data_9A4I # _entry.id 9A4I # loop_ _atom_type.symbol C H N O S # loop_ _audit_author.name _audit_author.pdbx_ordinal "Stahl, K." 1 "Brock, O." 2 "Rappsilber, J." 3 # loop_ _audit_conform.dict_location _audit_conform.dict_name _audit_conform.dict_version https://mmcif.wwpdb.org/dictionaries/ascii/mmcif_ihm_ext.dic mmcif_ihm_ext.dic 1.26 http://mmcif.wwpdb.org/dictionaries/ascii/mmcif_pdbx_v50.dic mmcif_pdbx.dic 5.395 # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 9A4I _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2024-01-22 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2024-09-18 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 9A4I pdb_00009a4i 10.2210/pdb9a4i/pdb PDB-Dev PDBDEV_00000239 PDBDEV_00000239 ? # _ihm_entry_collection.id PDBDEV_G_1000003 _ihm_entry_collection.name . _ihm_entry_collection.details 'Collection of entries belonging to the publication: "Modelling protein complexes with crosslinking mass spectrometry and deep learning"' # _ihm_entry_collection_mapping.collection_id PDBDEV_G_1000003 _ihm_entry_collection_mapping.entry_id 9A4I # loop_ _chem_comp.formula _chem_comp.formula_weight _chem_comp.id _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.type "C3 H7 N O2" 89.094 ALA . ALANINE . "L-peptide linking" "C6 H15 N4 O2 1" 175.212 ARG . ARGININE . "L-peptide linking" "C4 H8 N2 O3" 132.119 ASN . ASPARAGINE . "L-peptide linking" "C4 H7 N O4" 133.103 ASP . "ASPARTIC ACID" . "L-peptide linking" "C5 H10 N2 O3" 146.146 GLN . GLUTAMINE . "L-peptide linking" "C5 H9 N O4" 147.13 GLU . "GLUTAMIC ACID" . "L-peptide linking" "C2 H5 N O2" 75.067 GLY . GLYCINE . "peptide linking" "C6 H10 N3 O2 1" 156.165 HIS . HISTIDINE . "L-peptide linking" "C6 H13 N O2" 131.175 ILE . ISOLEUCINE . "L-peptide linking" "C6 H13 N O2" 131.175 LEU . LEUCINE . "L-peptide linking" "C6 H15 N2 O2 1" 147.198 LYS . LYSINE . "L-peptide linking" "C5 H11 N O2 S" 149.208 MET . METHIONINE . "L-peptide linking" "C9 H11 N O2" 165.192 PHE . PHENYLALANINE . "L-peptide linking" "C5 H9 N O2" 115.132 PRO . PROLINE . "L-peptide linking" "C3 H7 N O3" 105.093 SER . SERINE . "L-peptide linking" "C4 H9 N O3" 119.12 THR . THREONINE . "L-peptide linking" "C9 H11 N O3" 181.191 TYR . TYROSINE . "L-peptide linking" "C5 H11 N O2" 117.148 VAL . VALINE . "L-peptide linking" # _citation.country . _citation.id 1 _citation.journal_abbrev "Nat. Commun." _citation.journal_id_ASTM . _citation.journal_id_CSD . _citation.journal_id_ISSN . _citation.journal_issue . _citation.journal_volume 15 _citation.page_first 7866 _citation.page_last . _citation.pdbx_database_id_DOI 10.1038/s41467-024-51771-2 _citation.pdbx_database_id_PubMed 39251624 _citation.title "Modelling protein complexes with crosslinking mass spectrometry and deep learning" _citation.year 2024 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal 1 "Stahl, K." 1 1 "Warneke, R." 2 1 "Demann, L." 3 1 "Bremenkamp, R." 4 1 "Hormes, B." 5 1 "Brock, O." 6 1 "Stulke, J." 7 1 "Rappsilber, J." 8 # loop_ _entity.details _entity.formula_weight _entity.id _entity.pdbx_description _entity.pdbx_number_of_molecules _entity.src_method _entity.type . 16589.309 1 ATPE_BACSU 1 MAN POLYMER . 22278.988 2 ATPF_BACSU 1 MAN POLYMER # loop_ _entity_poly.entity_id _entity_poly.nstd_chirality _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_sequence_evidence_code _entity_poly.pdbx_strand_id _entity_poly.type 1 . NO NO MKTVKVNIVTPDGPVYDADIEMVSVRAESGDLGILPGHIPTVAPLKIGAVRLKKDGQTEMVAVSGGFVEVRPDHVTILAQAAETAEGIDKERAEAARQRAQERLNSQSDDTDIRRAELALQRALNRLDVAGK MKTVKVNIVTPDGPVYDADIEMVSVRAESGDLGILPGHIPTVAPLKIGAVRLKKDGQTEMVAVSGGFVEVRPDHVTILAQAAETAEGIDKERAEAARQRAQERLNSQSDDTDIRRAELALQRALNRLDVAGK . A polypeptide(L) 2 . NO NO MSQLPLELGLSFNGGDILFQLLAMLILLALLKKYALGPLLNIMKQREDHIAGEITSAEEKNKEAQQLIEEQRVLLKEARQESQTLIENAKKLGEKQKEEIIQAARAESERLKEAARTEIVKEKEQAVSALREQVASLSVMIASKVIEKELDEQAQEKLIQDYLKEVGESR MSQLPLELGLSFNGGDILFQLLAMLILLALLKKYALGPLLNIMKQREDHIAGEITSAEEKNKEAQQLIEEQRVLLKEARQESQTLIENAKKLGEKQKEEIIQAARAESERLKEAARTEIVKEKEQAVSALREQVASLSVMIASKVIEKELDEQAQEKLIQDYLKEVGESR . B polypeptide(L) # loop_ _entity_poly_seq.entity_id _entity_poly_seq.hetero _entity_poly_seq.mon_id _entity_poly_seq.num 1 . MET 1 1 . LYS 2 1 . THR 3 1 . VAL 4 1 . LYS 5 1 . VAL 6 1 . ASN 7 1 . ILE 8 1 . VAL 9 1 . THR 10 1 . PRO 11 1 . ASP 12 1 . GLY 13 1 . PRO 14 1 . VAL 15 1 . TYR 16 1 . ASP 17 1 . ALA 18 1 . ASP 19 1 . ILE 20 1 . GLU 21 1 . MET 22 1 . VAL 23 1 . SER 24 1 . VAL 25 1 . ARG 26 1 . ALA 27 1 . GLU 28 1 . SER 29 1 . GLY 30 1 . ASP 31 1 . LEU 32 1 . GLY 33 1 . ILE 34 1 . LEU 35 1 . PRO 36 1 . GLY 37 1 . HIS 38 1 . ILE 39 1 . PRO 40 1 . THR 41 1 . VAL 42 1 . ALA 43 1 . PRO 44 1 . LEU 45 1 . LYS 46 1 . ILE 47 1 . GLY 48 1 . ALA 49 1 . VAL 50 1 . ARG 51 1 . LEU 52 1 . LYS 53 1 . LYS 54 1 . ASP 55 1 . GLY 56 1 . GLN 57 1 . THR 58 1 . GLU 59 1 . MET 60 1 . VAL 61 1 . ALA 62 1 . VAL 63 1 . SER 64 1 . GLY 65 1 . GLY 66 1 . PHE 67 1 . VAL 68 1 . GLU 69 1 . VAL 70 1 . ARG 71 1 . PRO 72 1 . ASP 73 1 . HIS 74 1 . VAL 75 1 . THR 76 1 . ILE 77 1 . LEU 78 1 . ALA 79 1 . GLN 80 1 . ALA 81 1 . ALA 82 1 . GLU 83 1 . THR 84 1 . ALA 85 1 . GLU 86 1 . GLY 87 1 . ILE 88 1 . ASP 89 1 . LYS 90 1 . GLU 91 1 . ARG 92 1 . ALA 93 1 . GLU 94 1 . ALA 95 1 . ALA 96 1 . ARG 97 1 . GLN 98 1 . ARG 99 1 . ALA 100 1 . GLN 101 1 . GLU 102 1 . ARG 103 1 . LEU 104 1 . ASN 105 1 . SER 106 1 . GLN 107 1 . SER 108 1 . ASP 109 1 . ASP 110 1 . THR 111 1 . ASP 112 1 . ILE 113 1 . ARG 114 1 . ARG 115 1 . ALA 116 1 . GLU 117 1 . LEU 118 1 . ALA 119 1 . LEU 120 1 . GLN 121 1 . ARG 122 1 . ALA 123 1 . LEU 124 1 . ASN 125 1 . ARG 126 1 . LEU 127 1 . ASP 128 1 . VAL 129 1 . ALA 130 1 . GLY 131 1 . LYS 132 2 . MET 1 2 . SER 2 2 . GLN 3 2 . LEU 4 2 . PRO 5 2 . LEU 6 2 . GLU 7 2 . LEU 8 2 . GLY 9 2 . LEU 10 2 . SER 11 2 . PHE 12 2 . ASN 13 2 . GLY 14 2 . GLY 15 2 . ASP 16 2 . ILE 17 2 . LEU 18 2 . PHE 19 2 . GLN 20 2 . LEU 21 2 . LEU 22 2 . ALA 23 2 . MET 24 2 . LEU 25 2 . ILE 26 2 . LEU 27 2 . LEU 28 2 . ALA 29 2 . LEU 30 2 . LEU 31 2 . LYS 32 2 . LYS 33 2 . TYR 34 2 . ALA 35 2 . LEU 36 2 . GLY 37 2 . PRO 38 2 . LEU 39 2 . LEU 40 2 . ASN 41 2 . ILE 42 2 . MET 43 2 . LYS 44 2 . GLN 45 2 . ARG 46 2 . GLU 47 2 . ASP 48 2 . HIS 49 2 . ILE 50 2 . ALA 51 2 . GLY 52 2 . GLU 53 2 . ILE 54 2 . THR 55 2 . SER 56 2 . ALA 57 2 . GLU 58 2 . GLU 59 2 . LYS 60 2 . ASN 61 2 . LYS 62 2 . GLU 63 2 . ALA 64 2 . GLN 65 2 . GLN 66 2 . LEU 67 2 . ILE 68 2 . GLU 69 2 . GLU 70 2 . GLN 71 2 . ARG 72 2 . VAL 73 2 . LEU 74 2 . LEU 75 2 . LYS 76 2 . GLU 77 2 . ALA 78 2 . ARG 79 2 . GLN 80 2 . GLU 81 2 . SER 82 2 . GLN 83 2 . THR 84 2 . LEU 85 2 . ILE 86 2 . GLU 87 2 . ASN 88 2 . ALA 89 2 . LYS 90 2 . LYS 91 2 . LEU 92 2 . GLY 93 2 . GLU 94 2 . LYS 95 2 . GLN 96 2 . LYS 97 2 . GLU 98 2 . GLU 99 2 . ILE 100 2 . ILE 101 2 . GLN 102 2 . ALA 103 2 . ALA 104 2 . ARG 105 2 . ALA 106 2 . GLU 107 2 . SER 108 2 . GLU 109 2 . ARG 110 2 . LEU 111 2 . LYS 112 2 . GLU 113 2 . ALA 114 2 . ALA 115 2 . ARG 116 2 . THR 117 2 . GLU 118 2 . ILE 119 2 . VAL 120 2 . LYS 121 2 . GLU 122 2 . LYS 123 2 . GLU 124 2 . GLN 125 2 . ALA 126 2 . VAL 127 2 . SER 128 2 . ALA 129 2 . LEU 130 2 . ARG 131 2 . GLU 132 2 . GLN 133 2 . VAL 134 2 . ALA 135 2 . SER 136 2 . LEU 137 2 . SER 138 2 . VAL 139 2 . MET 140 2 . ILE 141 2 . ALA 142 2 . SER 143 2 . LYS 144 2 . VAL 145 2 . ILE 146 2 . GLU 147 2 . LYS 148 2 . GLU 149 2 . LEU 150 2 . ASP 151 2 . GLU 152 2 . GLN 153 2 . ALA 154 2 . GLN 155 2 . GLU 156 2 . LYS 157 2 . LEU 158 2 . ILE 159 2 . GLN 160 2 . ASP 161 2 . TYR 162 2 . LEU 163 2 . LYS 164 2 . GLU 165 2 . VAL 166 2 . GLY 167 2 . GLU 168 2 . SER 169 2 . ARG 170 # _ihm_chemical_component_descriptor.auth_name SDA _ihm_chemical_component_descriptor.chemical_name "succinimidyl 4,4'-azipentanoate" _ihm_chemical_component_descriptor.common_name . _ihm_chemical_component_descriptor.details . _ihm_chemical_component_descriptor.id 1 _ihm_chemical_component_descriptor.inchi 1S/C9H11N3O4/c1-9(10-11-9)5-4-8(15)16-12-6(13)2-3-7(12)14/h2-5H2,1H3 _ihm_chemical_component_descriptor.inchi_key " SYYLQNPWAPHRFV-UHFFFAOYSA-N" _ihm_chemical_component_descriptor.smiles CC1(N=N1)CCC(ON2C(CCC2=O)=O)=O _ihm_chemical_component_descriptor.smiles_canonical . # _ihm_cross_link_list.comp_id_1 LYS _ihm_cross_link_list.comp_id_2 LYS _ihm_cross_link_list.dataset_list_id 1 _ihm_cross_link_list.details . _ihm_cross_link_list.entity_description_1 ATPE_BACSU _ihm_cross_link_list.entity_description_2 ATPF_BACSU _ihm_cross_link_list.entity_id_1 1 _ihm_cross_link_list.entity_id_2 2 _ihm_cross_link_list.group_id 1 _ihm_cross_link_list.id 1 _ihm_cross_link_list.linker_chem_comp_descriptor_id 1 _ihm_cross_link_list.linker_type SDA _ihm_cross_link_list.seq_id_1 132 _ihm_cross_link_list.seq_id_2 60 # _ihm_cross_link_restraint.asym_id_1 A _ihm_cross_link_restraint.asym_id_2 B _ihm_cross_link_restraint.atom_id_1 . _ihm_cross_link_restraint.atom_id_2 . _ihm_cross_link_restraint.comp_id_1 LYS _ihm_cross_link_restraint.comp_id_2 LYS _ihm_cross_link_restraint.conditional_crosslink_flag . _ihm_cross_link_restraint.distance_threshold 25 _ihm_cross_link_restraint.entity_id_1 1 _ihm_cross_link_restraint.entity_id_2 2 _ihm_cross_link_restraint.group_id 1 _ihm_cross_link_restraint.id 1 _ihm_cross_link_restraint.model_granularity by-residue _ihm_cross_link_restraint.pseudo_site_flag NO _ihm_cross_link_restraint.psi 0.95 _ihm_cross_link_restraint.restraint_type "upper bound" _ihm_cross_link_restraint.seq_id_1 132 _ihm_cross_link_restraint.seq_id_2 60 _ihm_cross_link_restraint.sigma_1 . _ihm_cross_link_restraint.sigma_2 . # _ihm_dataset_group.application . _ihm_dataset_group.details . _ihm_dataset_group.id 1 _ihm_dataset_group.name . # _ihm_dataset_group_link.dataset_list_id 1 _ihm_dataset_group_link.group_id 1 # _ihm_dataset_list.data_type "Crosslinking-MS data" _ihm_dataset_list.database_hosted YES _ihm_dataset_list.details . _ihm_dataset_list.id 1 # _ihm_dataset_related_db_reference.accession_code PXD035508 _ihm_dataset_related_db_reference.dataset_list_id 1 _ihm_dataset_related_db_reference.db_name PRIDE _ihm_dataset_related_db_reference.details . _ihm_dataset_related_db_reference.id 1 _ihm_dataset_related_db_reference.version . # loop_ _ihm_entity_poly_segment.comp_id_begin _ihm_entity_poly_segment.comp_id_end _ihm_entity_poly_segment.entity_id _ihm_entity_poly_segment.id _ihm_entity_poly_segment.seq_id_begin _ihm_entity_poly_segment.seq_id_end MET LYS 1 1 1 132 MET ARG 2 2 1 170 # _ihm_model_group.details . _ihm_model_group.id 1 _ihm_model_group.name . # _ihm_model_group_link.group_id 1 _ihm_model_group_link.model_id 1 # _ihm_model_list.assembly_id 1 _ihm_model_list.model_id 1 _ihm_model_list.model_name . _ihm_model_list.protocol_id 1 _ihm_model_list.representation_id 1 # _ihm_model_representation.details . _ihm_model_representation.id 1 _ihm_model_representation.name . # loop_ _ihm_model_representation_details.description _ihm_model_representation_details.entity_asym_id _ihm_model_representation_details.entity_description _ihm_model_representation_details.entity_id _ihm_model_representation_details.entity_poly_segment_id _ihm_model_representation_details.id _ihm_model_representation_details.model_granularity _ihm_model_representation_details.model_mode _ihm_model_representation_details.model_object_count _ihm_model_representation_details.model_object_primitive _ihm_model_representation_details.representation_id _ihm_model_representation_details.starting_model_id . A ATPE_BACSU 1 1 1 by-atom flexible . atomistic 1 . . B ATPF_BACSU 2 2 2 by-atom flexible . atomistic 1 . # _ihm_modeling_protocol.details . _ihm_modeling_protocol.id 1 _ihm_modeling_protocol.num_steps 1 _ihm_modeling_protocol.protocol_name AlphaLink2 # _ihm_modeling_protocol_details.dataset_group_id 1 _ihm_modeling_protocol_details.description . _ihm_modeling_protocol_details.ensemble_flag NO _ihm_modeling_protocol_details.id 1 _ihm_modeling_protocol_details.multi_scale_flag NO _ihm_modeling_protocol_details.multi_state_flag NO _ihm_modeling_protocol_details.num_models_begin 0 _ihm_modeling_protocol_details.num_models_end 1 _ihm_modeling_protocol_details.ordered_flag NO _ihm_modeling_protocol_details.protocol_id 1 _ihm_modeling_protocol_details.script_file_id . _ihm_modeling_protocol_details.software_id 1 _ihm_modeling_protocol_details.step_id 1 _ihm_modeling_protocol_details.step_method AlphaLink2 _ihm_modeling_protocol_details.step_name AlphaLink2 _ihm_modeling_protocol_details.struct_assembly_description . _ihm_modeling_protocol_details.struct_assembly_id 1 # _ihm_struct_assembly.description "Integrative model of ATPE-ATPF by crosslinking MS and deep learning" _ihm_struct_assembly.id 1 _ihm_struct_assembly.name ATPE-ATPF # loop_ _ihm_struct_assembly_details.assembly_id _ihm_struct_assembly_details.asym_id _ihm_struct_assembly_details.entity_description _ihm_struct_assembly_details.entity_id _ihm_struct_assembly_details.entity_poly_segment_id _ihm_struct_assembly_details.id _ihm_struct_assembly_details.parent_assembly_id 1 A ATPE_BACSU 1 1 1 1 1 B ATPF_BACSU 2 2 2 1 # _software.citation_id 1 _software.classification "model building" _software.description "Modelling protein complexes with crosslinking mass spectrometry and deep learning" _software.location https://github.com/Rappsilber-Laboratory/AlphaLink2 _software.name AlphaLink2 _software.pdbx_ordinal 1 _software.type program _software.version 1.0 # _struct.entry_id 9A4I _struct.pdbx_CASP_flag . _struct.pdbx_descriptor . _struct.pdbx_details . _struct.pdbx_model_details . _struct.pdbx_model_type_details . _struct.pdbx_structure_determination_methodology integrative _struct.title "Integrative model of ATPE-ATPF by crosslinking MS and deep learning" # loop_ _struct_asym.details _struct_asym.entity_id _struct_asym.id _struct_asym.pdbx_PDB_id _struct_asym.pdbx_alt_id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.pdbx_order _struct_asym.pdbx_type ATPE_BACSU 1 A . . . . . . ATPF_BACSU 2 B . . . . . . # loop_ _struct_ref.db_code _struct_ref.db_name _struct_ref.details _struct_ref.entity_id _struct_ref.id _struct_ref.pdbx_align_begin _struct_ref.pdbx_align_end _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.pdbx_seq_one_letter_code A UNP . 1 1 1 . P37812 . MKTVKVNIVTPDGPVYDADIEMVSVRAESGDLGILPGHIPTVAPLKIGAVRLKKDGQTEMVAVSGGFVEVRPDHVTILAQAAETAEGIDKERAEAARQRAQERLNSQSDDTDIRRAELALQRALNRLDVAGK B UNP . 2 2 1 . P37814 . MSQLPLELGLSFNGGDILFQLLAMLILLALLKKYALGPLLNIMKQREDHIAGEITSAEEKNKEAQQLIEEQRVLLKEARQESQTLIENAKKLGEKQKEEIIQAARAESERLKEAARTEIVKEKEQAVSALREQVASLSVMIASKVIEKELDEQAQEKLIQDYLKEVGESR # loop_ _struct_ref_seq.align_id _struct_ref_seq.db_align_beg _struct_ref_seq.db_align_end _struct_ref_seq.ref_id _struct_ref_seq.seq_align_beg _struct_ref_seq.seq_align_end 1 1 132 1 1 132 2 1 170 2 1 170 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code A 1 1 MET 1 1 MET MET A . A 1 2 LYS 2 2 LYS LYS A . A 1 3 THR 3 3 THR THR A . A 1 4 VAL 4 4 VAL VAL A . A 1 5 LYS 5 5 LYS LYS A . A 1 6 VAL 6 6 VAL VAL A . A 1 7 ASN 7 7 ASN ASN A . A 1 8 ILE 8 8 ILE ILE A . A 1 9 VAL 9 9 VAL VAL A . A 1 10 THR 10 10 THR THR A . A 1 11 PRO 11 11 PRO PRO A . A 1 12 ASP 12 12 ASP ASP A . A 1 13 GLY 13 13 GLY GLY A . A 1 14 PRO 14 14 PRO PRO A . A 1 15 VAL 15 15 VAL VAL A . A 1 16 TYR 16 16 TYR TYR A . A 1 17 ASP 17 17 ASP ASP A . A 1 18 ALA 18 18 ALA ALA A . A 1 19 ASP 19 19 ASP ASP A . A 1 20 ILE 20 20 ILE ILE A . A 1 21 GLU 21 21 GLU GLU A . A 1 22 MET 22 22 MET MET A . A 1 23 VAL 23 23 VAL VAL A . A 1 24 SER 24 24 SER SER A . A 1 25 VAL 25 25 VAL VAL A . A 1 26 ARG 26 26 ARG ARG A . A 1 27 ALA 27 27 ALA ALA A . A 1 28 GLU 28 28 GLU GLU A . A 1 29 SER 29 29 SER SER A . A 1 30 GLY 30 30 GLY GLY A . A 1 31 ASP 31 31 ASP ASP A . A 1 32 LEU 32 32 LEU LEU A . A 1 33 GLY 33 33 GLY GLY A . A 1 34 ILE 34 34 ILE ILE A . A 1 35 LEU 35 35 LEU LEU A . A 1 36 PRO 36 36 PRO PRO A . A 1 37 GLY 37 37 GLY GLY A . A 1 38 HIS 38 38 HIS HIS A . A 1 39 ILE 39 39 ILE ILE A . A 1 40 PRO 40 40 PRO PRO A . A 1 41 THR 41 41 THR THR A . A 1 42 VAL 42 42 VAL VAL A . A 1 43 ALA 43 43 ALA ALA A . A 1 44 PRO 44 44 PRO PRO A . A 1 45 LEU 45 45 LEU LEU A . A 1 46 LYS 46 46 LYS LYS A . A 1 47 ILE 47 47 ILE ILE A . A 1 48 GLY 48 48 GLY GLY A . A 1 49 ALA 49 49 ALA ALA A . A 1 50 VAL 50 50 VAL VAL A . A 1 51 ARG 51 51 ARG ARG A . A 1 52 LEU 52 52 LEU LEU A . A 1 53 LYS 53 53 LYS LYS A . A 1 54 LYS 54 54 LYS LYS A . A 1 55 ASP 55 55 ASP ASP A . A 1 56 GLY 56 56 GLY GLY A . A 1 57 GLN 57 57 GLN GLN A . A 1 58 THR 58 58 THR THR A . A 1 59 GLU 59 59 GLU GLU A . A 1 60 MET 60 60 MET MET A . A 1 61 VAL 61 61 VAL VAL A . A 1 62 ALA 62 62 ALA ALA A . A 1 63 VAL 63 63 VAL VAL A . A 1 64 SER 64 64 SER SER A . A 1 65 GLY 65 65 GLY GLY A . A 1 66 GLY 66 66 GLY GLY A . A 1 67 PHE 67 67 PHE PHE A . A 1 68 VAL 68 68 VAL VAL A . A 1 69 GLU 69 69 GLU GLU A . A 1 70 VAL 70 70 VAL VAL A . A 1 71 ARG 71 71 ARG ARG A . A 1 72 PRO 72 72 PRO PRO A . A 1 73 ASP 73 73 ASP ASP A . A 1 74 HIS 74 74 HIS HIS A . A 1 75 VAL 75 75 VAL VAL A . A 1 76 THR 76 76 THR THR A . A 1 77 ILE 77 77 ILE ILE A . A 1 78 LEU 78 78 LEU LEU A . A 1 79 ALA 79 79 ALA ALA A . A 1 80 GLN 80 80 GLN GLN A . A 1 81 ALA 81 81 ALA ALA A . A 1 82 ALA 82 82 ALA ALA A . A 1 83 GLU 83 83 GLU GLU A . A 1 84 THR 84 84 THR THR A . A 1 85 ALA 85 85 ALA ALA A . A 1 86 GLU 86 86 GLU GLU A . A 1 87 GLY 87 87 GLY GLY A . A 1 88 ILE 88 88 ILE ILE A . A 1 89 ASP 89 89 ASP ASP A . A 1 90 LYS 90 90 LYS LYS A . A 1 91 GLU 91 91 GLU GLU A . A 1 92 ARG 92 92 ARG ARG A . A 1 93 ALA 93 93 ALA ALA A . A 1 94 GLU 94 94 GLU GLU A . A 1 95 ALA 95 95 ALA ALA A . A 1 96 ALA 96 96 ALA ALA A . A 1 97 ARG 97 97 ARG ARG A . A 1 98 GLN 98 98 GLN GLN A . A 1 99 ARG 99 99 ARG ARG A . A 1 100 ALA 100 100 ALA ALA A . A 1 101 GLN 101 101 GLN GLN A . A 1 102 GLU 102 102 GLU GLU A . A 1 103 ARG 103 103 ARG ARG A . A 1 104 LEU 104 104 LEU LEU A . A 1 105 ASN 105 105 ASN ASN A . A 1 106 SER 106 106 SER SER A . A 1 107 GLN 107 107 GLN GLN A . A 1 108 SER 108 108 SER SER A . A 1 109 ASP 109 109 ASP ASP A . A 1 110 ASP 110 110 ASP ASP A . A 1 111 THR 111 111 THR THR A . A 1 112 ASP 112 112 ASP ASP A . A 1 113 ILE 113 113 ILE ILE A . A 1 114 ARG 114 114 ARG ARG A . A 1 115 ARG 115 115 ARG ARG A . A 1 116 ALA 116 116 ALA ALA A . A 1 117 GLU 117 117 GLU GLU A . A 1 118 LEU 118 118 LEU LEU A . A 1 119 ALA 119 119 ALA ALA A . A 1 120 LEU 120 120 LEU LEU A . A 1 121 GLN 121 121 GLN GLN A . A 1 122 ARG 122 122 ARG ARG A . A 1 123 ALA 123 123 ALA ALA A . A 1 124 LEU 124 124 LEU LEU A . A 1 125 ASN 125 125 ASN ASN A . A 1 126 ARG 126 126 ARG ARG A . A 1 127 LEU 127 127 LEU LEU A . A 1 128 ASP 128 128 ASP ASP A . A 1 129 VAL 129 129 VAL VAL A . A 1 130 ALA 130 130 ALA ALA A . A 1 131 GLY 131 131 GLY GLY A . A 1 132 LYS 132 132 LYS LYS A . B 2 1 MET 1 1 MET MET B . B 2 2 SER 2 2 SER SER B . B 2 3 GLN 3 3 GLN GLN B . B 2 4 LEU 4 4 LEU LEU B . B 2 5 PRO 5 5 PRO PRO B . B 2 6 LEU 6 6 LEU LEU B . B 2 7 GLU 7 7 GLU GLU B . B 2 8 LEU 8 8 LEU LEU B . B 2 9 GLY 9 9 GLY GLY B . B 2 10 LEU 10 10 LEU LEU B . B 2 11 SER 11 11 SER SER B . B 2 12 PHE 12 12 PHE PHE B . B 2 13 ASN 13 13 ASN ASN B . B 2 14 GLY 14 14 GLY GLY B . B 2 15 GLY 15 15 GLY GLY B . B 2 16 ASP 16 16 ASP ASP B . B 2 17 ILE 17 17 ILE ILE B . B 2 18 LEU 18 18 LEU LEU B . B 2 19 PHE 19 19 PHE PHE B . B 2 20 GLN 20 20 GLN GLN B . B 2 21 LEU 21 21 LEU LEU B . B 2 22 LEU 22 22 LEU LEU B . B 2 23 ALA 23 23 ALA ALA B . B 2 24 MET 24 24 MET MET B . B 2 25 LEU 25 25 LEU LEU B . B 2 26 ILE 26 26 ILE ILE B . B 2 27 LEU 27 27 LEU LEU B . B 2 28 LEU 28 28 LEU LEU B . B 2 29 ALA 29 29 ALA ALA B . B 2 30 LEU 30 30 LEU LEU B . B 2 31 LEU 31 31 LEU LEU B . B 2 32 LYS 32 32 LYS LYS B . B 2 33 LYS 33 33 LYS LYS B . B 2 34 TYR 34 34 TYR TYR B . B 2 35 ALA 35 35 ALA ALA B . B 2 36 LEU 36 36 LEU LEU B . B 2 37 GLY 37 37 GLY GLY B . B 2 38 PRO 38 38 PRO PRO B . B 2 39 LEU 39 39 LEU LEU B . B 2 40 LEU 40 40 LEU LEU B . B 2 41 ASN 41 41 ASN ASN B . B 2 42 ILE 42 42 ILE ILE B . B 2 43 MET 43 43 MET MET B . B 2 44 LYS 44 44 LYS LYS B . B 2 45 GLN 45 45 GLN GLN B . B 2 46 ARG 46 46 ARG ARG B . B 2 47 GLU 47 47 GLU GLU B . B 2 48 ASP 48 48 ASP ASP B . B 2 49 HIS 49 49 HIS HIS B . B 2 50 ILE 50 50 ILE ILE B . B 2 51 ALA 51 51 ALA ALA B . B 2 52 GLY 52 52 GLY GLY B . B 2 53 GLU 53 53 GLU GLU B . B 2 54 ILE 54 54 ILE ILE B . B 2 55 THR 55 55 THR THR B . B 2 56 SER 56 56 SER SER B . B 2 57 ALA 57 57 ALA ALA B . B 2 58 GLU 58 58 GLU GLU B . B 2 59 GLU 59 59 GLU GLU B . B 2 60 LYS 60 60 LYS LYS B . B 2 61 ASN 61 61 ASN ASN B . B 2 62 LYS 62 62 LYS LYS B . B 2 63 GLU 63 63 GLU GLU B . B 2 64 ALA 64 64 ALA ALA B . B 2 65 GLN 65 65 GLN GLN B . B 2 66 GLN 66 66 GLN GLN B . B 2 67 LEU 67 67 LEU LEU B . B 2 68 ILE 68 68 ILE ILE B . B 2 69 GLU 69 69 GLU GLU B . B 2 70 GLU 70 70 GLU GLU B . B 2 71 GLN 71 71 GLN GLN B . B 2 72 ARG 72 72 ARG ARG B . B 2 73 VAL 73 73 VAL VAL B . B 2 74 LEU 74 74 LEU LEU B . B 2 75 LEU 75 75 LEU LEU B . B 2 76 LYS 76 76 LYS LYS B . B 2 77 GLU 77 77 GLU GLU B . B 2 78 ALA 78 78 ALA ALA B . B 2 79 ARG 79 79 ARG ARG B . B 2 80 GLN 80 80 GLN GLN B . B 2 81 GLU 81 81 GLU GLU B . B 2 82 SER 82 82 SER SER B . B 2 83 GLN 83 83 GLN GLN B . B 2 84 THR 84 84 THR THR B . B 2 85 LEU 85 85 LEU LEU B . B 2 86 ILE 86 86 ILE ILE B . B 2 87 GLU 87 87 GLU GLU B . B 2 88 ASN 88 88 ASN ASN B . B 2 89 ALA 89 89 ALA ALA B . B 2 90 LYS 90 90 LYS LYS B . B 2 91 LYS 91 91 LYS LYS B . B 2 92 LEU 92 92 LEU LEU B . B 2 93 GLY 93 93 GLY GLY B . B 2 94 GLU 94 94 GLU GLU B . B 2 95 LYS 95 95 LYS LYS B . B 2 96 GLN 96 96 GLN GLN B . B 2 97 LYS 97 97 LYS LYS B . B 2 98 GLU 98 98 GLU GLU B . B 2 99 GLU 99 99 GLU GLU B . B 2 100 ILE 100 100 ILE ILE B . B 2 101 ILE 101 101 ILE ILE B . B 2 102 GLN 102 102 GLN GLN B . B 2 103 ALA 103 103 ALA ALA B . B 2 104 ALA 104 104 ALA ALA B . B 2 105 ARG 105 105 ARG ARG B . B 2 106 ALA 106 106 ALA ALA B . B 2 107 GLU 107 107 GLU GLU B . B 2 108 SER 108 108 SER SER B . B 2 109 GLU 109 109 GLU GLU B . B 2 110 ARG 110 110 ARG ARG B . B 2 111 LEU 111 111 LEU LEU B . B 2 112 LYS 112 112 LYS LYS B . B 2 113 GLU 113 113 GLU GLU B . B 2 114 ALA 114 114 ALA ALA B . B 2 115 ALA 115 115 ALA ALA B . B 2 116 ARG 116 116 ARG ARG B . B 2 117 THR 117 117 THR THR B . B 2 118 GLU 118 118 GLU GLU B . B 2 119 ILE 119 119 ILE ILE B . B 2 120 VAL 120 120 VAL VAL B . B 2 121 LYS 121 121 LYS LYS B . B 2 122 GLU 122 122 GLU GLU B . B 2 123 LYS 123 123 LYS LYS B . B 2 124 GLU 124 124 GLU GLU B . B 2 125 GLN 125 125 GLN GLN B . B 2 126 ALA 126 126 ALA ALA B . B 2 127 VAL 127 127 VAL VAL B . B 2 128 SER 128 128 SER SER B . B 2 129 ALA 129 129 ALA ALA B . B 2 130 LEU 130 130 LEU LEU B . B 2 131 ARG 131 131 ARG ARG B . B 2 132 GLU 132 132 GLU GLU B . B 2 133 GLN 133 133 GLN GLN B . B 2 134 VAL 134 134 VAL VAL B . B 2 135 ALA 135 135 ALA ALA B . B 2 136 SER 136 136 SER SER B . B 2 137 LEU 137 137 LEU LEU B . B 2 138 SER 138 138 SER SER B . B 2 139 VAL 139 139 VAL VAL B . B 2 140 MET 140 140 MET MET B . B 2 141 ILE 141 141 ILE ILE B . B 2 142 ALA 142 142 ALA ALA B . B 2 143 SER 143 143 SER SER B . B 2 144 LYS 144 144 LYS LYS B . B 2 145 VAL 145 145 VAL VAL B . B 2 146 ILE 146 146 ILE ILE B . B 2 147 GLU 147 147 GLU GLU B . B 2 148 LYS 148 148 LYS LYS B . B 2 149 GLU 149 149 GLU GLU B . B 2 150 LEU 150 150 LEU LEU B . B 2 151 ASP 151 151 ASP ASP B . B 2 152 GLU 152 152 GLU GLU B . B 2 153 GLN 153 153 GLN GLN B . B 2 154 ALA 154 154 ALA ALA B . B 2 155 GLN 155 155 GLN GLN B . B 2 156 GLU 156 156 GLU GLU B . B 2 157 LYS 157 157 LYS LYS B . B 2 158 LEU 158 158 LEU LEU B . B 2 159 ILE 159 159 ILE ILE B . B 2 160 GLN 160 160 GLN GLN B . B 2 161 ASP 161 161 ASP ASP B . B 2 162 TYR 162 162 TYR TYR B . B 2 163 LEU 163 163 LEU LEU B . B 2 164 LYS 164 164 LYS LYS B . B 2 165 GLU 165 165 GLU GLU B . B 2 166 VAL 166 166 VAL VAL B . B 2 167 GLY 167 167 GLY GLY B . B 2 168 GLU 168 168 GLU GLU B . B 2 169 SER 169 169 SER SER B . B 2 170 ARG 170 170 ARG ARG B . # # loop_ # #