data_9A4S # _entry.id 9A4S # loop_ _atom_type.symbol C H N O S # loop_ _audit_author.name _audit_author.pdbx_ordinal "Stahl, K." 1 "Brock, O." 2 "Rappsilber, J." 3 # loop_ _audit_conform.dict_location _audit_conform.dict_name _audit_conform.dict_version https://mmcif.wwpdb.org/dictionaries/ascii/mmcif_ihm_ext.dic mmcif_ihm_ext.dic 1.26 http://mmcif.wwpdb.org/dictionaries/ascii/mmcif_pdbx_v50.dic mmcif_pdbx.dic 5.395 # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 9A4S _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2024-01-23 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2024-09-18 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 9A4S pdb_00009a4s 10.2210/pdb9a4s/pdb PDB-Dev PDBDEV_00000249 PDBDEV_00000249 ? # _ihm_entry_collection.id PDBDEV_G_1000003 _ihm_entry_collection.name . _ihm_entry_collection.details 'Collection of entries belonging to the publication: "Modelling protein complexes with crosslinking mass spectrometry and deep learning"' # _ihm_entry_collection_mapping.collection_id PDBDEV_G_1000003 _ihm_entry_collection_mapping.entry_id 9A4S # loop_ _chem_comp.formula _chem_comp.formula_weight _chem_comp.id _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.type "C3 H7 N O2" 89.094 ALA . ALANINE . "L-peptide linking" "C6 H15 N4 O2 1" 175.212 ARG . ARGININE . "L-peptide linking" "C4 H8 N2 O3" 132.119 ASN . ASPARAGINE . "L-peptide linking" "C4 H7 N O4" 133.103 ASP . "ASPARTIC ACID" . "L-peptide linking" "C3 H7 N O2 S" 121.154 CYS . CYSTEINE . "L-peptide linking" "C5 H10 N2 O3" 146.146 GLN . GLUTAMINE . "L-peptide linking" "C5 H9 N O4" 147.13 GLU . "GLUTAMIC ACID" . "L-peptide linking" "C2 H5 N O2" 75.067 GLY . GLYCINE . "peptide linking" "C6 H10 N3 O2 1" 156.165 HIS . HISTIDINE . "L-peptide linking" "C6 H13 N O2" 131.175 ILE . ISOLEUCINE . "L-peptide linking" "C6 H13 N O2" 131.175 LEU . LEUCINE . "L-peptide linking" "C6 H15 N2 O2 1" 147.198 LYS . LYSINE . "L-peptide linking" "C5 H11 N O2 S" 149.208 MET . METHIONINE . "L-peptide linking" "C9 H11 N O2" 165.192 PHE . PHENYLALANINE . "L-peptide linking" "C5 H9 N O2" 115.132 PRO . PROLINE . "L-peptide linking" "C3 H7 N O3" 105.093 SER . SERINE . "L-peptide linking" "C4 H9 N O3" 119.12 THR . THREONINE . "L-peptide linking" "C9 H11 N O3" 181.191 TYR . TYROSINE . "L-peptide linking" "C5 H11 N O2" 117.148 VAL . VALINE . "L-peptide linking" # _citation.country . _citation.id 1 _citation.journal_abbrev "Nat. Commun." _citation.journal_id_ASTM . _citation.journal_id_CSD . _citation.journal_id_ISSN . _citation.journal_issue . _citation.journal_volume 15 _citation.page_first 7866 _citation.page_last . _citation.pdbx_database_id_DOI 10.1038/s41467-024-51771-2 _citation.pdbx_database_id_PubMed 39251624 _citation.title "Modelling protein complexes with crosslinking mass spectrometry and deep learning" _citation.year 2024 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal 1 "Stahl, K." 1 1 "Warneke, R." 2 1 "Demann, L." 3 1 "Bremenkamp, R." 4 1 "Hormes, B." 5 1 "Brock, O." 6 1 "Stulke, J." 7 1 "Rappsilber, J." 8 # loop_ _entity.details _entity.formula_weight _entity.id _entity.pdbx_description _entity.pdbx_number_of_molecules _entity.src_method _entity.type . 10334.11 1 FER_BACSU 1 MAN POLYMER . 9763.861 2 YVFG_BACSU 1 MAN POLYMER # loop_ _entity_poly.entity_id _entity_poly.nstd_chirality _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_sequence_evidence_code _entity_poly.pdbx_strand_id _entity_poly.type 1 . NO NO MAKYTIVDKDTCIACGACGAAAPDIYDYDDEGIAFVTLDENKGVVEVPEVLEEDMIDAFEGCPTDSIKVADEPFEGDPLKFE MAKYTIVDKDTCIACGACGAAAPDIYDYDDEGIAFVTLDENKGVVEVPEVLEEDMIDAFEGCPTDSIKVADEPFEGDPLKFE . A polypeptide(L) 2 . NO NO MSELFSVPYFIENLKQHIEMNQSEDKIHAMNSYYRSVVSTLVQDQLTKNAVVLKRIQHLDEAYNKVKRGESK MSELFSVPYFIENLKQHIEMNQSEDKIHAMNSYYRSVVSTLVQDQLTKNAVVLKRIQHLDEAYNKVKRGESK . B polypeptide(L) # loop_ _entity_poly_seq.entity_id _entity_poly_seq.hetero _entity_poly_seq.mon_id _entity_poly_seq.num 1 . MET 1 1 . ALA 2 1 . LYS 3 1 . TYR 4 1 . THR 5 1 . ILE 6 1 . VAL 7 1 . ASP 8 1 . LYS 9 1 . ASP 10 1 . THR 11 1 . CYS 12 1 . ILE 13 1 . ALA 14 1 . CYS 15 1 . GLY 16 1 . ALA 17 1 . CYS 18 1 . GLY 19 1 . ALA 20 1 . ALA 21 1 . ALA 22 1 . PRO 23 1 . ASP 24 1 . ILE 25 1 . TYR 26 1 . ASP 27 1 . TYR 28 1 . ASP 29 1 . ASP 30 1 . GLU 31 1 . GLY 32 1 . ILE 33 1 . ALA 34 1 . PHE 35 1 . VAL 36 1 . THR 37 1 . LEU 38 1 . ASP 39 1 . GLU 40 1 . ASN 41 1 . LYS 42 1 . GLY 43 1 . VAL 44 1 . VAL 45 1 . GLU 46 1 . VAL 47 1 . PRO 48 1 . GLU 49 1 . VAL 50 1 . LEU 51 1 . GLU 52 1 . GLU 53 1 . ASP 54 1 . MET 55 1 . ILE 56 1 . ASP 57 1 . ALA 58 1 . PHE 59 1 . GLU 60 1 . GLY 61 1 . CYS 62 1 . PRO 63 1 . THR 64 1 . ASP 65 1 . SER 66 1 . ILE 67 1 . LYS 68 1 . VAL 69 1 . ALA 70 1 . ASP 71 1 . GLU 72 1 . PRO 73 1 . PHE 74 1 . GLU 75 1 . GLY 76 1 . ASP 77 1 . PRO 78 1 . LEU 79 1 . LYS 80 1 . PHE 81 1 . GLU 82 2 . MET 1 2 . SER 2 2 . GLU 3 2 . LEU 4 2 . PHE 5 2 . SER 6 2 . VAL 7 2 . PRO 8 2 . TYR 9 2 . PHE 10 2 . ILE 11 2 . GLU 12 2 . ASN 13 2 . LEU 14 2 . LYS 15 2 . GLN 16 2 . HIS 17 2 . ILE 18 2 . GLU 19 2 . MET 20 2 . ASN 21 2 . GLN 22 2 . SER 23 2 . GLU 24 2 . ASP 25 2 . LYS 26 2 . ILE 27 2 . HIS 28 2 . ALA 29 2 . MET 30 2 . ASN 31 2 . SER 32 2 . TYR 33 2 . TYR 34 2 . ARG 35 2 . SER 36 2 . VAL 37 2 . VAL 38 2 . SER 39 2 . THR 40 2 . LEU 41 2 . VAL 42 2 . GLN 43 2 . ASP 44 2 . GLN 45 2 . LEU 46 2 . THR 47 2 . LYS 48 2 . ASN 49 2 . ALA 50 2 . VAL 51 2 . VAL 52 2 . LEU 53 2 . LYS 54 2 . ARG 55 2 . ILE 56 2 . GLN 57 2 . HIS 58 2 . LEU 59 2 . ASP 60 2 . GLU 61 2 . ALA 62 2 . TYR 63 2 . ASN 64 2 . LYS 65 2 . VAL 66 2 . LYS 67 2 . ARG 68 2 . GLY 69 2 . GLU 70 2 . SER 71 2 . LYS 72 # _ihm_chemical_component_descriptor.auth_name SDA _ihm_chemical_component_descriptor.chemical_name "succinimidyl 4,4'-azipentanoate" _ihm_chemical_component_descriptor.common_name . _ihm_chemical_component_descriptor.details . _ihm_chemical_component_descriptor.id 1 _ihm_chemical_component_descriptor.inchi 1S/C9H11N3O4/c1-9(10-11-9)5-4-8(15)16-12-6(13)2-3-7(12)14/h2-5H2,1H3 _ihm_chemical_component_descriptor.inchi_key " SYYLQNPWAPHRFV-UHFFFAOYSA-N" _ihm_chemical_component_descriptor.smiles CC1(N=N1)CCC(ON2C(CCC2=O)=O)=O _ihm_chemical_component_descriptor.smiles_canonical . # _ihm_cross_link_list.comp_id_1 LYS _ihm_cross_link_list.comp_id_2 LYS _ihm_cross_link_list.dataset_list_id 1 _ihm_cross_link_list.details . _ihm_cross_link_list.entity_description_1 FER_BACSU _ihm_cross_link_list.entity_description_2 YVFG_BACSU _ihm_cross_link_list.entity_id_1 1 _ihm_cross_link_list.entity_id_2 2 _ihm_cross_link_list.group_id 1 _ihm_cross_link_list.id 1 _ihm_cross_link_list.linker_chem_comp_descriptor_id 1 _ihm_cross_link_list.linker_type SDA _ihm_cross_link_list.seq_id_1 3 _ihm_cross_link_list.seq_id_2 54 # _ihm_cross_link_restraint.asym_id_1 A _ihm_cross_link_restraint.asym_id_2 B _ihm_cross_link_restraint.atom_id_1 . _ihm_cross_link_restraint.atom_id_2 . _ihm_cross_link_restraint.comp_id_1 LYS _ihm_cross_link_restraint.comp_id_2 LYS _ihm_cross_link_restraint.conditional_crosslink_flag . _ihm_cross_link_restraint.distance_threshold 25 _ihm_cross_link_restraint.entity_id_1 1 _ihm_cross_link_restraint.entity_id_2 2 _ihm_cross_link_restraint.group_id 1 _ihm_cross_link_restraint.id 1 _ihm_cross_link_restraint.model_granularity by-residue _ihm_cross_link_restraint.pseudo_site_flag NO _ihm_cross_link_restraint.psi 0.95 _ihm_cross_link_restraint.restraint_type "upper bound" _ihm_cross_link_restraint.seq_id_1 3 _ihm_cross_link_restraint.seq_id_2 54 _ihm_cross_link_restraint.sigma_1 . _ihm_cross_link_restraint.sigma_2 . # _ihm_dataset_group.application . _ihm_dataset_group.details . _ihm_dataset_group.id 1 _ihm_dataset_group.name . # _ihm_dataset_group_link.dataset_list_id 1 _ihm_dataset_group_link.group_id 1 # _ihm_dataset_list.data_type "Crosslinking-MS data" _ihm_dataset_list.database_hosted YES _ihm_dataset_list.details . _ihm_dataset_list.id 1 # _ihm_dataset_related_db_reference.accession_code PXD035508 _ihm_dataset_related_db_reference.dataset_list_id 1 _ihm_dataset_related_db_reference.db_name PRIDE _ihm_dataset_related_db_reference.details . _ihm_dataset_related_db_reference.id 1 _ihm_dataset_related_db_reference.version . # loop_ _ihm_entity_poly_segment.comp_id_begin _ihm_entity_poly_segment.comp_id_end _ihm_entity_poly_segment.entity_id _ihm_entity_poly_segment.id _ihm_entity_poly_segment.seq_id_begin _ihm_entity_poly_segment.seq_id_end MET GLU 1 1 1 82 MET LYS 2 2 1 72 # _ihm_model_group.details . _ihm_model_group.id 1 _ihm_model_group.name . # _ihm_model_group_link.group_id 1 _ihm_model_group_link.model_id 1 # _ihm_model_list.assembly_id 1 _ihm_model_list.model_id 1 _ihm_model_list.model_name . _ihm_model_list.protocol_id 1 _ihm_model_list.representation_id 1 # _ihm_model_representation.details . _ihm_model_representation.id 1 _ihm_model_representation.name . # loop_ _ihm_model_representation_details.description _ihm_model_representation_details.entity_asym_id _ihm_model_representation_details.entity_description _ihm_model_representation_details.entity_id _ihm_model_representation_details.entity_poly_segment_id _ihm_model_representation_details.id _ihm_model_representation_details.model_granularity _ihm_model_representation_details.model_mode _ihm_model_representation_details.model_object_count _ihm_model_representation_details.model_object_primitive _ihm_model_representation_details.representation_id _ihm_model_representation_details.starting_model_id . A FER_BACSU 1 1 1 by-atom flexible . atomistic 1 . . B YVFG_BACSU 2 2 2 by-atom flexible . atomistic 1 . # _ihm_modeling_protocol.details . _ihm_modeling_protocol.id 1 _ihm_modeling_protocol.num_steps 1 _ihm_modeling_protocol.protocol_name AlphaLink2 # _ihm_modeling_protocol_details.dataset_group_id 1 _ihm_modeling_protocol_details.description . _ihm_modeling_protocol_details.ensemble_flag NO _ihm_modeling_protocol_details.id 1 _ihm_modeling_protocol_details.multi_scale_flag NO _ihm_modeling_protocol_details.multi_state_flag NO _ihm_modeling_protocol_details.num_models_begin 0 _ihm_modeling_protocol_details.num_models_end 1 _ihm_modeling_protocol_details.ordered_flag NO _ihm_modeling_protocol_details.protocol_id 1 _ihm_modeling_protocol_details.script_file_id . _ihm_modeling_protocol_details.software_id 1 _ihm_modeling_protocol_details.step_id 1 _ihm_modeling_protocol_details.step_method AlphaLink2 _ihm_modeling_protocol_details.step_name AlphaLink2 _ihm_modeling_protocol_details.struct_assembly_description . _ihm_modeling_protocol_details.struct_assembly_id 1 # _ihm_struct_assembly.description "Integrative model of FER-YVFG by crosslinking MS and deep learning" _ihm_struct_assembly.id 1 _ihm_struct_assembly.name FER-YVFG # loop_ _ihm_struct_assembly_details.assembly_id _ihm_struct_assembly_details.asym_id _ihm_struct_assembly_details.entity_description _ihm_struct_assembly_details.entity_id _ihm_struct_assembly_details.entity_poly_segment_id _ihm_struct_assembly_details.id _ihm_struct_assembly_details.parent_assembly_id 1 A FER_BACSU 1 1 1 1 1 B YVFG_BACSU 2 2 2 1 # _software.citation_id 1 _software.classification "model building" _software.description "Modelling protein complexes with crosslinking mass spectrometry and deep learning" _software.location https://github.com/Rappsilber-Laboratory/AlphaLink2 _software.name AlphaLink2 _software.pdbx_ordinal 1 _software.type program _software.version 1.0 # _struct.entry_id 9A4S _struct.pdbx_CASP_flag . _struct.pdbx_descriptor . _struct.pdbx_details . _struct.pdbx_model_details . _struct.pdbx_model_type_details . _struct.pdbx_structure_determination_methodology integrative _struct.title "Integrative model of FER-YVFG by crosslinking MS and deep learning" # loop_ _struct_asym.details _struct_asym.entity_id _struct_asym.id _struct_asym.pdbx_PDB_id _struct_asym.pdbx_alt_id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.pdbx_order _struct_asym.pdbx_type FER_BACSU 1 A . . . . . . YVFG_BACSU 2 B . . . . . . # loop_ _struct_ref.db_code _struct_ref.db_name _struct_ref.details _struct_ref.entity_id _struct_ref.id _struct_ref.pdbx_align_begin _struct_ref.pdbx_align_end _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.pdbx_seq_one_letter_code A UNP . 1 1 1 . P50727 . MAKYTIVDKDTCIACGACGAAAPDIYDYDDEGIAFVTLDENKGVVEVPEVLEEDMIDAFEGCPTDSIKVADEPFEGDPLKFE B UNP . 2 2 1 . P71066 . MSELFSVPYFIENLKQHIEMNQSEDKIHAMNSYYRSVVSTLVQDQLTKNAVVLKRIQHLDEAYNKVKRGESK # loop_ _struct_ref_seq.align_id _struct_ref_seq.db_align_beg _struct_ref_seq.db_align_end _struct_ref_seq.ref_id _struct_ref_seq.seq_align_beg _struct_ref_seq.seq_align_end 1 1 82 1 1 82 2 1 72 2 1 72 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code A 1 1 MET 1 1 MET MET A . A 1 2 ALA 2 2 ALA ALA A . A 1 3 LYS 3 3 LYS LYS A . A 1 4 TYR 4 4 TYR TYR A . A 1 5 THR 5 5 THR THR A . A 1 6 ILE 6 6 ILE ILE A . A 1 7 VAL 7 7 VAL VAL A . A 1 8 ASP 8 8 ASP ASP A . A 1 9 LYS 9 9 LYS LYS A . A 1 10 ASP 10 10 ASP ASP A . A 1 11 THR 11 11 THR THR A . A 1 12 CYS 12 12 CYS CYS A . A 1 13 ILE 13 13 ILE ILE A . A 1 14 ALA 14 14 ALA ALA A . A 1 15 CYS 15 15 CYS CYS A . A 1 16 GLY 16 16 GLY GLY A . A 1 17 ALA 17 17 ALA ALA A . A 1 18 CYS 18 18 CYS CYS A . A 1 19 GLY 19 19 GLY GLY A . A 1 20 ALA 20 20 ALA ALA A . A 1 21 ALA 21 21 ALA ALA A . A 1 22 ALA 22 22 ALA ALA A . A 1 23 PRO 23 23 PRO PRO A . A 1 24 ASP 24 24 ASP ASP A . A 1 25 ILE 25 25 ILE ILE A . A 1 26 TYR 26 26 TYR TYR A . A 1 27 ASP 27 27 ASP ASP A . A 1 28 TYR 28 28 TYR TYR A . A 1 29 ASP 29 29 ASP ASP A . A 1 30 ASP 30 30 ASP ASP A . A 1 31 GLU 31 31 GLU GLU A . A 1 32 GLY 32 32 GLY GLY A . A 1 33 ILE 33 33 ILE ILE A . A 1 34 ALA 34 34 ALA ALA A . A 1 35 PHE 35 35 PHE PHE A . A 1 36 VAL 36 36 VAL VAL A . A 1 37 THR 37 37 THR THR A . A 1 38 LEU 38 38 LEU LEU A . A 1 39 ASP 39 39 ASP ASP A . A 1 40 GLU 40 40 GLU GLU A . A 1 41 ASN 41 41 ASN ASN A . A 1 42 LYS 42 42 LYS LYS A . A 1 43 GLY 43 43 GLY GLY A . A 1 44 VAL 44 44 VAL VAL A . A 1 45 VAL 45 45 VAL VAL A . A 1 46 GLU 46 46 GLU GLU A . A 1 47 VAL 47 47 VAL VAL A . A 1 48 PRO 48 48 PRO PRO A . A 1 49 GLU 49 49 GLU GLU A . A 1 50 VAL 50 50 VAL VAL A . A 1 51 LEU 51 51 LEU LEU A . A 1 52 GLU 52 52 GLU GLU A . A 1 53 GLU 53 53 GLU GLU A . A 1 54 ASP 54 54 ASP ASP A . A 1 55 MET 55 55 MET MET A . A 1 56 ILE 56 56 ILE ILE A . A 1 57 ASP 57 57 ASP ASP A . A 1 58 ALA 58 58 ALA ALA A . A 1 59 PHE 59 59 PHE PHE A . A 1 60 GLU 60 60 GLU GLU A . A 1 61 GLY 61 61 GLY GLY A . A 1 62 CYS 62 62 CYS CYS A . A 1 63 PRO 63 63 PRO PRO A . A 1 64 THR 64 64 THR THR A . A 1 65 ASP 65 65 ASP ASP A . A 1 66 SER 66 66 SER SER A . A 1 67 ILE 67 67 ILE ILE A . A 1 68 LYS 68 68 LYS LYS A . A 1 69 VAL 69 69 VAL VAL A . A 1 70 ALA 70 70 ALA ALA A . A 1 71 ASP 71 71 ASP ASP A . A 1 72 GLU 72 72 GLU GLU A . A 1 73 PRO 73 73 PRO PRO A . A 1 74 PHE 74 74 PHE PHE A . A 1 75 GLU 75 75 GLU GLU A . A 1 76 GLY 76 76 GLY GLY A . A 1 77 ASP 77 77 ASP ASP A . A 1 78 PRO 78 78 PRO PRO A . A 1 79 LEU 79 79 LEU LEU A . A 1 80 LYS 80 80 LYS LYS A . A 1 81 PHE 81 81 PHE PHE A . A 1 82 GLU 82 82 GLU GLU A . B 2 1 MET 1 1 MET MET B . B 2 2 SER 2 2 SER SER B . B 2 3 GLU 3 3 GLU GLU B . B 2 4 LEU 4 4 LEU LEU B . B 2 5 PHE 5 5 PHE PHE B . B 2 6 SER 6 6 SER SER B . B 2 7 VAL 7 7 VAL VAL B . B 2 8 PRO 8 8 PRO PRO B . B 2 9 TYR 9 9 TYR TYR B . B 2 10 PHE 10 10 PHE PHE B . B 2 11 ILE 11 11 ILE ILE B . B 2 12 GLU 12 12 GLU GLU B . B 2 13 ASN 13 13 ASN ASN B . B 2 14 LEU 14 14 LEU LEU B . B 2 15 LYS 15 15 LYS LYS B . B 2 16 GLN 16 16 GLN GLN B . B 2 17 HIS 17 17 HIS HIS B . B 2 18 ILE 18 18 ILE ILE B . B 2 19 GLU 19 19 GLU GLU B . B 2 20 MET 20 20 MET MET B . B 2 21 ASN 21 21 ASN ASN B . B 2 22 GLN 22 22 GLN GLN B . B 2 23 SER 23 23 SER SER B . B 2 24 GLU 24 24 GLU GLU B . B 2 25 ASP 25 25 ASP ASP B . B 2 26 LYS 26 26 LYS LYS B . B 2 27 ILE 27 27 ILE ILE B . B 2 28 HIS 28 28 HIS HIS B . B 2 29 ALA 29 29 ALA ALA B . B 2 30 MET 30 30 MET MET B . B 2 31 ASN 31 31 ASN ASN B . B 2 32 SER 32 32 SER SER B . B 2 33 TYR 33 33 TYR TYR B . B 2 34 TYR 34 34 TYR TYR B . B 2 35 ARG 35 35 ARG ARG B . B 2 36 SER 36 36 SER SER B . B 2 37 VAL 37 37 VAL VAL B . B 2 38 VAL 38 38 VAL VAL B . B 2 39 SER 39 39 SER SER B . B 2 40 THR 40 40 THR THR B . B 2 41 LEU 41 41 LEU LEU B . B 2 42 VAL 42 42 VAL VAL B . B 2 43 GLN 43 43 GLN GLN B . B 2 44 ASP 44 44 ASP ASP B . B 2 45 GLN 45 45 GLN GLN B . B 2 46 LEU 46 46 LEU LEU B . B 2 47 THR 47 47 THR THR B . B 2 48 LYS 48 48 LYS LYS B . B 2 49 ASN 49 49 ASN ASN B . B 2 50 ALA 50 50 ALA ALA B . B 2 51 VAL 51 51 VAL VAL B . B 2 52 VAL 52 52 VAL VAL B . B 2 53 LEU 53 53 LEU LEU B . B 2 54 LYS 54 54 LYS LYS B . B 2 55 ARG 55 55 ARG ARG B . B 2 56 ILE 56 56 ILE ILE B . B 2 57 GLN 57 57 GLN GLN B . B 2 58 HIS 58 58 HIS HIS B . B 2 59 LEU 59 59 LEU LEU B . B 2 60 ASP 60 60 ASP ASP B . B 2 61 GLU 61 61 GLU GLU B . B 2 62 ALA 62 62 ALA ALA B . B 2 63 TYR 63 63 TYR TYR B . B 2 64 ASN 64 64 ASN ASN B . B 2 65 LYS 65 65 LYS LYS B . B 2 66 VAL 66 66 VAL VAL B . B 2 67 LYS 67 67 LYS LYS B . B 2 68 ARG 68 68 ARG ARG B . B 2 69 GLY 69 69 GLY GLY B . B 2 70 GLU 70 70 GLU GLU B . B 2 71 SER 71 71 SER SER B . B 2 72 LYS 72 72 LYS LYS B . # # loop_ # #