data_9ATX # _entry.id 9ATX # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.399 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 9ATX pdb_00009atx 10.2210/pdb9atx/pdb WWPDB D_1000281940 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2024-03-06 2 'Structure model' 1 1 2024-11-20 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_audit_revision_group.ordinal 1 _pdbx_audit_revision_group.revision_ordinal 2 _pdbx_audit_revision_group.data_content_type 'Structure model' _pdbx_audit_revision_group.group 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' pdbx_entry_details 2 2 'Structure model' pdbx_modification_feature # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 9ATX _pdbx_database_status.recvd_initial_deposition_date 2024-02-27 _pdbx_database_status.SG_entry Y _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_database_related.db_name TargetTrack _pdbx_database_related.db_id IDP01167 _pdbx_database_related.content_type unspecified _pdbx_database_related.details . # _pdbx_contact_author.id 2 _pdbx_contact_author.email andrzejj@anl.gov _pdbx_contact_author.name_first Andrzej _pdbx_contact_author.name_last Joachimiak _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0003-2535-6209 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Osipiuk, J.' 1 ? 'Koehler, T.M.' 2 ? 'Joachimiak, A.' 3 ? 'Center for Structural Biology of Infectious Diseases (CSBID)' 4 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'AcpB protein from Bacillus anthracis, N-terminal part' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Osipiuk, J.' 1 ? primary 'Koehler, T.M.' 2 ? primary 'Joachimiak, A.' 3 ? primary 'Center for Structural Biology of Infectious Diseases (CSBID)' 4 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Capsule synthesis positive regulator AcpB' 32998.047 1 ? ? ? 'Three N-terminal residues, SNA, are cloning artifacts' 2 water nat water 18.015 57 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;SNAMEKDIKRQIQILEIITSEEKWFTTIEISKILRCCNKTIMKDISFIKDFLPEDWHIKIKKGKGVRIYLPYNKHRNEIT FLLFRESLTFRILQHLFERETKTIATLAERLYIQVPSILPALKRVENYLKKFGLKLRKKPLRLEGDEVRIMIMYLDLYLK SYNDTEWPFEKLKKEVIFQYLGTLEESLGISLHVVSKRHLSFFIAILLKRKQQGYKVQLNRKFLYFNTETPDYVKIGRIF EKLEREFGVSLTVQDKILLTISIKSSKYVYKDINK ; _entity_poly.pdbx_seq_one_letter_code_can ;SNAMEKDIKRQIQILEIITSEEKWFTTIEISKILRCCNKTIMKDISFIKDFLPEDWHIKIKKGKGVRIYLPYNKHRNEIT FLLFRESLTFRILQHLFERETKTIATLAERLYIQVPSILPALKRVENYLKKFGLKLRKKPLRLEGDEVRIMIMYLDLYLK SYNDTEWPFEKLKKEVIFQYLGTLEESLGISLHVVSKRHLSFFIAILLKRKQQGYKVQLNRKFLYFNTETPDYVKIGRIF EKLEREFGVSLTVQDKILLTISIKSSKYVYKDINK ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier IDP01167 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 SER n 1 2 ASN n 1 3 ALA n 1 4 MET n 1 5 GLU n 1 6 LYS n 1 7 ASP n 1 8 ILE n 1 9 LYS n 1 10 ARG n 1 11 GLN n 1 12 ILE n 1 13 GLN n 1 14 ILE n 1 15 LEU n 1 16 GLU n 1 17 ILE n 1 18 ILE n 1 19 THR n 1 20 SER n 1 21 GLU n 1 22 GLU n 1 23 LYS n 1 24 TRP n 1 25 PHE n 1 26 THR n 1 27 THR n 1 28 ILE n 1 29 GLU n 1 30 ILE n 1 31 SER n 1 32 LYS n 1 33 ILE n 1 34 LEU n 1 35 ARG n 1 36 CYS n 1 37 CYS n 1 38 ASN n 1 39 LYS n 1 40 THR n 1 41 ILE n 1 42 MET n 1 43 LYS n 1 44 ASP n 1 45 ILE n 1 46 SER n 1 47 PHE n 1 48 ILE n 1 49 LYS n 1 50 ASP n 1 51 PHE n 1 52 LEU n 1 53 PRO n 1 54 GLU n 1 55 ASP n 1 56 TRP n 1 57 HIS n 1 58 ILE n 1 59 LYS n 1 60 ILE n 1 61 LYS n 1 62 LYS n 1 63 GLY n 1 64 LYS n 1 65 GLY n 1 66 VAL n 1 67 ARG n 1 68 ILE n 1 69 TYR n 1 70 LEU n 1 71 PRO n 1 72 TYR n 1 73 ASN n 1 74 LYS n 1 75 HIS n 1 76 ARG n 1 77 ASN n 1 78 GLU n 1 79 ILE n 1 80 THR n 1 81 PHE n 1 82 LEU n 1 83 LEU n 1 84 PHE n 1 85 ARG n 1 86 GLU n 1 87 SER n 1 88 LEU n 1 89 THR n 1 90 PHE n 1 91 ARG n 1 92 ILE n 1 93 LEU n 1 94 GLN n 1 95 HIS n 1 96 LEU n 1 97 PHE n 1 98 GLU n 1 99 ARG n 1 100 GLU n 1 101 THR n 1 102 LYS n 1 103 THR n 1 104 ILE n 1 105 ALA n 1 106 THR n 1 107 LEU n 1 108 ALA n 1 109 GLU n 1 110 ARG n 1 111 LEU n 1 112 TYR n 1 113 ILE n 1 114 GLN n 1 115 VAL n 1 116 PRO n 1 117 SER n 1 118 ILE n 1 119 LEU n 1 120 PRO n 1 121 ALA n 1 122 LEU n 1 123 LYS n 1 124 ARG n 1 125 VAL n 1 126 GLU n 1 127 ASN n 1 128 TYR n 1 129 LEU n 1 130 LYS n 1 131 LYS n 1 132 PHE n 1 133 GLY n 1 134 LEU n 1 135 LYS n 1 136 LEU n 1 137 ARG n 1 138 LYS n 1 139 LYS n 1 140 PRO n 1 141 LEU n 1 142 ARG n 1 143 LEU n 1 144 GLU n 1 145 GLY n 1 146 ASP n 1 147 GLU n 1 148 VAL n 1 149 ARG n 1 150 ILE n 1 151 MET n 1 152 ILE n 1 153 MET n 1 154 TYR n 1 155 LEU n 1 156 ASP n 1 157 LEU n 1 158 TYR n 1 159 LEU n 1 160 LYS n 1 161 SER n 1 162 TYR n 1 163 ASN n 1 164 ASP n 1 165 THR n 1 166 GLU n 1 167 TRP n 1 168 PRO n 1 169 PHE n 1 170 GLU n 1 171 LYS n 1 172 LEU n 1 173 LYS n 1 174 LYS n 1 175 GLU n 1 176 VAL n 1 177 ILE n 1 178 PHE n 1 179 GLN n 1 180 TYR n 1 181 LEU n 1 182 GLY n 1 183 THR n 1 184 LEU n 1 185 GLU n 1 186 GLU n 1 187 SER n 1 188 LEU n 1 189 GLY n 1 190 ILE n 1 191 SER n 1 192 LEU n 1 193 HIS n 1 194 VAL n 1 195 VAL n 1 196 SER n 1 197 LYS n 1 198 ARG n 1 199 HIS n 1 200 LEU n 1 201 SER n 1 202 PHE n 1 203 PHE n 1 204 ILE n 1 205 ALA n 1 206 ILE n 1 207 LEU n 1 208 LEU n 1 209 LYS n 1 210 ARG n 1 211 LYS n 1 212 GLN n 1 213 GLN n 1 214 GLY n 1 215 TYR n 1 216 LYS n 1 217 VAL n 1 218 GLN n 1 219 LEU n 1 220 ASN n 1 221 ARG n 1 222 LYS n 1 223 PHE n 1 224 LEU n 1 225 TYR n 1 226 PHE n 1 227 ASN n 1 228 THR n 1 229 GLU n 1 230 THR n 1 231 PRO n 1 232 ASP n 1 233 TYR n 1 234 VAL n 1 235 LYS n 1 236 ILE n 1 237 GLY n 1 238 ARG n 1 239 ILE n 1 240 PHE n 1 241 GLU n 1 242 LYS n 1 243 LEU n 1 244 GLU n 1 245 ARG n 1 246 GLU n 1 247 PHE n 1 248 GLY n 1 249 VAL n 1 250 SER n 1 251 LEU n 1 252 THR n 1 253 VAL n 1 254 GLN n 1 255 ASP n 1 256 LYS n 1 257 ILE n 1 258 LEU n 1 259 LEU n 1 260 THR n 1 261 ILE n 1 262 SER n 1 263 ILE n 1 264 LYS n 1 265 SER n 1 266 SER n 1 267 LYS n 1 268 TYR n 1 269 VAL n 1 270 TYR n 1 271 LYS n 1 272 ASP n 1 273 ILE n 1 274 ASN n 1 275 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 275 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'acpB, pXO2-53, BXB0060, GBAA_pXO2_0060' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Bacillus anthracis str. Ames' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 198094 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pMCSG68 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 SER 1 -2 ? ? ? A . n A 1 2 ASN 2 -1 ? ? ? A . n A 1 3 ALA 3 0 0 ALA ALA A . n A 1 4 MET 4 1 1 MET MET A . n A 1 5 GLU 5 2 2 GLU GLU A . n A 1 6 LYS 6 3 3 LYS LYS A . n A 1 7 ASP 7 4 4 ASP ASP A . n A 1 8 ILE 8 5 5 ILE ILE A . n A 1 9 LYS 9 6 6 LYS LYS A . n A 1 10 ARG 10 7 7 ARG ARG A . n A 1 11 GLN 11 8 8 GLN GLN A . n A 1 12 ILE 12 9 9 ILE ILE A . n A 1 13 GLN 13 10 10 GLN GLN A . n A 1 14 ILE 14 11 11 ILE ILE A . n A 1 15 LEU 15 12 12 LEU LEU A . n A 1 16 GLU 16 13 13 GLU GLU A . n A 1 17 ILE 17 14 14 ILE ILE A . n A 1 18 ILE 18 15 15 ILE ILE A . n A 1 19 THR 19 16 16 THR THR A . n A 1 20 SER 20 17 17 SER SER A . n A 1 21 GLU 21 18 18 GLU GLU A . n A 1 22 GLU 22 19 19 GLU GLU A . n A 1 23 LYS 23 20 20 LYS LYS A . n A 1 24 TRP 24 21 21 TRP TRP A . n A 1 25 PHE 25 22 22 PHE PHE A . n A 1 26 THR 26 23 23 THR THR A . n A 1 27 THR 27 24 24 THR THR A . n A 1 28 ILE 28 25 25 ILE ILE A . n A 1 29 GLU 29 26 26 GLU GLU A . n A 1 30 ILE 30 27 27 ILE ILE A . n A 1 31 SER 31 28 28 SER SER A . n A 1 32 LYS 32 29 29 LYS LYS A . n A 1 33 ILE 33 30 30 ILE ILE A . n A 1 34 LEU 34 31 31 LEU LEU A . n A 1 35 ARG 35 32 32 ARG ARG A . n A 1 36 CYS 36 33 33 CYS CYS A . n A 1 37 CYS 37 34 34 CYS CYS A . n A 1 38 ASN 38 35 35 ASN ASN A . n A 1 39 LYS 39 36 36 LYS LYS A . n A 1 40 THR 40 37 37 THR THR A . n A 1 41 ILE 41 38 38 ILE ILE A . n A 1 42 MET 42 39 39 MET MET A . n A 1 43 LYS 43 40 40 LYS LYS A . n A 1 44 ASP 44 41 41 ASP ASP A . n A 1 45 ILE 45 42 42 ILE ILE A . n A 1 46 SER 46 43 43 SER SER A . n A 1 47 PHE 47 44 44 PHE PHE A . n A 1 48 ILE 48 45 45 ILE ILE A . n A 1 49 LYS 49 46 46 LYS LYS A . n A 1 50 ASP 50 47 47 ASP ASP A . n A 1 51 PHE 51 48 48 PHE PHE A . n A 1 52 LEU 52 49 49 LEU LEU A . n A 1 53 PRO 53 50 50 PRO PRO A . n A 1 54 GLU 54 51 51 GLU GLU A . n A 1 55 ASP 55 52 52 ASP ASP A . n A 1 56 TRP 56 53 53 TRP TRP A . n A 1 57 HIS 57 54 54 HIS HIS A . n A 1 58 ILE 58 55 55 ILE ILE A . n A 1 59 LYS 59 56 56 LYS LYS A . n A 1 60 ILE 60 57 57 ILE ILE A . n A 1 61 LYS 61 58 58 LYS LYS A . n A 1 62 LYS 62 59 59 LYS LYS A . n A 1 63 GLY 63 60 60 GLY GLY A . n A 1 64 LYS 64 61 61 LYS LYS A . n A 1 65 GLY 65 62 62 GLY GLY A . n A 1 66 VAL 66 63 63 VAL VAL A . n A 1 67 ARG 67 64 64 ARG ARG A . n A 1 68 ILE 68 65 65 ILE ILE A . n A 1 69 TYR 69 66 66 TYR TYR A . n A 1 70 LEU 70 67 67 LEU LEU A . n A 1 71 PRO 71 68 68 PRO PRO A . n A 1 72 TYR 72 69 ? ? ? A . n A 1 73 ASN 73 70 ? ? ? A . n A 1 74 LYS 74 71 71 LYS LYS A . n A 1 75 HIS 75 72 72 HIS HIS A . n A 1 76 ARG 76 73 73 ARG ARG A . n A 1 77 ASN 77 74 74 ASN ASN A . n A 1 78 GLU 78 75 75 GLU GLU A . n A 1 79 ILE 79 76 76 ILE ILE A . n A 1 80 THR 80 77 77 THR THR A . n A 1 81 PHE 81 78 78 PHE PHE A . n A 1 82 LEU 82 79 79 LEU LEU A . n A 1 83 LEU 83 80 80 LEU LEU A . n A 1 84 PHE 84 81 81 PHE PHE A . n A 1 85 ARG 85 82 82 ARG ARG A . n A 1 86 GLU 86 83 83 GLU GLU A . n A 1 87 SER 87 84 84 SER SER A . n A 1 88 LEU 88 85 85 LEU LEU A . n A 1 89 THR 89 86 86 THR THR A . n A 1 90 PHE 90 87 87 PHE PHE A . n A 1 91 ARG 91 88 88 ARG ARG A . n A 1 92 ILE 92 89 89 ILE ILE A . n A 1 93 LEU 93 90 90 LEU LEU A . n A 1 94 GLN 94 91 91 GLN GLN A . n A 1 95 HIS 95 92 92 HIS HIS A . n A 1 96 LEU 96 93 93 LEU LEU A . n A 1 97 PHE 97 94 94 PHE PHE A . n A 1 98 GLU 98 95 95 GLU GLU A . n A 1 99 ARG 99 96 96 ARG ARG A . n A 1 100 GLU 100 97 97 GLU GLU A . n A 1 101 THR 101 98 98 THR THR A . n A 1 102 LYS 102 99 99 LYS LYS A . n A 1 103 THR 103 100 100 THR THR A . n A 1 104 ILE 104 101 101 ILE ILE A . n A 1 105 ALA 105 102 102 ALA ALA A . n A 1 106 THR 106 103 103 THR THR A . n A 1 107 LEU 107 104 104 LEU LEU A . n A 1 108 ALA 108 105 105 ALA ALA A . n A 1 109 GLU 109 106 106 GLU GLU A . n A 1 110 ARG 110 107 107 ARG ARG A . n A 1 111 LEU 111 108 108 LEU LEU A . n A 1 112 TYR 112 109 109 TYR TYR A . n A 1 113 ILE 113 110 110 ILE ILE A . n A 1 114 GLN 114 111 111 GLN GLN A . n A 1 115 VAL 115 112 112 VAL VAL A . n A 1 116 PRO 116 113 113 PRO PRO A . n A 1 117 SER 117 114 114 SER SER A . n A 1 118 ILE 118 115 115 ILE ILE A . n A 1 119 LEU 119 116 116 LEU LEU A . n A 1 120 PRO 120 117 117 PRO PRO A . n A 1 121 ALA 121 118 118 ALA ALA A . n A 1 122 LEU 122 119 119 LEU LEU A . n A 1 123 LYS 123 120 120 LYS LYS A . n A 1 124 ARG 124 121 121 ARG ARG A . n A 1 125 VAL 125 122 122 VAL VAL A . n A 1 126 GLU 126 123 123 GLU GLU A . n A 1 127 ASN 127 124 124 ASN ASN A . n A 1 128 TYR 128 125 125 TYR TYR A . n A 1 129 LEU 129 126 126 LEU LEU A . n A 1 130 LYS 130 127 127 LYS LYS A . n A 1 131 LYS 131 128 128 LYS LYS A . n A 1 132 PHE 132 129 129 PHE PHE A . n A 1 133 GLY 133 130 130 GLY GLY A . n A 1 134 LEU 134 131 131 LEU LEU A . n A 1 135 LYS 135 132 132 LYS LYS A . n A 1 136 LEU 136 133 133 LEU LEU A . n A 1 137 ARG 137 134 134 ARG ARG A . n A 1 138 LYS 138 135 135 LYS LYS A . n A 1 139 LYS 139 136 136 LYS LYS A . n A 1 140 PRO 140 137 137 PRO PRO A . n A 1 141 LEU 141 138 138 LEU LEU A . n A 1 142 ARG 142 139 139 ARG ARG A . n A 1 143 LEU 143 140 140 LEU LEU A . n A 1 144 GLU 144 141 141 GLU GLU A . n A 1 145 GLY 145 142 142 GLY GLY A . n A 1 146 ASP 146 143 143 ASP ASP A . n A 1 147 GLU 147 144 144 GLU GLU A . n A 1 148 VAL 148 145 145 VAL VAL A . n A 1 149 ARG 149 146 146 ARG ARG A . n A 1 150 ILE 150 147 147 ILE ILE A . n A 1 151 MET 151 148 148 MET MET A . n A 1 152 ILE 152 149 149 ILE ILE A . n A 1 153 MET 153 150 150 MET MET A . n A 1 154 TYR 154 151 151 TYR TYR A . n A 1 155 LEU 155 152 152 LEU LEU A . n A 1 156 ASP 156 153 153 ASP ASP A . n A 1 157 LEU 157 154 154 LEU LEU A . n A 1 158 TYR 158 155 155 TYR TYR A . n A 1 159 LEU 159 156 156 LEU LEU A . n A 1 160 LYS 160 157 157 LYS LYS A . n A 1 161 SER 161 158 158 SER SER A . n A 1 162 TYR 162 159 159 TYR TYR A . n A 1 163 ASN 163 160 160 ASN ASN A . n A 1 164 ASP 164 161 161 ASP ASP A . n A 1 165 THR 165 162 162 THR THR A . n A 1 166 GLU 166 163 163 GLU GLU A . n A 1 167 TRP 167 164 164 TRP TRP A . n A 1 168 PRO 168 165 165 PRO PRO A . n A 1 169 PHE 169 166 166 PHE PHE A . n A 1 170 GLU 170 167 167 GLU GLU A . n A 1 171 LYS 171 168 168 LYS LYS A . n A 1 172 LEU 172 169 169 LEU LEU A . n A 1 173 LYS 173 170 170 LYS LYS A . n A 1 174 LYS 174 171 171 LYS LYS A . n A 1 175 GLU 175 172 172 GLU GLU A . n A 1 176 VAL 176 173 173 VAL VAL A . n A 1 177 ILE 177 174 174 ILE ILE A . n A 1 178 PHE 178 175 175 PHE PHE A . n A 1 179 GLN 179 176 176 GLN GLN A . n A 1 180 TYR 180 177 177 TYR TYR A . n A 1 181 LEU 181 178 178 LEU LEU A . n A 1 182 GLY 182 179 179 GLY GLY A . n A 1 183 THR 183 180 180 THR THR A . n A 1 184 LEU 184 181 181 LEU LEU A . n A 1 185 GLU 185 182 182 GLU GLU A . n A 1 186 GLU 186 183 183 GLU GLU A . n A 1 187 SER 187 184 184 SER SER A . n A 1 188 LEU 188 185 185 LEU LEU A . n A 1 189 GLY 189 186 186 GLY GLY A . n A 1 190 ILE 190 187 187 ILE ILE A . n A 1 191 SER 191 188 188 SER SER A . n A 1 192 LEU 192 189 189 LEU LEU A . n A 1 193 HIS 193 190 190 HIS HIS A . n A 1 194 VAL 194 191 191 VAL VAL A . n A 1 195 VAL 195 192 192 VAL VAL A . n A 1 196 SER 196 193 193 SER SER A . n A 1 197 LYS 197 194 194 LYS LYS A . n A 1 198 ARG 198 195 195 ARG ARG A . n A 1 199 HIS 199 196 196 HIS HIS A . n A 1 200 LEU 200 197 197 LEU LEU A . n A 1 201 SER 201 198 198 SER SER A . n A 1 202 PHE 202 199 199 PHE PHE A . n A 1 203 PHE 203 200 200 PHE PHE A . n A 1 204 ILE 204 201 201 ILE ILE A . n A 1 205 ALA 205 202 202 ALA ALA A . n A 1 206 ILE 206 203 203 ILE ILE A . n A 1 207 LEU 207 204 204 LEU LEU A . n A 1 208 LEU 208 205 205 LEU LEU A . n A 1 209 LYS 209 206 206 LYS LYS A . n A 1 210 ARG 210 207 207 ARG ARG A . n A 1 211 LYS 211 208 208 LYS LYS A . n A 1 212 GLN 212 209 209 GLN GLN A . n A 1 213 GLN 213 210 210 GLN GLN A . n A 1 214 GLY 214 211 211 GLY GLY A . n A 1 215 TYR 215 212 212 TYR TYR A . n A 1 216 LYS 216 213 213 LYS LYS A . n A 1 217 VAL 217 214 214 VAL VAL A . n A 1 218 GLN 218 215 215 GLN GLN A . n A 1 219 LEU 219 216 216 LEU LEU A . n A 1 220 ASN 220 217 217 ASN ASN A . n A 1 221 ARG 221 218 218 ARG ARG A . n A 1 222 LYS 222 219 219 LYS LYS A . n A 1 223 PHE 223 220 220 PHE PHE A . n A 1 224 LEU 224 221 221 LEU LEU A . n A 1 225 TYR 225 222 222 TYR TYR A . n A 1 226 PHE 226 223 223 PHE PHE A . n A 1 227 ASN 227 224 224 ASN ASN A . n A 1 228 THR 228 225 225 THR THR A . n A 1 229 GLU 229 226 226 GLU GLU A . n A 1 230 THR 230 227 227 THR THR A . n A 1 231 PRO 231 228 228 PRO PRO A . n A 1 232 ASP 232 229 229 ASP ASP A . n A 1 233 TYR 233 230 230 TYR TYR A . n A 1 234 VAL 234 231 231 VAL VAL A . n A 1 235 LYS 235 232 232 LYS LYS A . n A 1 236 ILE 236 233 233 ILE ILE A . n A 1 237 GLY 237 234 234 GLY GLY A . n A 1 238 ARG 238 235 235 ARG ARG A . n A 1 239 ILE 239 236 236 ILE ILE A . n A 1 240 PHE 240 237 237 PHE PHE A . n A 1 241 GLU 241 238 238 GLU GLU A . n A 1 242 LYS 242 239 239 LYS LYS A . n A 1 243 LEU 243 240 240 LEU LEU A . n A 1 244 GLU 244 241 241 GLU GLU A . n A 1 245 ARG 245 242 242 ARG ARG A . n A 1 246 GLU 246 243 243 GLU GLU A . n A 1 247 PHE 247 244 244 PHE PHE A . n A 1 248 GLY 248 245 245 GLY GLY A . n A 1 249 VAL 249 246 246 VAL VAL A . n A 1 250 SER 250 247 247 SER SER A . n A 1 251 LEU 251 248 248 LEU LEU A . n A 1 252 THR 252 249 249 THR THR A . n A 1 253 VAL 253 250 250 VAL VAL A . n A 1 254 GLN 254 251 251 GLN GLN A . n A 1 255 ASP 255 252 252 ASP ASP A . n A 1 256 LYS 256 253 253 LYS LYS A . n A 1 257 ILE 257 254 254 ILE ILE A . n A 1 258 LEU 258 255 255 LEU LEU A . n A 1 259 LEU 259 256 256 LEU LEU A . n A 1 260 THR 260 257 257 THR THR A . n A 1 261 ILE 261 258 258 ILE ILE A . n A 1 262 SER 262 259 259 SER SER A . n A 1 263 ILE 263 260 260 ILE ILE A . n A 1 264 LYS 264 261 261 LYS LYS A . n A 1 265 SER 265 262 262 SER SER A . n A 1 266 SER 266 263 263 SER SER A . n A 1 267 LYS 267 264 264 LYS LYS A . n A 1 268 TYR 268 265 265 TYR TYR A . n A 1 269 VAL 269 266 266 VAL VAL A . n A 1 270 TYR 270 267 267 TYR TYR A . n A 1 271 LYS 271 268 268 LYS LYS A . n A 1 272 ASP 272 269 269 ASP ASP A . n A 1 273 ILE 273 270 ? ? ? A . n A 1 274 ASN 274 271 ? ? ? A . n A 1 275 LYS 275 272 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HOH 1 301 56 HOH HOH A . B 2 HOH 2 302 36 HOH HOH A . B 2 HOH 3 303 37 HOH HOH A . B 2 HOH 4 304 40 HOH HOH A . B 2 HOH 5 305 49 HOH HOH A . B 2 HOH 6 306 7 HOH HOH A . B 2 HOH 7 307 9 HOH HOH A . B 2 HOH 8 308 29 HOH HOH A . B 2 HOH 9 309 48 HOH HOH A . B 2 HOH 10 310 21 HOH HOH A . B 2 HOH 11 311 3 HOH HOH A . B 2 HOH 12 312 23 HOH HOH A . B 2 HOH 13 313 42 HOH HOH A . B 2 HOH 14 314 46 HOH HOH A . B 2 HOH 15 315 27 HOH HOH A . B 2 HOH 16 316 30 HOH HOH A . B 2 HOH 17 317 44 HOH HOH A . B 2 HOH 18 318 35 HOH HOH A . B 2 HOH 19 319 8 HOH HOH A . B 2 HOH 20 320 22 HOH HOH A . B 2 HOH 21 321 24 HOH HOH A . B 2 HOH 22 322 31 HOH HOH A . B 2 HOH 23 323 28 HOH HOH A . B 2 HOH 24 324 6 HOH HOH A . B 2 HOH 25 325 1 HOH HOH A . B 2 HOH 26 326 15 HOH HOH A . B 2 HOH 27 327 19 HOH HOH A . B 2 HOH 28 328 52 HOH HOH A . B 2 HOH 29 329 17 HOH HOH A . B 2 HOH 30 330 34 HOH HOH A . B 2 HOH 31 331 10 HOH HOH A . B 2 HOH 32 332 18 HOH HOH A . B 2 HOH 33 333 41 HOH HOH A . B 2 HOH 34 334 12 HOH HOH A . B 2 HOH 35 335 53 HOH HOH A . B 2 HOH 36 336 43 HOH HOH A . B 2 HOH 37 337 51 HOH HOH A . B 2 HOH 38 338 26 HOH HOH A . B 2 HOH 39 339 4 HOH HOH A . B 2 HOH 40 340 11 HOH HOH A . B 2 HOH 41 341 39 HOH HOH A . B 2 HOH 42 342 16 HOH HOH A . B 2 HOH 43 343 47 HOH HOH A . B 2 HOH 44 344 50 HOH HOH A . B 2 HOH 45 345 38 HOH HOH A . B 2 HOH 46 346 20 HOH HOH A . B 2 HOH 47 347 14 HOH HOH A . B 2 HOH 48 348 5 HOH HOH A . B 2 HOH 49 349 33 HOH HOH A . B 2 HOH 50 350 13 HOH HOH A . B 2 HOH 51 351 2 HOH HOH A . B 2 HOH 52 352 57 HOH HOH A . B 2 HOH 53 353 45 HOH HOH A . B 2 HOH 54 354 25 HOH HOH A . B 2 HOH 55 355 55 HOH HOH A . B 2 HOH 56 356 54 HOH HOH A . B 2 HOH 57 357 32 HOH HOH A . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0425 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-3000 ? ? ? . 2 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-3000 ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? HKL-3000 ? ? ? . 4 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 9ATX _cell.details ? _cell.formula_units_Z ? _cell.length_a 46.546 _cell.length_a_esd ? _cell.length_b 63.520 _cell.length_b_esd ? _cell.length_c 119.426 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 9ATX _symmetry.cell_setting ? _symmetry.Int_Tables_number 19 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 9ATX _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.68 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 54.02 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 8.8 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '4.3% PEG-3000, 25% PEG-1000, 0.05 M Bicine pH 8.8' _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 277 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'ADSC QUANTUM 315r' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2016-04-15 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9792 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'APS BEAMLINE 19-ID' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9792 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 19-ID _diffrn_source.pdbx_synchrotron_site APS # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 9ATX _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.11 _reflns.d_resolution_low 43.54 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 20624 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 97.5 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 5.6 _reflns.pdbx_netI_over_av_sigmaI 26.0 _reflns.pdbx_netI_over_sigmaI 7.8 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared 1.136 _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.070 _reflns.pdbx_Rpim_I_all 0.028 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.999 _reflns.pdbx_CC_star 1.000 _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs 0.063 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_CC_star _reflns_shell.pdbx_R_split _reflns_shell.percent_possible_all _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_percent_possible_ellipsoidal _reflns_shell.pdbx_percent_possible_spherical _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous _reflns_shell.pdbx_percent_possible_spherical_anomalous _reflns_shell.pdbx_redundancy_anomalous _reflns_shell.pdbx_CC_half_anomalous _reflns_shell.pdbx_absDiff_over_sigma_anomalous _reflns_shell.pdbx_percent_possible_anomalous 2.11 2.15 ? 1.08 ? ? ? ? 744 ? ? ? ? ? ? ? ? ? ? ? 2.0 1.057 ? ? 0.915 0.554 ? 1 1 0.503 0.818 ? 74.0 ? 0.721 ? ? ? ? ? ? ? ? ? 2.15 2.19 ? ? ? ? ? ? 903 ? ? ? ? ? ? ? ? ? ? ? 2.4 1.051 ? ? 0.836 0.479 ? 2 1 0.538 0.837 ? 85.3 ? 0.678 ? ? ? ? ? ? ? ? ? 2.19 2.23 ? ? ? ? ? ? 957 ? ? ? ? ? ? ? ? ? ? ? 3.0 0.987 ? ? 0.742 0.396 ? 3 1 0.638 0.883 ? 93.1 ? 0.622 ? ? ? ? ? ? ? ? ? 2.23 2.27 ? ? ? ? ? ? 1012 ? ? ? ? ? ? ? ? ? ? ? 3.8 1.037 ? ? 0.668 0.330 ? 4 1 0.720 0.915 ? 97.6 ? 0.576 ? ? ? ? ? ? ? ? ? 2.27 2.32 ? ? ? ? ? ? 1039 ? ? ? ? ? ? ? ? ? ? ? 4.5 1.035 ? ? 0.541 0.247 ? 5 1 0.834 0.954 ? 99.5 ? 0.479 ? ? ? ? ? ? ? ? ? 2.32 2.38 ? ? ? ? ? ? 1038 ? ? ? ? ? ? ? ? ? ? ? 5.3 1.044 ? ? 0.482 0.206 ? 6 1 0.867 0.964 ? 99.7 ? 0.434 ? ? ? ? ? ? ? ? ? 2.38 2.44 ? ? ? ? ? ? 1032 ? ? ? ? ? ? ? ? ? ? ? 5.4 1.077 ? ? 0.415 0.175 ? 7 1 0.905 0.975 ? 99.9 ? 0.375 ? ? ? ? ? ? ? ? ? 2.44 2.50 ? ? ? ? ? ? 1031 ? ? ? ? ? ? ? ? ? ? ? 6.0 1.039 ? ? 0.355 0.143 ? 8 1 0.933 0.983 ? 99.9 ? 0.324 ? ? ? ? ? ? ? ? ? 2.50 2.58 ? ? ? ? ? ? 1055 ? ? ? ? ? ? ? ? ? ? ? 6.6 1.040 ? ? 0.304 0.117 ? 9 1 0.957 0.989 ? 100.0 ? 0.280 ? ? ? ? ? ? ? ? ? 2.58 2.66 ? ? ? ? ? ? 1050 ? ? ? ? ? ? ? ? ? ? ? 6.7 1.077 ? ? 0.256 0.099 ? 10 1 0.968 0.992 ? 99.7 ? 0.236 ? ? ? ? ? ? ? ? ? 2.66 2.75 ? ? ? ? ? ? 1044 ? ? ? ? ? ? ? ? ? ? ? 6.6 1.089 ? ? 0.205 0.079 ? 11 1 0.983 0.996 ? 100.0 ? 0.188 ? ? ? ? ? ? ? ? ? 2.75 2.86 ? ? ? ? ? ? 1055 ? ? ? ? ? ? ? ? ? ? ? 6.5 1.059 ? ? 0.164 0.064 ? 12 1 0.987 0.997 ? 100.0 ? 0.150 ? ? ? ? ? ? ? ? ? 2.86 2.99 ? ? ? ? ? ? 1035 ? ? ? ? ? ? ? ? ? ? ? 5.9 1.077 ? ? 0.125 0.051 ? 13 1 0.991 0.998 ? 99.6 ? 0.114 ? ? ? ? ? ? ? ? ? 2.99 3.15 ? ? ? ? ? ? 1074 ? ? ? ? ? ? ? ? ? ? ? 6.6 1.117 ? ? 0.102 0.039 ? 14 1 0.995 0.999 ? 100.0 ? 0.094 ? ? ? ? ? ? ? ? ? 3.15 3.35 ? ? ? ? ? ? 1059 ? ? ? ? ? ? ? ? ? ? ? 6.7 1.182 ? ? 0.086 0.033 ? 15 1 0.995 0.999 ? 100.0 ? 0.079 ? ? ? ? ? ? ? ? ? 3.35 3.61 ? ? ? ? ? ? 1058 ? ? ? ? ? ? ? ? ? ? ? 6.6 1.208 ? ? 0.063 0.025 ? 16 1 0.998 0.999 ? 99.9 ? 0.058 ? ? ? ? ? ? ? ? ? 3.61 3.97 ? ? ? ? ? ? 1075 ? ? ? ? ? ? ? ? ? ? ? 6.0 1.309 ? ? 0.053 0.022 ? 17 1 0.998 1.000 ? 100.0 ? 0.049 ? ? ? ? ? ? ? ? ? 3.97 4.54 ? ? ? ? ? ? 1081 ? ? ? ? ? ? ? ? ? ? ? 6.7 1.303 ? ? 0.046 0.018 ? 18 1 0.998 1.000 ? 100.0 ? 0.043 ? ? ? ? ? ? ? ? ? 4.54 5.72 ? ? ? ? ? ? 1102 ? ? ? ? ? ? ? ? ? ? ? 6.2 1.227 ? ? 0.044 0.017 ? 19 1 0.998 1.000 ? 99.7 ? 0.040 ? ? ? ? ? ? ? ? ? 5.72 43.54 ? ? ? ? ? ? 1180 ? ? ? ? ? ? ? ? ? ? ? 5.8 1.333 ? ? 0.038 0.016 ? 20 1 0.999 1.000 ? 99.7 ? 0.035 ? ? ? ? ? ? ? ? ? # _refine.aniso_B[1][1] 1.21 _refine.aniso_B[1][2] 0.00 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][2] 0.37 _refine.aniso_B[2][3] -0.00 _refine.aniso_B[3][3] -1.57 _refine.B_iso_max ? _refine.B_iso_mean 53.577 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc 0.961 _refine.correlation_coeff_Fo_to_Fc_free 0.945 _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 9ATX _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.11 _refine.ls_d_res_low 43.54 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 19550 _refine.ls_number_reflns_R_free 1024 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 97.35 _refine.ls_percent_reflns_R_free 5.0 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.20338 _refine.ls_R_factor_R_free 0.24552 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.20104 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details MASK _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct SAD _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.209 _refine.pdbx_overall_ESU_R_Free 0.184 _refine.pdbx_solvent_vdw_probe_radii 1.20 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 12.568 _refine.overall_SU_ML 0.152 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id 1 _refine_hist.details ? _refine_hist.d_res_high 2.11 _refine_hist.d_res_low 43.54 _refine_hist.number_atoms_solvent 57 _refine_hist.number_atoms_total 2325 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 2268 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.008 0.012 2336 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 0.001 0.016 2394 ? r_bond_other_d ? ? 'X-RAY DIFFRACTION' ? 1.675 1.876 3138 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 0.544 1.791 5523 ? r_angle_other_deg ? ? 'X-RAY DIFFRACTION' ? 6.492 5.000 272 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 6.457 5.000 17 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 16.298 10.000 493 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.081 0.200 356 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.007 0.020 2593 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 0.001 0.020 537 ? r_gen_planes_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbd_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbd_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbtor_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbtor_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_xyhbond_nbd_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_xyhbond_nbd_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_metal_ion_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_metal_ion_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_vdw_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_vdw_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_hbond_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_hbond_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_metal_ion_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_metal_ion_other ? ? 'X-RAY DIFFRACTION' ? 4.220 4.299 1076 ? r_mcbond_it ? ? 'X-RAY DIFFRACTION' ? 4.220 4.300 1076 ? r_mcbond_other ? ? 'X-RAY DIFFRACTION' ? 5.958 7.702 1343 ? r_mcangle_it ? ? 'X-RAY DIFFRACTION' ? 5.956 7.705 1344 ? r_mcangle_other ? ? 'X-RAY DIFFRACTION' ? 5.027 5.011 1260 ? r_scbond_it ? ? 'X-RAY DIFFRACTION' ? 5.015 5.008 1259 ? r_scbond_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_scangle_it ? ? 'X-RAY DIFFRACTION' ? 7.948 8.918 1793 ? r_scangle_other ? ? 'X-RAY DIFFRACTION' ? 9.969 43.22 2681 ? r_long_range_B_refined ? ? 'X-RAY DIFFRACTION' ? 9.969 43.17 2669 ? r_long_range_B_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_rigid_bond_restr ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_sphericity_free ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_sphericity_bonded ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 2.11 _refine_ls_shell.d_res_low 2.162 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 57 _refine_ls_shell.number_reflns_R_work 1088 _refine_ls_shell.percent_reflns_obs 75.53 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.R_factor_R_work 0.324 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_R_complete ? _refine_ls_shell.pdbx_total_number_of_bins_used ? _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? _refine_ls_shell.R_factor_R_free 0.336 # _struct.entry_id 9ATX _struct.title 'AcpB protein from Bacillus anthracis, N-terminal part' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 9ATX _struct_keywords.text ;AcpB, transcription regulator, virulence, Structural Genomics, Center for Structural Biology of Infectious Diseases, CSBID, TRANSCRIPTION ; _struct_keywords.pdbx_keywords TRANSCRIPTION # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code ACPB_BACAN _struct_ref.pdbx_db_accession Q9RMX9 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MEKDIKRQIQILEIITSEEKWFTTIEISKILRCCNKTIMKDISFIKDFLPEDWHIKIKKGKGVRIYLPYNKHRNEITFLL FRESLTFRILQHLFERETKTIATLAERLYIQVPSILPALKRVENYLKKFGLKLRKKPLRLEGDEVRIMIMYLDLYLKSYN DTEWPFEKLKKEVIFQYLGTLEESLGISLHVVSKRHLSFFIAILLKRKQQGYKVQLNRKFLYFNTETPDYVKIGRIFEKL EREFGVSLTVQDKILLTISIKSSKYVYKDINK ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 9ATX _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 4 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 275 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9RMX9 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 272 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 272 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 9ATX SER A 1 ? UNP Q9RMX9 ? ? 'expression tag' -2 1 1 9ATX ASN A 2 ? UNP Q9RMX9 ? ? 'expression tag' -1 2 1 9ATX ALA A 3 ? UNP Q9RMX9 ? ? 'expression tag' 0 3 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 LYS A 6 ? THR A 19 ? LYS A 3 THR A 16 1 ? 14 HELX_P HELX_P2 AA2 THR A 26 ? ARG A 35 ? THR A 23 ARG A 32 1 ? 10 HELX_P HELX_P3 AA3 CYS A 37 ? LYS A 39 ? CYS A 34 LYS A 36 5 ? 3 HELX_P HELX_P4 AA4 THR A 40 ? LYS A 49 ? THR A 37 LYS A 46 1 ? 10 HELX_P HELX_P5 AA5 ASP A 50 ? LEU A 52 ? ASP A 47 LEU A 49 5 ? 3 HELX_P HELX_P6 AA6 LEU A 82 ? SER A 87 ? LEU A 79 SER A 84 1 ? 6 HELX_P HELX_P7 AA7 SER A 87 ? LEU A 96 ? SER A 84 LEU A 93 1 ? 10 HELX_P HELX_P8 AA8 THR A 103 ? TYR A 112 ? THR A 100 TYR A 109 1 ? 10 HELX_P HELX_P9 AA9 GLN A 114 ? LYS A 131 ? GLN A 111 LYS A 128 1 ? 18 HELX_P HELX_P10 AB1 ASP A 146 ? TYR A 162 ? ASP A 143 TYR A 159 1 ? 17 HELX_P HELX_P11 AB2 LYS A 173 ? GLY A 189 ? LYS A 170 GLY A 186 1 ? 17 HELX_P HELX_P12 AB3 HIS A 193 ? GLN A 213 ? HIS A 190 GLN A 210 1 ? 21 HELX_P HELX_P13 AB4 ARG A 221 ? PHE A 226 ? ARG A 218 PHE A 223 5 ? 6 HELX_P HELX_P14 AB5 THR A 230 ? GLY A 248 ? THR A 227 GLY A 245 1 ? 19 HELX_P HELX_P15 AB6 THR A 252 ? SER A 265 ? THR A 249 SER A 262 1 ? 14 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id disulf1 _struct_conn.conn_type_id disulf _struct_conn.pdbx_leaving_atom_flag ? _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id CYS _struct_conn.ptnr1_label_seq_id 36 _struct_conn.ptnr1_label_atom_id SG _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id A _struct_conn.ptnr2_label_comp_id CYS _struct_conn.ptnr2_label_seq_id 37 _struct_conn.ptnr2_label_atom_id SG _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id CYS _struct_conn.ptnr1_auth_seq_id 33 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id CYS _struct_conn.ptnr2_auth_seq_id 34 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 2.117 _struct_conn.pdbx_value_order ? _struct_conn.pdbx_role ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # _pdbx_modification_feature.ordinal 1 _pdbx_modification_feature.label_comp_id CYS _pdbx_modification_feature.label_asym_id A _pdbx_modification_feature.label_seq_id 36 _pdbx_modification_feature.label_alt_id ? _pdbx_modification_feature.modified_residue_label_comp_id CYS _pdbx_modification_feature.modified_residue_label_asym_id A _pdbx_modification_feature.modified_residue_label_seq_id 37 _pdbx_modification_feature.modified_residue_label_alt_id ? _pdbx_modification_feature.auth_comp_id CYS _pdbx_modification_feature.auth_asym_id A _pdbx_modification_feature.auth_seq_id 33 _pdbx_modification_feature.PDB_ins_code ? _pdbx_modification_feature.symmetry 1_555 _pdbx_modification_feature.modified_residue_auth_comp_id CYS _pdbx_modification_feature.modified_residue_auth_asym_id A _pdbx_modification_feature.modified_residue_auth_seq_id 34 _pdbx_modification_feature.modified_residue_PDB_ins_code ? _pdbx_modification_feature.modified_residue_symmetry 1_555 _pdbx_modification_feature.comp_id_linking_atom SG _pdbx_modification_feature.modified_residue_id_linking_atom SG _pdbx_modification_feature.modified_residue_id . _pdbx_modification_feature.ref_pcm_id . _pdbx_modification_feature.ref_comp_id . _pdbx_modification_feature.type None _pdbx_modification_feature.category 'Disulfide bridge' # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id LYS _struct_mon_prot_cis.label_seq_id 139 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id LYS _struct_mon_prot_cis.auth_seq_id 136 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 140 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 137 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle -14.54 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 2 ? AA2 ? 2 ? AA3 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA2 1 2 ? anti-parallel AA3 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 HIS A 57 ? LYS A 61 ? HIS A 54 LYS A 58 AA1 2 GLY A 65 ? TYR A 69 ? GLY A 62 TYR A 66 AA2 1 LYS A 135 ? ARG A 137 ? LYS A 132 ARG A 134 AA2 2 ARG A 142 ? GLU A 144 ? ARG A 139 GLU A 141 AA3 1 ILE A 190 ? LEU A 192 ? ILE A 187 LEU A 189 AA3 2 TYR A 268 ? TYR A 270 ? TYR A 265 TYR A 267 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N LYS A 59 ? N LYS A 56 O ARG A 67 ? O ARG A 64 AA2 1 2 N LYS A 135 ? N LYS A 132 O GLU A 144 ? O GLU A 141 AA3 1 2 N SER A 191 ? N SER A 188 O VAL A 269 ? O VAL A 266 # _pdbx_entry_details.entry_id 9ATX _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'NIAID, National Institute of Allergy and Infectious Diseases' _pdbx_SG_project.full_name_of_center 'Center for Structural Biology of Infectious Diseases' _pdbx_SG_project.initial_of_center CSBID # _pdbx_refine_tls.id 1 _pdbx_refine_tls.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls.details ? _pdbx_refine_tls.method refined _pdbx_refine_tls.origin_x 30.1551 _pdbx_refine_tls.origin_y 32.6906 _pdbx_refine_tls.origin_z 11.6715 _pdbx_refine_tls.T[1][1] 0.0500 _pdbx_refine_tls.T[1][1]_esd ? _pdbx_refine_tls.T[1][2] -0.0304 _pdbx_refine_tls.T[1][2]_esd ? _pdbx_refine_tls.T[1][3] -0.0363 _pdbx_refine_tls.T[1][3]_esd ? _pdbx_refine_tls.T[2][2] 0.0189 _pdbx_refine_tls.T[2][2]_esd ? _pdbx_refine_tls.T[2][3] 0.0174 _pdbx_refine_tls.T[2][3]_esd ? _pdbx_refine_tls.T[3][3] 0.1036 _pdbx_refine_tls.T[3][3]_esd ? _pdbx_refine_tls.L[1][1] 0.4556 _pdbx_refine_tls.L[1][1]_esd ? _pdbx_refine_tls.L[1][2] 0.1768 _pdbx_refine_tls.L[1][2]_esd ? _pdbx_refine_tls.L[1][3] -0.1848 _pdbx_refine_tls.L[1][3]_esd ? _pdbx_refine_tls.L[2][2] 0.5684 _pdbx_refine_tls.L[2][2]_esd ? _pdbx_refine_tls.L[2][3] -0.1965 _pdbx_refine_tls.L[2][3]_esd ? _pdbx_refine_tls.L[3][3] 0.3743 _pdbx_refine_tls.L[3][3]_esd ? _pdbx_refine_tls.S[1][1] 0.1126 _pdbx_refine_tls.S[1][1]_esd ? _pdbx_refine_tls.S[1][2] -0.0679 _pdbx_refine_tls.S[1][2]_esd ? _pdbx_refine_tls.S[1][3] -0.0208 _pdbx_refine_tls.S[1][3]_esd ? _pdbx_refine_tls.S[2][1] -0.0093 _pdbx_refine_tls.S[2][1]_esd ? _pdbx_refine_tls.S[2][2] 0.0182 _pdbx_refine_tls.S[2][2]_esd ? _pdbx_refine_tls.S[2][3] -0.0808 _pdbx_refine_tls.S[2][3]_esd ? _pdbx_refine_tls.S[3][1] 0.0339 _pdbx_refine_tls.S[3][1]_esd ? _pdbx_refine_tls.S[3][2] -0.0192 _pdbx_refine_tls.S[3][2]_esd ? _pdbx_refine_tls.S[3][3] -0.1308 _pdbx_refine_tls.S[3][3]_esd ? # _pdbx_refine_tls_group.id 1 _pdbx_refine_tls_group.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls_group.refine_tls_id 1 _pdbx_refine_tls_group.beg_label_asym_id ? _pdbx_refine_tls_group.beg_label_seq_id ? _pdbx_refine_tls_group.beg_auth_asym_id A _pdbx_refine_tls_group.beg_auth_seq_id 0 _pdbx_refine_tls_group.beg_PDB_ins_code ? _pdbx_refine_tls_group.end_label_asym_id ? _pdbx_refine_tls_group.end_label_seq_id ? _pdbx_refine_tls_group.end_auth_asym_id A _pdbx_refine_tls_group.end_auth_seq_id 269 _pdbx_refine_tls_group.end_PDB_ins_code ? _pdbx_refine_tls_group.selection ? _pdbx_refine_tls_group.selection_details ? # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A SER -2 ? A SER 1 2 1 Y 1 A ASN -1 ? A ASN 2 3 1 Y 1 A TYR 69 ? A TYR 72 4 1 Y 1 A ASN 70 ? A ASN 73 5 1 Y 1 A ILE 270 ? A ILE 273 6 1 Y 1 A ASN 271 ? A ASN 274 7 1 Y 1 A LYS 272 ? A LYS 275 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 HOH O O N N 158 HOH H1 H N N 159 HOH H2 H N N 160 ILE N N N N 161 ILE CA C N S 162 ILE C C N N 163 ILE O O N N 164 ILE CB C N S 165 ILE CG1 C N N 166 ILE CG2 C N N 167 ILE CD1 C N N 168 ILE OXT O N N 169 ILE H H N N 170 ILE H2 H N N 171 ILE HA H N N 172 ILE HB H N N 173 ILE HG12 H N N 174 ILE HG13 H N N 175 ILE HG21 H N N 176 ILE HG22 H N N 177 ILE HG23 H N N 178 ILE HD11 H N N 179 ILE HD12 H N N 180 ILE HD13 H N N 181 ILE HXT H N N 182 LEU N N N N 183 LEU CA C N S 184 LEU C C N N 185 LEU O O N N 186 LEU CB C N N 187 LEU CG C N N 188 LEU CD1 C N N 189 LEU CD2 C N N 190 LEU OXT O N N 191 LEU H H N N 192 LEU H2 H N N 193 LEU HA H N N 194 LEU HB2 H N N 195 LEU HB3 H N N 196 LEU HG H N N 197 LEU HD11 H N N 198 LEU HD12 H N N 199 LEU HD13 H N N 200 LEU HD21 H N N 201 LEU HD22 H N N 202 LEU HD23 H N N 203 LEU HXT H N N 204 LYS N N N N 205 LYS CA C N S 206 LYS C C N N 207 LYS O O N N 208 LYS CB C N N 209 LYS CG C N N 210 LYS CD C N N 211 LYS CE C N N 212 LYS NZ N N N 213 LYS OXT O N N 214 LYS H H N N 215 LYS H2 H N N 216 LYS HA H N N 217 LYS HB2 H N N 218 LYS HB3 H N N 219 LYS HG2 H N N 220 LYS HG3 H N N 221 LYS HD2 H N N 222 LYS HD3 H N N 223 LYS HE2 H N N 224 LYS HE3 H N N 225 LYS HZ1 H N N 226 LYS HZ2 H N N 227 LYS HZ3 H N N 228 LYS HXT H N N 229 MET N N N N 230 MET CA C N S 231 MET C C N N 232 MET O O N N 233 MET CB C N N 234 MET CG C N N 235 MET SD S N N 236 MET CE C N N 237 MET OXT O N N 238 MET H H N N 239 MET H2 H N N 240 MET HA H N N 241 MET HB2 H N N 242 MET HB3 H N N 243 MET HG2 H N N 244 MET HG3 H N N 245 MET HE1 H N N 246 MET HE2 H N N 247 MET HE3 H N N 248 MET HXT H N N 249 PHE N N N N 250 PHE CA C N S 251 PHE C C N N 252 PHE O O N N 253 PHE CB C N N 254 PHE CG C Y N 255 PHE CD1 C Y N 256 PHE CD2 C Y N 257 PHE CE1 C Y N 258 PHE CE2 C Y N 259 PHE CZ C Y N 260 PHE OXT O N N 261 PHE H H N N 262 PHE H2 H N N 263 PHE HA H N N 264 PHE HB2 H N N 265 PHE HB3 H N N 266 PHE HD1 H N N 267 PHE HD2 H N N 268 PHE HE1 H N N 269 PHE HE2 H N N 270 PHE HZ H N N 271 PHE HXT H N N 272 PRO N N N N 273 PRO CA C N S 274 PRO C C N N 275 PRO O O N N 276 PRO CB C N N 277 PRO CG C N N 278 PRO CD C N N 279 PRO OXT O N N 280 PRO H H N N 281 PRO HA H N N 282 PRO HB2 H N N 283 PRO HB3 H N N 284 PRO HG2 H N N 285 PRO HG3 H N N 286 PRO HD2 H N N 287 PRO HD3 H N N 288 PRO HXT H N N 289 SER N N N N 290 SER CA C N S 291 SER C C N N 292 SER O O N N 293 SER CB C N N 294 SER OG O N N 295 SER OXT O N N 296 SER H H N N 297 SER H2 H N N 298 SER HA H N N 299 SER HB2 H N N 300 SER HB3 H N N 301 SER HG H N N 302 SER HXT H N N 303 THR N N N N 304 THR CA C N S 305 THR C C N N 306 THR O O N N 307 THR CB C N R 308 THR OG1 O N N 309 THR CG2 C N N 310 THR OXT O N N 311 THR H H N N 312 THR H2 H N N 313 THR HA H N N 314 THR HB H N N 315 THR HG1 H N N 316 THR HG21 H N N 317 THR HG22 H N N 318 THR HG23 H N N 319 THR HXT H N N 320 TRP N N N N 321 TRP CA C N S 322 TRP C C N N 323 TRP O O N N 324 TRP CB C N N 325 TRP CG C Y N 326 TRP CD1 C Y N 327 TRP CD2 C Y N 328 TRP NE1 N Y N 329 TRP CE2 C Y N 330 TRP CE3 C Y N 331 TRP CZ2 C Y N 332 TRP CZ3 C Y N 333 TRP CH2 C Y N 334 TRP OXT O N N 335 TRP H H N N 336 TRP H2 H N N 337 TRP HA H N N 338 TRP HB2 H N N 339 TRP HB3 H N N 340 TRP HD1 H N N 341 TRP HE1 H N N 342 TRP HE3 H N N 343 TRP HZ2 H N N 344 TRP HZ3 H N N 345 TRP HH2 H N N 346 TRP HXT H N N 347 TYR N N N N 348 TYR CA C N S 349 TYR C C N N 350 TYR O O N N 351 TYR CB C N N 352 TYR CG C Y N 353 TYR CD1 C Y N 354 TYR CD2 C Y N 355 TYR CE1 C Y N 356 TYR CE2 C Y N 357 TYR CZ C Y N 358 TYR OH O N N 359 TYR OXT O N N 360 TYR H H N N 361 TYR H2 H N N 362 TYR HA H N N 363 TYR HB2 H N N 364 TYR HB3 H N N 365 TYR HD1 H N N 366 TYR HD2 H N N 367 TYR HE1 H N N 368 TYR HE2 H N N 369 TYR HH H N N 370 TYR HXT H N N 371 VAL N N N N 372 VAL CA C N S 373 VAL C C N N 374 VAL O O N N 375 VAL CB C N N 376 VAL CG1 C N N 377 VAL CG2 C N N 378 VAL OXT O N N 379 VAL H H N N 380 VAL H2 H N N 381 VAL HA H N N 382 VAL HB H N N 383 VAL HG11 H N N 384 VAL HG12 H N N 385 VAL HG13 H N N 386 VAL HG21 H N N 387 VAL HG22 H N N 388 VAL HG23 H N N 389 VAL HXT H N N 390 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MET N CA sing N N 218 MET N H sing N N 219 MET N H2 sing N N 220 MET CA C sing N N 221 MET CA CB sing N N 222 MET CA HA sing N N 223 MET C O doub N N 224 MET C OXT sing N N 225 MET CB CG sing N N 226 MET CB HB2 sing N N 227 MET CB HB3 sing N N 228 MET CG SD sing N N 229 MET CG HG2 sing N N 230 MET CG HG3 sing N N 231 MET SD CE sing N N 232 MET CE HE1 sing N N 233 MET CE HE2 sing N N 234 MET CE HE3 sing N N 235 MET OXT HXT sing N N 236 PHE N CA sing N N 237 PHE N H sing N N 238 PHE N H2 sing N N 239 PHE CA C sing N N 240 PHE CA CB sing N N 241 PHE CA HA sing N N 242 PHE C O doub N N 243 PHE C OXT sing N N 244 PHE CB CG sing N N 245 PHE CB HB2 sing N N 246 PHE CB HB3 sing N N 247 PHE CG CD1 doub Y N 248 PHE CG CD2 sing Y N 249 PHE CD1 CE1 sing Y N 250 PHE CD1 HD1 sing N N 251 PHE CD2 CE2 doub Y N 252 PHE CD2 HD2 sing N N 253 PHE CE1 CZ doub Y N 254 PHE CE1 HE1 sing N N 255 PHE CE2 CZ sing Y N 256 PHE CE2 HE2 sing N N 257 PHE CZ HZ sing N N 258 PHE OXT HXT sing N N 259 PRO N CA sing N N 260 PRO N CD sing N N 261 PRO N H sing N N 262 PRO CA C sing N N 263 PRO CA CB sing N N 264 PRO CA HA sing N N 265 PRO C O doub N N 266 PRO C OXT sing N N 267 PRO CB CG sing N N 268 PRO CB HB2 sing N N 269 PRO CB HB3 sing N N 270 PRO CG CD sing N N 271 PRO CG HG2 sing N N 272 PRO CG HG3 sing N N 273 PRO CD HD2 sing N N 274 PRO CD HD3 sing N N 275 PRO OXT HXT sing N N 276 SER N CA sing N N 277 SER N H sing N N 278 SER N H2 sing N N 279 SER CA C sing N N 280 SER CA CB sing N N 281 SER CA HA sing N N 282 SER C O doub N N 283 SER C OXT sing N N 284 SER CB OG sing N N 285 SER CB HB2 sing N N 286 SER CB HB3 sing N N 287 SER OG HG sing N N 288 SER OXT HXT sing N N 289 THR N CA sing N N 290 THR N H sing N N 291 THR N H2 sing N N 292 THR CA C sing N N 293 THR CA CB sing N N 294 THR CA HA sing N N 295 THR C O doub N N 296 THR C OXT sing N N 297 THR CB OG1 sing N N 298 THR CB CG2 sing N N 299 THR CB HB sing N N 300 THR OG1 HG1 sing N N 301 THR CG2 HG21 sing N N 302 THR CG2 HG22 sing N N 303 THR CG2 HG23 sing N N 304 THR OXT HXT sing N N 305 TRP N CA sing N N 306 TRP N H sing N N 307 TRP N H2 sing N N 308 TRP CA C sing N N 309 TRP CA CB sing N N 310 TRP CA HA sing N N 311 TRP C O doub N N 312 TRP C OXT sing N N 313 TRP CB CG sing N N 314 TRP CB HB2 sing N N 315 TRP CB HB3 sing N N 316 TRP CG CD1 doub Y N 317 TRP CG CD2 sing Y N 318 TRP CD1 NE1 sing Y N 319 TRP CD1 HD1 sing N N 320 TRP CD2 CE2 doub Y N 321 TRP CD2 CE3 sing Y N 322 TRP NE1 CE2 sing Y N 323 TRP NE1 HE1 sing N N 324 TRP CE2 CZ2 sing Y N 325 TRP CE3 CZ3 doub Y N 326 TRP CE3 HE3 sing N N 327 TRP CZ2 CH2 doub Y N 328 TRP CZ2 HZ2 sing N N 329 TRP CZ3 CH2 sing Y N 330 TRP CZ3 HZ3 sing N N 331 TRP CH2 HH2 sing N N 332 TRP OXT HXT sing N N 333 TYR N CA sing N N 334 TYR N H sing N N 335 TYR N H2 sing N N 336 TYR CA C sing N N 337 TYR CA CB sing N N 338 TYR CA HA sing N N 339 TYR C O doub N N 340 TYR C OXT sing N N 341 TYR CB CG sing N N 342 TYR CB HB2 sing N N 343 TYR CB HB3 sing N N 344 TYR CG CD1 doub Y N 345 TYR CG CD2 sing Y N 346 TYR CD1 CE1 sing Y N 347 TYR CD1 HD1 sing N N 348 TYR CD2 CE2 doub Y N 349 TYR CD2 HD2 sing N N 350 TYR CE1 CZ doub Y N 351 TYR CE1 HE1 sing N N 352 TYR CE2 CZ sing Y N 353 TYR CE2 HE2 sing N N 354 TYR CZ OH sing N N 355 TYR OH HH sing N N 356 TYR OXT HXT sing N N 357 VAL N CA sing N N 358 VAL N H sing N N 359 VAL N H2 sing N N 360 VAL CA C sing N N 361 VAL CA CB sing N N 362 VAL CA HA sing N N 363 VAL C O doub N N 364 VAL C OXT sing N N 365 VAL CB CG1 sing N N 366 VAL CB CG2 sing N N 367 VAL CB HB sing N N 368 VAL CG1 HG11 sing N N 369 VAL CG1 HG12 sing N N 370 VAL CG1 HG13 sing N N 371 VAL CG2 HG21 sing N N 372 VAL CG2 HG22 sing N N 373 VAL CG2 HG23 sing N N 374 VAL OXT HXT sing N N 375 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'National Institutes of Health/National Institute Of Allergy and Infectious Diseases (NIH/NIAID)' 'United States' 75N93022C00035 1 'National Institutes of Health/National Institute Of Allergy and Infectious Diseases (NIH/NIAID)' 'United States' 'R01 AI033537' 2 # _atom_sites.entry_id 9ATX _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 0.021484 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] -0.000000 _atom_sites.fract_transf_matrix[2][2] 0.015743 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] -0.000000 _atom_sites.fract_transf_matrix[3][3] 0.008373 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C N O S # loop_ # loop_ #