data_9A87 # _entry.id 9A87 # loop_ _atom_type.symbol C H N O S # loop_ _audit_author.name _audit_author.pdbx_ordinal "Shivaiah, K-K." 1 "Subedi, G.P." 2 "Barb, A.W." 3 "Nikolau, B.J." 4 # loop_ _audit_conform.dict_location _audit_conform.dict_name _audit_conform.dict_version https://mmcif.wwpdb.org/dictionaries/ascii/mmcif_ihm_ext.dic mmcif_ihm_ext.dic 1.26 http://mmcif.wwpdb.org/dictionaries/ascii/mmcif_pdbx_v50.dic mmcif_pdbx.dic 5.395 # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 9A87 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2023-11-11 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2025-04-09 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 9A87 pdb_00009a87 10.2210/pdb9a87/pdb PDB-Dev PDBDEV_00000372 PDBDEV_00000372 ? # loop_ _chem_comp.formula _chem_comp.formula_weight _chem_comp.id _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.type "C3 H7 N O2" 89.094 ALA . ALANINE . "L-peptide linking" "C6 H15 N4 O2 1" 175.212 ARG . ARGININE . "L-peptide linking" "C4 H8 N2 O3" 132.119 ASN . ASPARAGINE . "L-peptide linking" "C4 H7 N O4" 133.103 ASP . "ASPARTIC ACID" . "L-peptide linking" "C3 H7 N O2 S" 121.154 CYS . CYSTEINE . "L-peptide linking" "C5 H10 N2 O3" 146.146 GLN . GLUTAMINE . "L-peptide linking" "C5 H9 N O4" 147.13 GLU . "GLUTAMIC ACID" . "L-peptide linking" "C2 H5 N O2" 75.067 GLY . GLYCINE . "peptide linking" "C6 H10 N3 O2 1" 156.165 HIS . HISTIDINE . "L-peptide linking" "C6 H13 N O2" 131.175 ILE . ISOLEUCINE . "L-peptide linking" "C6 H13 N O2" 131.175 LEU . LEUCINE . "L-peptide linking" "C6 H15 N2 O2 1" 147.198 LYS . LYSINE . "L-peptide linking" "C5 H11 N O2 S" 149.208 MET . METHIONINE . "L-peptide linking" "C9 H11 N O2" 165.192 PHE . PHENYLALANINE . "L-peptide linking" "C5 H9 N O2" 115.132 PRO . PROLINE . "L-peptide linking" "C3 H7 N O3" 105.093 SER . SERINE . "L-peptide linking" "C4 H9 N O3" 119.12 THR . THREONINE . "L-peptide linking" "C9 H11 N O3" 181.191 TYR . TYROSINE . "L-peptide linking" "C5 H11 N O2" 117.148 VAL . VALINE . "L-peptide linking" # loop_ _citation.country _citation.id _citation.journal_abbrev _citation.journal_id_ASTM _citation.journal_id_CSD _citation.journal_id_ISSN _citation.journal_issue _citation.journal_volume _citation.page_first _citation.page_last _citation.pdbx_database_id_DOI _citation.pdbx_database_id_PubMed _citation.title _citation.year . 1 "Plant Direct" . . . . . . . 10.1002/pld3.70057 40124907 "Solution Structure and NMR Chemical Shift Perturbations of the Arabidopsis BCCP1 Identify Intersubunit Interactions Potentially Involved in the Assembly of the Heteromeric Acetyl-CoA Carboxylase " 2025 "United Kingdom" 2 Bioinformatics . . . 8 31 1325 1327 10.1093/bioinformatics/btu830 25505092 "NMRFAM-SPARKY: enhanced software for biomolecular NMR spectroscopy." 2015 "United States of America" 3 PNAS . . . 27 109 10873 10878 10.1073/pnas.1203013109 22733734 "Determination of solution structures of proteins up to 40 kDa using CS-Rosetta with sparse NMR data from deuterated samples" 2012 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal 1 "Shivaiah, K-K." 1 1 "Subedi, G.P." 2 1 "Barb, A.W." 3 1 "Nikolau, B.J." 4 2 "Lee, W." 1 2 "Tonelli, M." 2 2 "Markley, J.L." 3 3 "Lange, O.F." 1 3 "Rossi, P." 2 3 "Sgourakis, N.G." 3 3 "Song, Y." 4 3 "Lee, H.-W." 5 3 "Aramini, J.M." 6 3 "Ertekin, A." 7 3 "Xiao, R." 8 3 "Acton, T.B. " 9 3 "Baker, D." 10 3 "Montelione, G.T." 10 # _entity.details . _entity.formula_weight 9855.027 _entity.id 1 _entity.pdbx_description "Biotin carboxyl carrier protein of acetyl-CoA carboxylase 1, chloroplastic" _entity.pdbx_number_of_molecules 1 _entity.src_method MAN _entity.type POLYMER # _entity_name_sys.entity_id 1 _entity_name_sys.name "C-terminal domain of Arabidopsis Biotin Carboxyl Carrier Protein 1" # _entity_poly.entity_id 1 _entity_poly.nstd_chirality . _entity_poly.nstd_linkage NO _entity_poly.nstd_monomer NO _entity_poly.pdbx_seq_one_letter_code SSLPTVKSPMAGTFYRSPAPGEPPFIKVGDKVQKGQVLCIVEAMKLMNEIESDHTGTVVDIVAEDGKPVSLDTPLFVVQ _entity_poly.pdbx_seq_one_letter_code_can SSLPTVKSPMAGTFYRSPAPGEPPFIKVGDKVQKGQVLCIVEAMKLMNEIESDHTGTVVDIVAEDGKPVSLDTPLFVVQ _entity_poly.pdbx_sequence_evidence_code . _entity_poly.pdbx_strand_id A _entity_poly.type polypeptide(L) # loop_ _entity_poly_seq.entity_id _entity_poly_seq.hetero _entity_poly_seq.mon_id _entity_poly_seq.num 1 . SER 1 1 . SER 2 1 . LEU 3 1 . PRO 4 1 . THR 5 1 . VAL 6 1 . LYS 7 1 . SER 8 1 . PRO 9 1 . MET 10 1 . ALA 11 1 . GLY 12 1 . THR 13 1 . PHE 14 1 . TYR 15 1 . ARG 16 1 . SER 17 1 . PRO 18 1 . ALA 19 1 . PRO 20 1 . GLY 21 1 . GLU 22 1 . PRO 23 1 . PRO 24 1 . PHE 25 1 . ILE 26 1 . LYS 27 1 . VAL 28 1 . GLY 29 1 . ASP 30 1 . LYS 31 1 . VAL 32 1 . GLN 33 1 . LYS 34 1 . GLY 35 1 . GLN 36 1 . VAL 37 1 . LEU 38 1 . CYS 39 1 . ILE 40 1 . VAL 41 1 . GLU 42 1 . ALA 43 1 . MET 44 1 . LYS 45 1 . LEU 46 1 . MET 47 1 . ASN 48 1 . GLU 49 1 . ILE 50 1 . GLU 51 1 . SER 52 1 . ASP 53 1 . HIS 54 1 . THR 55 1 . GLY 56 1 . THR 57 1 . VAL 58 1 . VAL 59 1 . ASP 60 1 . ILE 61 1 . VAL 62 1 . ALA 63 1 . GLU 64 1 . ASP 65 1 . GLY 66 1 . LYS 67 1 . PRO 68 1 . VAL 69 1 . SER 70 1 . LEU 71 1 . ASP 72 1 . THR 73 1 . PRO 74 1 . LEU 75 1 . PHE 76 1 . VAL 77 1 . VAL 78 1 . GLN 79 # _ihm_dataset_group.application . _ihm_dataset_group.details . _ihm_dataset_group.id 1 _ihm_dataset_group.name . # _ihm_dataset_group_link.dataset_list_id 1 _ihm_dataset_group_link.group_id 1 # _ihm_dataset_list.data_type "NMR data" _ihm_dataset_list.database_hosted YES _ihm_dataset_list.details BMRB _ihm_dataset_list.id 1 # _ihm_dataset_related_db_reference.accession_code 52087 _ihm_dataset_related_db_reference.dataset_list_id 1 _ihm_dataset_related_db_reference.db_name BMRB _ihm_dataset_related_db_reference.details . _ihm_dataset_related_db_reference.id 1 _ihm_dataset_related_db_reference.version . # _ihm_entity_poly_segment.comp_id_begin SER _ihm_entity_poly_segment.comp_id_end GLN _ihm_entity_poly_segment.entity_id 1 _ihm_entity_poly_segment.id 1 _ihm_entity_poly_segment.seq_id_begin 1 _ihm_entity_poly_segment.seq_id_end 79 # _ihm_model_group.details . _ihm_model_group.id 1 _ihm_model_group.name . # _ihm_model_group_link.group_id 1 _ihm_model_group_link.model_id 1 # _ihm_model_list.assembly_id 1 _ihm_model_list.model_id 1 _ihm_model_list.model_name . _ihm_model_list.protocol_id 1 _ihm_model_list.representation_id 1 # _ihm_model_representation.details "No starting models were used" _ihm_model_representation.id 1 _ihm_model_representation.name . # _ihm_model_representation_details.description . _ihm_model_representation_details.entity_asym_id A _ihm_model_representation_details.entity_description . _ihm_model_representation_details.entity_id 1 _ihm_model_representation_details.entity_poly_segment_id 1 _ihm_model_representation_details.id 1 _ihm_model_representation_details.model_granularity by-atom _ihm_model_representation_details.model_mode flexible _ihm_model_representation_details.model_object_count . _ihm_model_representation_details.model_object_primitive atomistic _ihm_model_representation_details.representation_id 1 _ihm_model_representation_details.starting_model_id . # _ihm_modeling_protocol.details "C-terminal domain of the Arabidopsis BCCP1 modeled using CS-Rosetta, guided by its experimentally determined chemical shift values" _ihm_modeling_protocol.id 1 _ihm_modeling_protocol.num_steps 2 _ihm_modeling_protocol.protocol_name modeling # loop_ _ihm_modeling_protocol_details.dataset_group_id _ihm_modeling_protocol_details.description _ihm_modeling_protocol_details.ensemble_flag _ihm_modeling_protocol_details.id _ihm_modeling_protocol_details.multi_scale_flag _ihm_modeling_protocol_details.multi_state_flag _ihm_modeling_protocol_details.num_models_begin _ihm_modeling_protocol_details.num_models_end _ihm_modeling_protocol_details.ordered_flag _ihm_modeling_protocol_details.protocol_id _ihm_modeling_protocol_details.script_file_id _ihm_modeling_protocol_details.software_id _ihm_modeling_protocol_details.step_id _ihm_modeling_protocol_details.step_method _ihm_modeling_protocol_details.step_name _ihm_modeling_protocol_details.struct_assembly_description _ihm_modeling_protocol_details.struct_assembly_id 1 "Evaluated NMR data with the SPARKY program hosted by NMRFAM to establish backbone and sidechain assignments" NO 1 NO NO . . NO 1 . 1 1 . . . 1 1 "Using the assigned chemical shift values, the structure of the C-terminal domain of the Arabidopsis BCCP1 was determined using chemical shift-Rosetta (CS-Rosetta)" NO 2 NO NO . . NO 1 . 2 2 . . . 1 # _ihm_struct_assembly.description "C-terminal domain of the Arabidopsis BCCP1 modeled using CS-Rosetta, guided by its experimentally determined chemical shift values" _ihm_struct_assembly.id 1 _ihm_struct_assembly.name "C-terminal domain of the Arabidopsis BCCP1" # _ihm_struct_assembly_details.assembly_id 1 _ihm_struct_assembly_details.asym_id A _ihm_struct_assembly_details.entity_description "C-terminal domain of the Arabidopsis BCCP1" _ihm_struct_assembly_details.entity_id 1 _ihm_struct_assembly_details.entity_poly_segment_id 1 _ihm_struct_assembly_details.id 1 _ihm_struct_assembly_details.parent_assembly_id 1 # loop_ _software.citation_id _software.classification _software.description _software.location _software.name _software.pdbx_ordinal _software.type _software.version 2 "Chemical shifts were manually assigned and validated using NMRFAM-sparky" . https://nmrbox.nmrhub.org/software/nmrfam-sparky NMRFAM-sparky 1 program . 3 "model building" . https://www.rosettacommons.org/docs/latest/CS-Rosetta CS-Rosetta 2 program . # _struct.entry_id 9A87 _struct.pdbx_CASP_flag . _struct.pdbx_descriptor . _struct.pdbx_details . _struct.pdbx_model_details . _struct.pdbx_model_type_details "The protein's structure was modeled using CS-Rosetta, guided by its experimentally determined chemical shift values" _struct.pdbx_structure_determination_methodology integrative _struct.title "The structure of C-terminal domain of the Arabidopsis BCCP1" # _struct_asym.details . _struct_asym.entity_id 1 _struct_asym.id A _struct_asym.pdbx_PDB_id . _struct_asym.pdbx_alt_id . _struct_asym.pdbx_blank_PDB_chainid_flag . _struct_asym.pdbx_modified . _struct_asym.pdbx_order . _struct_asym.pdbx_type . # _struct_ref.db_code BCCP1_ARATH _struct_ref.db_name UNP _struct_ref.details "Biotin carboxyl carrier protein of acetyl-CoA carboxylase 1, chloroplastic" _struct_ref.entity_id 1 _struct_ref.id 1 _struct_ref.pdbx_align_begin 201 _struct_ref.pdbx_align_end 279 _struct_ref.pdbx_db_accession Q42533 _struct_ref.pdbx_db_isoform . _struct_ref.pdbx_seq_one_letter_code "SSLPTVKSPMAGTFYRSPAPGEPPFIKVGDKVQKGQVLCIVEAMKLMNEIESDHTGTVVD IVAEDGKPVSLDTPLFVVQ" # _struct_ref_seq.align_id 1 _struct_ref_seq.db_align_beg 201 _struct_ref_seq.db_align_end 279 _struct_ref_seq.ref_id 1 _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.seq_align_end 79 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code A 1 1 SER 1 1 SER SER A . A 1 2 SER 2 2 SER SER A . A 1 3 LEU 3 3 LEU LEU A . A 1 4 PRO 4 4 PRO PRO A . A 1 5 THR 5 5 THR THR A . A 1 6 VAL 6 6 VAL VAL A . A 1 7 LYS 7 7 LYS LYS A . A 1 8 SER 8 8 SER SER A . A 1 9 PRO 9 9 PRO PRO A . A 1 10 MET 10 10 MET MET A . A 1 11 ALA 11 11 ALA ALA A . A 1 12 GLY 12 12 GLY GLY A . A 1 13 THR 13 13 THR THR A . A 1 14 PHE 14 14 PHE PHE A . A 1 15 TYR 15 15 TYR TYR A . A 1 16 ARG 16 16 ARG ARG A . A 1 17 SER 17 17 SER SER A . A 1 18 PRO 18 18 PRO PRO A . A 1 19 ALA 19 19 ALA ALA A . A 1 20 PRO 20 20 PRO PRO A . A 1 21 GLY 21 21 GLY GLY A . A 1 22 GLU 22 22 GLU GLU A . A 1 23 PRO 23 23 PRO PRO A . A 1 24 PRO 24 24 PRO PRO A . A 1 25 PHE 25 25 PHE PHE A . A 1 26 ILE 26 26 ILE ILE A . A 1 27 LYS 27 27 LYS LYS A . A 1 28 VAL 28 28 VAL VAL A . A 1 29 GLY 29 29 GLY GLY A . A 1 30 ASP 30 30 ASP ASP A . A 1 31 LYS 31 31 LYS LYS A . A 1 32 VAL 32 32 VAL VAL A . A 1 33 GLN 33 33 GLN GLN A . A 1 34 LYS 34 34 LYS LYS A . A 1 35 GLY 35 35 GLY GLY A . A 1 36 GLN 36 36 GLN GLN A . A 1 37 VAL 37 37 VAL VAL A . A 1 38 LEU 38 38 LEU LEU A . A 1 39 CYS 39 39 CYS CYS A . A 1 40 ILE 40 40 ILE ILE A . A 1 41 VAL 41 41 VAL VAL A . A 1 42 GLU 42 42 GLU GLU A . A 1 43 ALA 43 43 ALA ALA A . A 1 44 MET 44 44 MET MET A . A 1 45 LYS 45 45 LYS LYS A . A 1 46 LEU 46 46 LEU LEU A . A 1 47 MET 47 47 MET MET A . A 1 48 ASN 48 48 ASN ASN A . A 1 49 GLU 49 49 GLU GLU A . A 1 50 ILE 50 50 ILE ILE A . A 1 51 GLU 51 51 GLU GLU A . A 1 52 SER 52 52 SER SER A . A 1 53 ASP 53 53 ASP ASP A . A 1 54 HIS 54 54 HIS HIS A . A 1 55 THR 55 55 THR THR A . A 1 56 GLY 56 56 GLY GLY A . A 1 57 THR 57 57 THR THR A . A 1 58 VAL 58 58 VAL VAL A . A 1 59 VAL 59 59 VAL VAL A . A 1 60 ASP 60 60 ASP ASP A . A 1 61 ILE 61 61 ILE ILE A . A 1 62 VAL 62 62 VAL VAL A . A 1 63 ALA 63 63 ALA ALA A . A 1 64 GLU 64 64 GLU GLU A . A 1 65 ASP 65 65 ASP ASP A . A 1 66 GLY 66 66 GLY GLY A . A 1 67 LYS 67 67 LYS LYS A . A 1 68 PRO 68 68 PRO PRO A . A 1 69 VAL 69 69 VAL VAL A . A 1 70 SER 70 70 SER SER A . A 1 71 LEU 71 71 LEU LEU A . A 1 72 ASP 72 72 ASP ASP A . A 1 73 THR 73 73 THR THR A . A 1 74 PRO 74 74 PRO PRO A . A 1 75 LEU 75 75 LEU LEU A . A 1 76 PHE 76 76 PHE PHE A . A 1 77 VAL 77 77 VAL VAL A . A 1 78 VAL 78 78 VAL VAL A . A 1 79 GLN 79 79 GLN GLN A . # # loop_ # #