_component_descriptor.inchi_key " SYYLQNPWAPHRFV-UHFFFAOYSA-N" _ihm_chemical_component_descriptor.smiles CC1(N=N1)CCC(ON2C(CCC2=O)=O)=O _ihm_chemical_component_descriptor.smiles_canonical . # _ihm_cross_link_list.comp_id_1 LYS _ihm_cross_link_list.comp_id_2 LYS _ihm_cross_link_list.dataset_list_id 1 _ihm_cross_link_list.details . _ihm_cross_link_list.entity_description_1 ACP_BACSU _ihm_cross_link_list.entity_description_2 DBH1_BACSU _ihm_cross_link_list.entity_id_1 1 _ihm_cross_link_list.entity_id_2 2 _ihm_cross_link_list.group_id 1 _ihm_cross_link_list.id 1 _ihm_cross_link_list.linker_chem_comp_descriptor_id 1 _ihm_cross_link_list.linker_type SDA _ihm_cross_link_list.seq_id_1 10 _ihm_cross_link_list.seq_id_2 83 # _ihm_cross_link_restraint.asym_id_1 A _ihm_cross_link_restraint.asym_id_2 B _ihm_cross_link_restraint.atom_id_1 . _ihm_cross_link_restraint.atom_id_2 . _ihm_cross_link_restraint.comp_id_1 LYS _ihm_cross_link_restraint.comp_id_2 LYS _ihm_cross_link_restraint.conditional_crosslink_flag . _ihm_cross_link_restraint.distance_threshold 25 _ihm_cross_link_restraint.entity_id_1 1 _ihm_cross_link_restraint.entity_id_2 2 _ihm_cross_link_restraint.group_id 1 _ihm_cross_link_restraint.id 1 _ihm_cross_link_restraint.model_granularity by-residue _ihm_cross_link_restraint.pseudo_site_flag NO _ihm_cross_link_restraint.psi 0.95 _ihm_cross_link_restraint.restraint_type "upper bound" _ihm_cross_link_restraint.seq_id_1 10 _ihm_cross_link_restraint.seq_id_2 83 _ihm_cross_link_restraint.sigma_1 . _ihm_cross_link_restraint.sigma_2 . # _ihm_dataset_group.application . _ihm_dataset_group.details . _ihm_dataset_group.id 1 _ihm_dataset_group.name . # _ihm_dataset_group_link.dataset_list_id 1 _ihm_dataset_group_link.group_id 1 # _ihm_dataset_list.data_type "Crosslinking-MS data" _ihm_dataset_list.database_hosted YES _ihm_dataset_list.details . _ihm_dataset_list.id 1 # _ihm_dataset_related_db_reference.accession_code PXD035508 _ihm_dataset_related_db_reference.dataset_list_id 1 _ihm_dataset_related_db_reference.db_name PRIDE _ihm_dataset_related_db_reference.details . _ihm_dataset_related_db_reference.id 1 _ihm_dataset_related_db_reference.version . # loop_ _ihm_entity_poly_segment.comp_id_begin _ihm_entity_poly_segment.comp_id_end _ihm_entity_poly_segment.entity_id _ihm_entity_poly_segment.id _ihm_entity_poly_segment.seq_id_begin _ihm_entity_poly_segment.seq_id_end MET GLN 1 1 1 77 MET LYS 2 2 1 92 # _ihm_model_group.details . _ihm_model_group.id 1 _ihm_model_group.name . # _ihm_model_group_link.group_id 1 _ihm_model_group_link.model_id 1 # _ihm_model_list.assembly_id 1 _ihm_model_list.model_id 1 _ihm_model_list.model_name . _ihm_model_list.protocol_id 1 _ihm_model_list.representation_id 1 # _ihm_model_representation.details . _ihm_model_representation.id 1 _ihm_model_representation.name . # loop_ _ihm_model_representation_details.description _ihm_model_representation_details.entity_asym_id _ihm_model_representation_details.entity_description _ihm_model_representation_details.entity_id _ihm_model_representation_details.entity_poly_segment_id _ihm_model_representation_details.id _ihm_model_representation_details.model_granularity _ihm_model_representation_details.model_mode _ihm_model_representation_details.model_object_count _ihm_model_representation_details.model_object_primitive _ihm_model_representation_details.representation_id _ihm_model_representation_details.starting_model_id . A ACP_BACSU 1 1 1 by-atom flexible . atomistic 1 . . B DBH1_BACSU 2 2 2 by-atom flexible . atomistic 1 . # _ihm_modeling_protocol.details . _ihm_modeling_protocol.id 1 _ihm_modeling_protocol.num_steps 1 _ihm_modeling_protocol.protocol_name AlphaLink2 # _ihm_modeling_protocol_details.dataset_group_id 1 _ihm_modeling_protocol_details.description . _ihm_modeling_protocol_details.ensemble_flag NO _ihm_modeling_protocol_details.id 1 _ihm_modeling_protocol_details.multi_scale_flag NO _ihm_modeling_protocol_details.multi_state_flag NO _ihm_modeling_protocol_details.num_models_begin 0 _ihm_modeling_protocol_details.num_models_end 1 _ihm_modeling_protocol_details.ordered_flag NO _ihm_modeling_protocol_details.protocol_id 1 _ihm_modeling_protocol_details.script_file_id . _ihm_modeling_protocol_details.software_id 1 _ihm_modeling_protocol_details.step_id 1 _ihm_modeling_protocol_details.step_method AlphaLink2 _ihm_modeling_protocol_details.step_name AlphaLink2 _ihm_modeling_protocol_details.struct_assembly_description . _ihm_modeling_protocol_details.struct_assembly_id 1 # _ihm_struct_assembly.description "Integrative model of ACP-DBH1 by crosslinking MS and deep learning" _ihm_struct_assembly.id 1 _ihm_struct_assembly.name ACP-DBH1 # loop_ _ihm_struct_assembly_details.assembly_id _ihm_struct_assembly_details.asym_id _ihm_struct_assembly_details.entity_description _ihm_struct_assembly_details.entity_id _ihm_struct_assembly_details.entity_poly_segment_id _ihm_struct_assembly_details.id _ihm_struct_assembly_details.parent_assembly_id 1 A ACP_BACSU 1 1 1 1 1 B DBH1_BACSU 2 2 2 1 # _software.citation_id 1 _software.classification "model building" _software.description "Modelling protein complexes with crosslinking mass spectrometry and deep learning" _software.location https://github.com/Rappsilber-Laboratory/AlphaLink2 _software.name AlphaLink2 _software.pdbx_ordinal 1 _software.type program _software.version 1.0 # _struct.entry_id 9A4H _struct.pdbx_CASP_flag . _struct.pdbx_descriptor . _struct.pdbx_details . _struct.pdbx_model_details . _struct.pdbx_model_type_details . _struct.pdbx_structure_determination_methodology integrative _struct.title "Integrative model of ACP-DBH1 by crosslinking MS and deep learning" # loop_ _struct_asym.details _struct_asym.entity_id _struct_asym.id _struct_asym.pdbx_PDB_id _struct_asym.pdbx_alt_id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.pdbx_order _struct_asym.pdbx_type ACP_BACSU 1 A . . . . . . DBH1_BACSU 2 B . . . . . . # loop_ _struct_ref.db_code _struct_ref.db_name _struct_ref.details _struct_ref.entity_id _struct_ref.id _struct_ref.pdbx_align_begin _struct_ref.pdbx_align_end _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.pdbx_seq_one_letter_code A UNP . 1 1 1 . P80643 . MADTLERVTKIIVDRLGVDEADVKLEASFKEDLGADSLDVVELVMELEDEFDMEISDEDAEKIATVGDAVNYIQNQQ B UNP . 2 2 1 . P08821 . MNKTELINAVAEASELSKKDATKAVDSVFDTILDALKNGDKIQLIGFGNFEVRERSARKGRNPQTGEEIEIPASKVPAFKPGKALKDAVAGK # loop_ _struct_ref_seq.align_id _struct_ref_seq.db_align_beg _struct_ref_seq.db_align_end _struct_ref_seq.ref_id _struct_ref_seq.seq_align_beg _struct_ref_seq.seq_align_end 1 1 77 1 1 77 2 1 92 2 1 92 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code A 1 1 MET 1 1 MET MET A . A 1 2 ALA 2 2 ALA ALA A . A 1 3 ASP 3 3 ASP ASP A . A 1 4 THR 4 4 THR THR A . A 1 5 LEU 5 5 LEU LEU A . A 1 6 GLU 6 6 GLU GLU A . A 1 7 ARG 7 7 ARG ARG A . A 1 8 VAL 8 8 VAL VAL A . A 1 9 THR 9 9 THR THR A . A 1 10 LYS 10 10 LYS LYS A . A 1 11 ILE 11 11 ILE ILE A . A 1 12 ILE 12 12 ILE ILE A . A 1 13 VAL 13 13 VAL VAL A . A 1 14 ASP 14 14 ASP ASP A . A 1 15 ARG 15 15 ARG ARG A . A 1 16 LEU 16 16 LEU LEU A . A 1 17 GLY 17 17 GLY GLY A . A 1 18 VAL 18 18 VAL VAL A . A 1 19 ASP 19 19 ASP ASP A . A 1 20 GLU 20 20 GLU GLU A . A 1 21 ALA 21 21 ALA ALA A . A 1 22 ASP 22 22 ASP ASP A . A 1 23 VAL 23 23 VAL VAL A . A 1 24 LYS 24 24 LYS LYS A . A 1 25 LEU 25 25 LEU LEU A . A 1 26 GLU 26 26 GLU GLU A . A 1 27 ALA 27 27 ALA ALA A . A 1 28 SER 28 28 SER SER A . A 1 29 PHE 29 29 PHE PHE A . A 1 30 LYS 30 30 LYS LYS A . A 1 31 GLU 31 31 GLU GLU A . A 1 32 ASP 32 32 ASP ASP A . A 1 33 LEU 33 33 LEU LEU A . A 1 34 GLY 34 34 GLY GLY A . A 1 35 ALA 35 35 ALA ALA A . A 1 36 ASP 36 36 ASP ASP A . A 1 37 SER 37 37 SER SER A . A 1 38 LEU 38 38 LEU LEU A . A 1 39 ASP 39 39 ASP ASP A . A 1 40 VAL 40 40 VAL VAL A . A 1 41 VAL 41 41 VAL VAL A . A 1 42 GLU 42 42 GLU GLU A . A 1 43 LEU 43 43 LEU LEU A . A 1 44 VAL 44 44 VAL VAL A . A 1 45 MET 45 45 MET MET A . A 1 46 GLU 46 46 GLU GLU A . A 1 47 LEU 47 47 LEU LEU A . A 1 48 GLU 48 48 GLU GLU A . A 1 49 ASP 49 49 ASP ASP A . A 1 50 GLU 50 50 GLU GLU A . A 1 51 PHE 51 51 PHE PHE A . A 1 52 ASP 52 52 ASP ASP A . A 1 53 MET 53 53 MET MET A . A 1 54 GLU 54 54 GLU GLU A . A 1 55 ILE 55 55 ILE ILE A . A 1 56 SER 56 56 SER SER A . A 1 57 ASP 57 57 ASP ASP A . A 1 58 GLU 58 58 GLU GLU A . A 1 59 ASP 59 59 ASP ASP A . A 1 60 ALA 60 60 ALA ALA A . A 1 61 GLU 61 61 GLU GLU A . A 1 62 LYS 62 62 LYS LYS A . A 1 63 ILE 63 63 ILE ILE A . A 1 64 ALA 64 64 ALA ALA A . A 1 65 THR 65 65 THR THR A . A 1 66 VAL 66 66 VAL VAL A . A 1 67 GLY 67 67 GLY GLY A . A 1 68 ASP 68 68 ASP ASP A . A 1 69 ALA 69 69 ALA ALA A . A 1 70 VAL 70 70 VAL VAL A . A 1 71 ASN 71 71 ASN ASN A . A 1 72 TYR 72 72 TYR TYR A . A 1 73 ILE 73 73 ILE ILE A . A 1 74 GLN 74 74 GLN GLN A . A 1 75 ASN 75 75 ASN ASN A . A 1 76 GLN 76 76 GLN GLN A . A 1 77 GLN 77 77 GLN GLN A . B 2 1 MET 1 1 MET MET B . B 2 2 ASN 2 2 ASN ASN B . B 2 3 LYS 3 3 LYS LYS B . B 2 4 THR 4 4 THR THR B . B 2 5 GLU 5 5 GLU GLU B . B 2 6 LEU 6 6 LEU LEU B . B 2 7 ILE 7 7 ILE ILE B . B 2 8 ASN 8 8 ASN ASN B . B 2 9 ALA 9 9 ALA ALA B . B 2 10 VAL 10 10 VAL VAL B . B 2 11 ALA 11 11 ALA ALA B . B 2 12 GLU 12 12 GLU GLU B . B 2 13 ALA 13 13 ALA ALA B . B 2 14 SER 14 14 SER SER B . B 2 15 GLU 15 15 GLU GLU B . B 2 16 LEU 16 16 LEU LEU B . B 2 17 SER 17 17 SER SER B . B 2 18 LYS 18 18 LYS LYS B . B 2 19 LYS 19 19 LYS LYS B . B 2 20 ASP 20 20 ASP ASP B . B 2 21 ALA 21 21 ALA ALA B . B 2 22 THR 22 22 THR THR B . B 2 23 LYS 23 23 LYS LYS B . B 2 24 ALA 24 24 ALA ALA B . B 2 25 VAL 25 25 VAL VAL B . B 2 26 ASP 26 26 ASP ASP B . B 2 27 SER 27 27 SER SER B . B 2 28 VAL 28 28 VAL VAL B . B 2 29 PHE 29 29 PHE PHE B . B 2 30 ASP 30 30 ASP ASP B . B 2 31 THR 31 31 THR THR B . B 2 32 ILE 32 32 ILE ILE B . B 2 33 LEU 33 33 LEU LEU B . B 2 34 ASP 34 34 ASP ASP B . B 2 35 ALA 35 35 ALA ALA B . B 2 36 LEU 36 36 LEU LEU B . B 2 37 LYS 37 37 LYS LYS B . B 2 38 ASN 38 38 ASN ASN B . B 2 39 GLY 39 39 GLY GLY B . B 2 40 ASP 40 40 ASP ASP B . B 2 41 LYS 41 41 LYS LYS B . B 2 42 ILE 42 42 ILE ILE B . B 2 43 GLN 43 43 GLN GLN B . B 2 44 LEU 44 44 LEU LEU B . B 2 45 ILE 45 45 ILE ILE B . B 2 46 GLY 46 46 GLY GLY B . B 2 47 PHE 47 47 PHE PHE B . B 2 48 GLY 48 48 GLY GLY B . B 2 49 ASN 49 49 ASN ASN B . B 2 50 PHE 50 50 PHE PHE B . B 2 51 GLU 51 51 GLU GLU B . B 2 52 VAL 52 52 VAL VAL B . B 2 53 ARG 53 53 ARG ARG B . B 2 54 GLU 54 54 GLU GLU B . B 2 55 ARG 55 55 ARG ARG B . B 2 56 SER 56 56 SER SER B . B 2 57 ALA 57 57 ALA ALA B . B 2 58 ARG 58 58 ARG ARG B . B 2 59 LYS 59 59 LYS LYS B . B 2 60 GLY 60 60 GLY GLY B . B 2 61 ARG 61 61 ARG ARG B . B 2 62 ASN 62 62 ASN ASN B . B 2 63 PRO 63 63 PRO PRO B . B 2 64 GLN 64 64 GLN GLN B . B 2 65 THR 65 65 THR THR B . B 2 66 GLY 66 66 GLY GLY B . B 2 67 GLU 67 67 GLU GLU B . B 2 68 GLU 68 68 GLU GLU B . B 2 69 ILE 69 69 ILE ILE B . B 2 70 GLU 70 70 GLU GLU B . B 2 71 ILE 71 71 ILE ILE B . B 2 72 PRO 72 72 PRO PRO B . B 2 73 ALA 73 73 ALA ALA B . B 2 74 SER 74 74 SER SER B . B 2 75 LYS 75 75 LYS LYS B . B 2 76 VAL 76 76 VAL VAL B . B 2 77 PRO 77 77 PRO PRO B . B 2 78 ALA 78 78 ALA ALA B . B 2 79 PHE 79 79 PHE PHE B . B 2 80 LYS 80 80 LYS LYS B . B 2 81 PRO 81 81 PRO PRO B . B 2 82 GLY 82 82 GLY GLY B . B 2 83 LYS 83 83 LYS LYS B . B 2 84 ALA 84 84 ALA ALA B . B 2 85 LEU 85 85 LEU LEU B . B 2 86 LYS 86 86 LYS LYS B . B 2 87 ASP 87 87 ASP ASP B . B 2 88 ALA 88 88 ALA ALA B . B 2 89 VAL 89 89 VAL VAL B . B 2 90 ALA 90 90 ALA ALA B . B 2 91 GLY 91 91 GLY GLY B . B 2 92 LYS 92 92 LYS LYS B . # # loop_ # #