data_9A8V # _entry.id 9A8V # loop_ _atom_type.symbol C H N O S # loop_ _audit_author.name _audit_author.pdbx_ordinal "Huang, Y.J." 1 "Montelione, G.T." 2 # loop_ _audit_conform.dict_location _audit_conform.dict_name _audit_conform.dict_version https://mmcif.wwpdb.org/dictionaries/ascii/mmcif_ihm_ext.dic mmcif_ihm_ext.dic 1.28 http://mmcif.wwpdb.org/dictionaries/ascii/mmcif_pdbx_v50.dic mmcif_pdbx.dic 5.403 # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 9A8V _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2024-06-18 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2026-05-06 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 9A8V pdb_00009a8v 10.2210/pdb9a8v/pdb # loop_ _chem_comp.formula _chem_comp.formula_weight _chem_comp.id _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.type "C3 H7 N O2" 89.094 ALA . ALANINE . "L-peptide linking" "C6 H15 N4 O2 1" 175.212 ARG . ARGININE . "L-peptide linking" "C4 H8 N2 O3" 132.119 ASN . ASPARAGINE . "L-peptide linking" "C4 H7 N O4" 133.103 ASP . "ASPARTIC ACID" . "L-peptide linking" "C3 H7 N O2 S" 121.154 CYS . CYSTEINE . "L-peptide linking" "C5 H10 N2 O3" 146.146 GLN . GLUTAMINE . "L-peptide linking" "C5 H9 N O4" 147.13 GLU . "GLUTAMIC ACID" . "L-peptide linking" "C2 H5 N O2" 75.067 GLY . GLYCINE . "peptide linking" "C6 H10 N3 O2 1" 156.165 HIS . HISTIDINE . "L-peptide linking" "C6 H13 N O2" 131.175 ILE . ISOLEUCINE . "L-peptide linking" "C6 H13 N O2" 131.175 LEU . LEUCINE . "L-peptide linking" "C6 H15 N2 O2 1" 147.198 LYS . LYSINE . "L-peptide linking" "C5 H11 N O2 S" 149.208 MET . METHIONINE . "L-peptide linking" "C9 H11 N O2" 165.192 PHE . PHENYLALANINE . "L-peptide linking" "C5 H9 N O2" 115.132 PRO . PROLINE . "L-peptide linking" "C3 H7 N O3" 105.093 SER . SERINE . "L-peptide linking" "C4 H9 N O3" 119.12 THR . THREONINE . "L-peptide linking" "C11 H12 N2 O2" 204.229 TRP . TRYPTOPHAN . "L-peptide linking" "C9 H11 N O3" 181.191 TYR . TYROSINE . "L-peptide linking" "C5 H11 N O2" 117.148 VAL . VALINE . "L-peptide linking" # loop_ _citation.country _citation.id _citation.journal_abbrev _citation.journal_id_ASTM _citation.journal_id_CSD _citation.journal_id_ISSN _citation.journal_issue _citation.journal_volume _citation.page_first _citation.page_last _citation.pdbx_database_id_DOI _citation.pdbx_database_id_PubMed _citation.title _citation.year . 1 "Nat Commun" . . . . . . . 10.1038/s41467-026-71997-6 42045216 "Hidden Structural States of Proteins Revealed by Conformer Selection" 2026 . 2 "J. Am. Chem. Soc." . . . 6 127 1665 1674 10.1021/ja047109h . "Protein NMR Recall, Precision, and F-measure Scores (RPF Scores): Structure Quality Assessment Measures Based on Information Retrieval Statistics" 2005 . 3 Proteins . . . . 66 778 795 10.1002/prot.21165 . "Evaluating protein structures determined by structural genomics consortia" 2007 . 4 Nature . . . . 596 583 589 10.1038/s41586-021-03819-2 . "Highly accurate protein structure prediction with AlphaFold" 2021 . 5 Bioinformatics . . . 9 39 . . 10.1093/bioinformatics/btad573 . "AFsample: improving multimer prediction with AlphaFold using massive sampling" 2023 . 6 "Nucleic Acids Research" . . . suppl_2 35 W531 W537 10.1093/nar/gkm328 . "The RCI server: rapid and accurate calculation of protein flexibility using chemical shifts" 2007 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal 1 "Huang, Y.J." 1 1 "Ramelot, T.A." 2 1 "Spaman, L.E." 3 1 "Kobayashi, N." 4 1 "Montelione, G.T." 5 2 "Huang, Y.J." 6 2 "Powers, R." 7 2 "Montelione, G.T." 8 3 "Bhattacharya, A." 9 3 "Tejero, R." 10 3 "Montelione, G.T." 11 4 "Jumper, J." 12 4 "Evans, R." 13 4 "Pritzel, A." 14 4 "Green, T." 15 4 "Figurnov, M." 16 4 "Ronneberger, O." 17 4 "Tunyasuvunakool, K." 18 4 "Bates, R." 19 4 "Zidek, A." 20 4 "Potapenko, A." 21 4 "Bridgland, A." 22 4 "Meyer, C." 23 4 "Kohl, S.A.A" 24 4 "Ballard, A.J." 25 4 "Cowie, A." 26 4 "Romera-Paredes, B." 27 4 "Nikolov, S." 28 4 "Jain, R." 29 4 "Adler, J." 30 4 "Back, T." 31 4 "Petersen, S." 32 4 "Reiman, D." 33 4 "Clancy, E." 34 4 "Zielinski, M." 35 4 "Steinegger, M." 36 4 "Pacholska, M." 37 4 "Berghammer, T." 38 4 "Bodenstein, S." 39 4 "Silver, D." 40 4 "Vinyals, O." 41 4 "Senior, A.W." 42 4 "Kavukcuoglu, K." 43 4 "Kohli, P." 44 4 "Hassabis, D." 45 5 "Wallner, B." 46 6 "Berjanskii, M.V." 47 6 "Wishart, D.S." 48 # _entity.details . _entity.formula_weight 21245.88 _entity.id 1 _entity.pdbx_description Luciferase _entity.pdbx_number_of_molecules 1 _entity.src_method MAN _entity.type POLYMER # _entity_poly.entity_id 1 _entity_poly.nstd_chirality . _entity_poly.nstd_linkage NO _entity_poly.nstd_monomer NO _entity_poly.pdbx_seq_one_letter_code KPTENNEDFNIVAVASNFATTDLDADRGKLPGKKLPLEVLKEMEANARKAGCTRGCLICLSHIKCTPKMKKFIPGRCHTYEGDKESAQGGIGEAIVDIPAIPRFKDLEPMEQFIAQVDLCVDCTTGCLKGLANVQCSDLLKKWLPQRCATFASKIQGQVDKIKGAGGD _entity_poly.pdbx_seq_one_letter_code_can KPTENNEDFNIVAVASNFATTDLDADRGKLPGKKLPLEVLKEMEANARKAGCTRGCLICLSHIKCTPKMKKFIPGRCHTYEGDKESAQGGIGEAIVDIPAIPRFKDLEPMEQFIAQVDLCVDCTTGCLKGLANVQCSDLLKKWLPQRCATFASKIQGQVDKIKGAGGD _entity_poly.pdbx_sequence_evidence_code . _entity_poly.pdbx_strand_id A _entity_poly.type polypeptide(L) # loop_ _entity_poly_seq.entity_id _entity_poly_seq.hetero _entity_poly_seq.mon_id _entity_poly_seq.num 1 . LYS 1 1 . PRO 2 1 . THR 3 1 . GLU 4 1 . ASN 5 1 . ASN 6 1 . GLU 7 1 . ASP 8 1 . PHE 9 1 . ASN 10 1 . ILE 11 1 . VAL 12 1 . ALA 13 1 . VAL 14 1 . ALA 15 1 . SER 16 1 . ASN 17 1 . PHE 18 1 . ALA 19 1 . THR 20 1 . THR 21 1 . ASP 22 1 . LEU 23 1 . ASP 24 1 . ALA 25 1 . ASP 26 1 . ARG 27 1 . GLY 28 1 . LYS 29 1 . LEU 30 1 . PRO 31 1 . GLY 32 1 . LYS 33 1 . LYS 34 1 . LEU 35 1 . PRO 36 1 . LEU 37 1 . GLU 38 1 . VAL 39 1 . LEU 40 1 . LYS 41 1 . GLU 42 1 . MET 43 1 . GLU 44 1 . ALA 45 1 . ASN 46 1 . ALA 47 1 . ARG 48 1 . LYS 49 1 . ALA 50 1 . GLY 51 1 . CYS 52 1 . THR 53 1 . ARG 54 1 . GLY 55 1 . CYS 56 1 . LEU 57 1 . ILE 58 1 . CYS 59 1 . LEU 60 1 . SER 61 1 . HIS 62 1 . ILE 63 1 . LYS 64 1 . CYS 65 1 . THR 66 1 . PRO 67 1 . LYS 68 1 . MET 69 1 . LYS 70 1 . LYS 71 1 . PHE 72 1 . ILE 73 1 . PRO 74 1 . GLY 75 1 . ARG 76 1 . CYS 77 1 . HIS 78 1 . THR 79 1 . TYR 80 1 . GLU 81 1 . GLY 82 1 . ASP 83 1 . LYS 84 1 . GLU 85 1 . SER 86 1 . ALA 87 1 . GLN 88 1 . GLY 89 1 . GLY 90 1 . ILE 91 1 . GLY 92 1 . GLU 93 1 . ALA 94 1 . ILE 95 1 . VAL 96 1 . ASP 97 1 . ILE 98 1 . PRO 99 1 . ALA 100 1 . ILE 101 1 . PRO 102 1 . ARG 103 1 . PHE 104 1 . LYS 105 1 . ASP 106 1 . LEU 107 1 . GLU 108 1 . PRO 109 1 . MET 110 1 . GLU 111 1 . GLN 112 1 . PHE 113 1 . ILE 114 1 . ALA 115 1 . GLN 116 1 . VAL 117 1 . ASP 118 1 . LEU 119 1 . CYS 120 1 . VAL 121 1 . ASP 122 1 . CYS 123 1 . THR 124 1 . THR 125 1 . GLY 126 1 . CYS 127 1 . LEU 128 1 . LYS 129 1 . GLY 130 1 . LEU 131 1 . ALA 132 1 . ASN 133 1 . VAL 134 1 . GLN 135 1 . CYS 136 1 . SER 137 1 . ASP 138 1 . LEU 139 1 . LEU 140 1 . LYS 141 1 . LYS 142 1 . TRP 143 1 . LEU 144 1 . PRO 145 1 . GLN 146 1 . ARG 147 1 . CYS 148 1 . ALA 149 1 . THR 150 1 . PHE 151 1 . ALA 152 1 . SER 153 1 . LYS 154 1 . ILE 155 1 . GLN 156 1 . GLY 157 1 . GLN 158 1 . VAL 159 1 . ASP 160 1 . LYS 161 1 . ILE 162 1 . LYS 163 1 . GLY 164 1 . ALA 165 1 . GLY 166 1 . GLY 167 1 . ASP 168 # loop_ _ihm_dataset_external_reference.dataset_list_id _ihm_dataset_external_reference.file_id _ihm_dataset_external_reference.id 2 1 1 3 2 2 4 3 3 5 4 4 # _ihm_dataset_group.application modeling _ihm_dataset_group.details . _ihm_dataset_group.id 1 _ihm_dataset_group.name . # loop_ _ihm_dataset_group_link.dataset_list_id _ihm_dataset_group_link.group_id 1 1 2 1 3 1 4 1 5 1 # loop_ _ihm_dataset_list.data_type _ihm_dataset_list.database_hosted _ihm_dataset_list.details _ihm_dataset_list.id "NMR data" YES "Chemical shift assignments for Gluc" 1 "NMR data" NO "NOESY peak list C13 aliphatic" 2 "NMR data" NO "NOESY peak list C13 aromatic" 3 "NMR data" NO "NOESY peak list N15" 4 "NMR data" NO "Chemical shift data" 5 # _ihm_dataset_related_db_reference.accession_code 36385 _ihm_dataset_related_db_reference.dataset_list_id 1 _ihm_dataset_related_db_reference.db_name BMRB _ihm_dataset_related_db_reference.details "Chemical shift data" _ihm_dataset_related_db_reference.id 1 _ihm_dataset_related_db_reference.version . # _ihm_entity_poly_segment.comp_id_begin LYS _ihm_entity_poly_segment.comp_id_end ASP _ihm_entity_poly_segment.entity_id 1 _ihm_entity_poly_segment.id 1 _ihm_entity_poly_segment.seq_id_begin 1 _ihm_entity_poly_segment.seq_id_end 168 # loop_ _ihm_external_files.content_type _ihm_external_files.details _ihm_external_files.file_format _ihm_external_files.file_path _ihm_external_files.file_size_bytes _ihm_external_files.id _ihm_external_files.reference_id "Input data or restraints" "NOESY peak list C13 aliphatic" Other /files/c13ali.peaks . 1 1 "Input data or restraints" "NOESY peak list C13 aromatic" Other /files/c13aro.peaks . 2 1 "Input data or restraints" "NOESY peak list N15" Other /files/n15.peaks . 3 1 "Input data or restraints" "Chemical shift data" Other /files/gluc.str . 4 1 # _ihm_external_reference_info.associated_url https://zenodo.org/records/13831427 _ihm_external_reference_info.details . _ihm_external_reference_info.reference 10.5281/zenodo.13831427 _ihm_external_reference_info.reference_id 1 _ihm_external_reference_info.reference_provider Zenodo _ihm_external_reference_info.reference_type DOI _ihm_external_reference_info.refers_to Archive # loop_ _ihm_model_group.details _ihm_model_group.id _ihm_model_group.name . 1 "State 1" . 2 "State 2" # loop_ _ihm_model_group_link.group_id _ihm_model_group_link.model_id 1 1 1 2 1 3 1 4 1 5 2 6 2 7 2 8 2 9 2 10 # loop_ _ihm_model_list.assembly_id _ihm_model_list.model_id _ihm_model_list.model_name _ihm_model_list.protocol_id _ihm_model_list.representation_id 1 1 "State 1 Model 1" 1 1 1 2 "State 1 Model 2" 1 1 1 3 "State 1 Model 3" 1 1 1 4 "State 1 Model 4" 1 1 1 5 "State 1 Model 5" 1 1 1 6 "State 2 Model 1" 1 1 1 7 "State 2 Model 2" 1 1 1 8 "State 2 Model 3" 1 1 1 9 "State 2 Model 4" 1 1 1 10 "State 2 Model 5" 1 1 # _ihm_model_representation.details "No starting models were used" _ihm_model_representation.id 1 _ihm_model_representation.name . # _ihm_model_representation_details.description . _ihm_model_representation_details.entity_asym_id A _ihm_model_representation_details.entity_description Luciferase _ihm_model_representation_details.entity_id 1 _ihm_model_representation_details.entity_poly_segment_id 1 _ihm_model_representation_details.id 1 _ihm_model_representation_details.model_granularity by-atom _ihm_model_representation_details.model_mode flexible _ihm_model_representation_details.model_object_count . _ihm_model_representation_details.model_object_primitive atomistic _ihm_model_representation_details.representation_id 1 _ihm_model_representation_details.starting_model_id . # loop_ _ihm_model_representative.id _ihm_model_representative.model_group_id _ihm_model_representative.model_id _ihm_model_representative.selection_criteria 1 1 1 "best scoring model" 2 1 3 "other selction criteria" 3 2 6 "best scoring model" # loop_ _ihm_modeling_post_process.analysis_id _ihm_modeling_post_process.dataset_group_id _ihm_modeling_post_process.details _ihm_modeling_post_process.feature _ihm_modeling_post_process.feature_name _ihm_modeling_post_process.id _ihm_modeling_post_process.num_models_begin _ihm_modeling_post_process.num_models_end _ihm_modeling_post_process.protocol_id _ihm_modeling_post_process.script_file_id _ihm_modeling_post_process.software_id _ihm_modeling_post_process.step_id _ihm_modeling_post_process.struct_assembly_id _ihm_modeling_post_process.type 1 1 "PSVS runs a suite of knowledge-based software tools including ProCheck (ver 3.5.4) and MolProbity (mage ver 6.35.040409)" energy/score PSVS 1 . . 1 . 3 1 1 validation 1 1 " NMR NOESY Double Recall analysis: This method compares two ensembles of conformers, A and B, and identifies 3D 15N/13C-resolved NOESY peaks (from provided peak lists) explained by short 1H-1H distances present in one conformer ensemble (e.g. in the A ensemble) but not by the other (e.g. in the B ensemble)." other DoubleRecall 2 . . 1 . 4 2 1 validation 1 1 "RPF server was used to compute RPF-DP scores (a set of fast and sensitive structure quality assessment measures used to evaluate how well a 3D structure model fits with NOESY peak and resonance assignment lists, and hence to assess the accuracy of the structure)." other RPF 3 . . 1 . 5 3 1 validation 1 1 . other "Conformation Selection based on NOESY and RCI data" 4 . . 2 . 6 4 1 filter # loop_ _ihm_modeling_protocol.details _ihm_modeling_protocol.id _ihm_modeling_protocol.num_steps _ihm_modeling_protocol.protocol_name "AFsample modeling calculations were carried out using modified version of AlphaFold v2.2.0. AF2 was trained using the PDB database of 2018-04-30 and did not include any NMR structures in the training data. AFsample calculations, which use six different settings with network dropouts to create conformational heterogeneity, were carried out to generate ~6000 models" 1 2 modeling "Conformation Selection based on NOESY and RCI data" 2 1 AISAR # loop_ _ihm_modeling_protocol_details.dataset_group_id _ihm_modeling_protocol_details.description _ihm_modeling_protocol_details.ensemble_flag _ihm_modeling_protocol_details.id _ihm_modeling_protocol_details.multi_scale_flag _ihm_modeling_protocol_details.multi_state_flag _ihm_modeling_protocol_details.num_models_begin _ihm_modeling_protocol_details.num_models_end _ihm_modeling_protocol_details.ordered_flag _ihm_modeling_protocol_details.protocol_id _ihm_modeling_protocol_details.script_file_id _ihm_modeling_protocol_details.software_id _ihm_modeling_protocol_details.step_id _ihm_modeling_protocol_details.step_method _ihm_modeling_protocol_details.step_name _ihm_modeling_protocol_details.struct_assembly_description _ihm_modeling_protocol_details.struct_assembly_id 1 "AFsample modeling calculations were carried out using modified version of AlphaFold v2.2.0. AFsample calculations, which use six different settings with network dropouts to create conformational heterogeneity, were carried out to generate ~6000 models" YES 1 NO YES . . NO 1 . 2 2 . modeling . 1 1 "A modified version of AlphaFold v2.2.0 used by AFsample. AF2 was trained using the PDB database of 2018-04-30 and did not include any NMR structures in the training data. " YES 2 NO YES . . NO 1 . 1 1 . modeling . 1 # loop_ _ihm_multi_state_model_group_link.model_group_id _ihm_multi_state_model_group_link.state_id 1 1 2 2 # loop_ _ihm_multi_state_modeling.details _ihm_multi_state_modeling.experiment_type _ihm_multi_state_modeling.population_fraction _ihm_multi_state_modeling.population_fraction_sd _ihm_multi_state_modeling.state_group_id _ihm_multi_state_modeling.state_id _ihm_multi_state_modeling.state_name _ihm_multi_state_modeling.state_type . "Fraction of bulk" . . 1 1 "State 1" "conformational change" . "Fraction of bulk" . . 1 2 "State 2" "conformational change" # _ihm_struct_assembly.description "Integrative structure of Gaussia Luciferase determined using the conformational selection approach: generating a distribution of realistic protein conformational models using artificial intelligence-(AI-) based methods and then selecting the sets of conformers that best explain the experimental data" _ihm_struct_assembly.id 1 _ihm_struct_assembly.name "Gaussia Luciferase" # _ihm_struct_assembly_details.assembly_id 1 _ihm_struct_assembly_details.asym_id A _ihm_struct_assembly_details.entity_description Luciferase _ihm_struct_assembly_details.entity_id 1 _ihm_struct_assembly_details.entity_poly_segment_id 1 _ihm_struct_assembly_details.id 1 _ihm_struct_assembly_details.parent_assembly_id 1 # loop_ _software.citation_id _software.classification _software.description _software.location _software.name _software.pdbx_ordinal _software.type _software.version 4 "Model Building" . https://github.com/google-deepmind/alphafold AlphaFold2 1 program 2.2.0 5 "Enhanced Sampling" . http://wallnerlab.org/AFsample AFsample 2 package . 3 Validation . https://montelionelab.chem.rpi.edu/PSVS/PSVS2/ "Protein Structure Validation Software" 3 program 2.0 1 Validation . https://github.rpi.edu/RPIBioinformatics/AlphaFold-NMR DoubleRecall 4 program 1.0 2 Validation . https://montelionelab.chem.rpi.edu/rpf/ "RPF server" 5 program "ASDP ver 1.0" 1 "Model Selection" . https://github.com/MontelioneLab/AISAR AISAR 6 package 1.0 6 Other . https://www.randomcoilindex.ca/cgi-bin/rci_cgi_current.py RCI 7 program . # _struct.entry_id 9A8V _struct.pdbx_CASP_flag . _struct.pdbx_descriptor . _struct.pdbx_details . _struct.pdbx_model_details . _struct.pdbx_model_type_details . _struct.pdbx_structure_determination_methodology integrative _struct.title 'Integrative structure of Gaussia Luciferase "open" and "closed" structural states from NMR data' # _struct_asym.details . _struct_asym.entity_id 1 _struct_asym.id A _struct_asym.pdbx_PDB_id . _struct_asym.pdbx_alt_id . _struct_asym.pdbx_blank_PDB_chainid_flag . _struct_asym.pdbx_modified . _struct_asym.pdbx_order . _struct_asym.pdbx_type . # _struct_ref.db_code Q9BLZ2_9MAXI _struct_ref.db_name UNP _struct_ref.details . _struct_ref.entity_id 1 _struct_ref.id 1 _struct_ref.pdbx_align_begin 18 _struct_ref.pdbx_align_end . _struct_ref.pdbx_db_accession Q9BLZ2 _struct_ref.pdbx_db_isoform . _struct_ref.pdbx_seq_one_letter_code . # _struct_ref_seq.align_id 1 _struct_ref_seq.db_align_beg 18 _struct_ref_seq.db_align_end 185 _struct_ref_seq.ref_id 1 _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.seq_align_end 168 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code A 1 1 LYS 1 1 LYS LYS A . A 1 2 PRO 2 2 PRO PRO A . A 1 3 THR 3 3 THR THR A . A 1 4 GLU 4 4 GLU GLU A . A 1 5 ASN 5 5 ASN ASN A . A 1 6 ASN 6 6 ASN ASN A . A 1 7 GLU 7 7 GLU GLU A . A 1 8 ASP 8 8 ASP ASP A . A 1 9 PHE 9 9 PHE PHE A . A 1 10 ASN 10 10 ASN ASN A . A 1 11 ILE 11 11 ILE ILE A . A 1 12 VAL 12 12 VAL VAL A . A 1 13 ALA 13 13 ALA ALA A . A 1 14 VAL 14 14 VAL VAL A . A 1 15 ALA 15 15 ALA ALA A . A 1 16 SER 16 16 SER SER A . A 1 17 ASN 17 17 ASN ASN A . A 1 18 PHE 18 18 PHE PHE A . A 1 19 ALA 19 19 ALA ALA A . A 1 20 THR 20 20 THR THR A . A 1 21 THR 21 21 THR THR A . A 1 22 ASP 22 22 ASP ASP A . A 1 23 LEU 23 23 LEU LEU A . A 1 24 ASP 24 24 ASP ASP A . A 1 25 ALA 25 25 ALA ALA A . A 1 26 ASP 26 26 ASP ASP A . A 1 27 ARG 27 27 ARG ARG A . A 1 28 GLY 28 28 GLY GLY A . A 1 29 LYS 29 29 LYS LYS A . A 1 30 LEU 30 30 LEU LEU A . A 1 31 PRO 31 31 PRO PRO A . A 1 32 GLY 32 32 GLY GLY A . A 1 33 LYS 33 33 LYS LYS A . A 1 34 LYS 34 34 LYS LYS A . A 1 35 LEU 35 35 LEU LEU A . A 1 36 PRO 36 36 PRO PRO A . A 1 37 LEU 37 37 LEU LEU A . A 1 38 GLU 38 38 GLU GLU A . A 1 39 VAL 39 39 VAL VAL A . A 1 40 LEU 40 40 LEU LEU A . A 1 41 LYS 41 41 LYS LYS A . A 1 42 GLU 42 42 GLU GLU A . A 1 43 MET 43 43 MET MET A . A 1 44 GLU 44 44 GLU GLU A . A 1 45 ALA 45 45 ALA ALA A . A 1 46 ASN 46 46 ASN ASN A . A 1 47 ALA 47 47 ALA ALA A . A 1 48 ARG 48 48 ARG ARG A . A 1 49 LYS 49 49 LYS LYS A . A 1 50 ALA 50 50 ALA ALA A . A 1 51 GLY 51 51 GLY GLY A . A 1 52 CYS 52 52 CYS CYS A . A 1 53 THR 53 53 THR THR A . A 1 54 ARG 54 54 ARG ARG A . A 1 55 GLY 55 55 GLY GLY A . A 1 56 CYS 56 56 CYS CYS A . A 1 57 LEU 57 57 LEU LEU A . A 1 58 ILE 58 58 ILE ILE A . A 1 59 CYS 59 59 CYS CYS A . A 1 60 LEU 60 60 LEU LEU A . A 1 61 SER 61 61 SER SER A . A 1 62 HIS 62 62 HIS HIS A . A 1 63 ILE 63 63 ILE ILE A . A 1 64 LYS 64 64 LYS LYS A . A 1 65 CYS 65 65 CYS CYS A . A 1 66 THR 66 66 THR THR A . A 1 67 PRO 67 67 PRO PRO A . A 1 68 LYS 68 68 LYS LYS A . A 1 69 MET 69 69 MET MET A . A 1 70 LYS 70 70 LYS LYS A . A 1 71 LYS 71 71 LYS LYS A . A 1 72 PHE 72 72 PHE PHE A . A 1 73 ILE 73 73 ILE ILE A . A 1 74 PRO 74 74 PRO PRO A . A 1 75 GLY 75 75 GLY GLY A . A 1 76 ARG 76 76 ARG ARG A . A 1 77 CYS 77 77 CYS CYS A . A 1 78 HIS 78 78 HIS HIS A . A 1 79 THR 79 79 THR THR A . A 1 80 TYR 80 80 TYR TYR A . A 1 81 GLU 81 81 GLU GLU A . A 1 82 GLY 82 82 GLY GLY A . A 1 83 ASP 83 83 ASP ASP A . A 1 84 LYS 84 84 LYS LYS A . A 1 85 GLU 85 85 GLU GLU A . A 1 86 SER 86 86 SER SER A . A 1 87 ALA 87 87 ALA ALA A . A 1 88 GLN 88 88 GLN GLN A . A 1 89 GLY 89 89 GLY GLY A . A 1 90 GLY 90 90 GLY GLY A . A 1 91 ILE 91 91 ILE ILE A . A 1 92 GLY 92 92 GLY GLY A . A 1 93 GLU 93 93 GLU GLU A . A 1 94 ALA 94 94 ALA ALA A . A 1 95 ILE 95 95 ILE ILE A . A 1 96 VAL 96 96 VAL VAL A . A 1 97 ASP 97 97 ASP ASP A . A 1 98 ILE 98 98 ILE ILE A . A 1 99 PRO 99 99 PRO PRO A . A 1 100 ALA 100 100 ALA ALA A . A 1 101 ILE 101 101 ILE ILE A . A 1 102 PRO 102 102 PRO PRO A . A 1 103 ARG 103 103 ARG ARG A . A 1 104 PHE 104 104 PHE PHE A . A 1 105 LYS 105 105 LYS LYS A . A 1 106 ASP 106 106 ASP ASP A . A 1 107 LEU 107 107 LEU LEU A . A 1 108 GLU 108 108 GLU GLU A . A 1 109 PRO 109 109 PRO PRO A . A 1 110 MET 110 110 MET MET A . A 1 111 GLU 111 111 GLU GLU A . A 1 112 GLN 112 112 GLN GLN A . A 1 113 PHE 113 113 PHE PHE A . A 1 114 ILE 114 114 ILE ILE A . A 1 115 ALA 115 115 ALA ALA A . A 1 116 GLN 116 116 GLN GLN A . A 1 117 VAL 117 117 VAL VAL A . A 1 118 ASP 118 118 ASP ASP A . A 1 119 LEU 119 119 LEU LEU A . A 1 120 CYS 120 120 CYS CYS A . A 1 121 VAL 121 121 VAL VAL A . A 1 122 ASP 122 122 ASP ASP A . A 1 123 CYS 123 123 CYS CYS A . A 1 124 THR 124 124 THR THR A . A 1 125 THR 125 125 THR THR A . A 1 126 GLY 126 126 GLY GLY A . A 1 127 CYS 127 127 CYS CYS A . A 1 128 LEU 128 128 LEU LEU A . A 1 129 LYS 129 129 LYS LYS A . A 1 130 GLY 130 130 GLY GLY A . A 1 131 LEU 131 131 LEU LEU A . A 1 132 ALA 132 132 ALA ALA A . A 1 133 ASN 133 133 ASN ASN A . A 1 134 VAL 134 134 VAL VAL A . A 1 135 GLN 135 135 GLN GLN A . A 1 136 CYS 136 136 CYS CYS A . A 1 137 SER 137 137 SER SER A . A 1 138 ASP 138 138 ASP ASP A . A 1 139 LEU 139 139 LEU LEU A . A 1 140 LEU 140 140 LEU LEU A . A 1 141 LYS 141 141 LYS LYS A . A 1 142 LYS 142 142 LYS LYS A . A 1 143 TRP 143 143 TRP TRP A . A 1 144 LEU 144 144 LEU LEU A . A 1 145 PRO 145 145 PRO PRO A . A 1 146 GLN 146 146 GLN GLN A . A 1 147 ARG 147 147 ARG ARG A . A 1 148 CYS 148 148 CYS CYS A . A 1 149 ALA 149 149 ALA ALA A . A 1 150 THR 150 150 THR THR A . A 1 151 PHE 151 151 PHE PHE A . A 1 152 ALA 152 152 ALA ALA A . A 1 153 SER 153 153 SER SER A . A 1 154 LYS 154 154 LYS LYS A . A 1 155 ILE 155 155 ILE ILE A . A 1 156 GLN 156 156 GLN GLN A . A 1 157 GLY 157 157 GLY GLY A . A 1 158 GLN 158 158 GLN GLN A . A 1 159 VAL 159 159 VAL VAL A . A 1 160 ASP 160 160 ASP ASP A . A 1 161 LYS 161 161 LYS LYS A . A 1 162 ILE 162 162 ILE ILE A . A 1 163 LYS 163 163 LYS LYS A . A 1 164 GLY 164 164 GLY GLY A . A 1 165 ALA 165 165 ALA ALA A . A 1 166 GLY 166 166 GLY GLY A . A 1 167 GLY 167 167 GLY GLY A . A 1 168 ASP 168 168 ASP ASP A . # # loop_ # #