data_9AVE # _entry.id 9AVE # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.403 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 9AVE pdb_00009ave 10.2210/pdb9ave/pdb WWPDB D_1000280734 ? ? # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2025-05-21 _pdbx_audit_revision_history.part_number ? # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 9AVE _pdbx_database_status.recvd_initial_deposition_date 2024-03-01 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_contact_author.id 3 _pdbx_contact_author.email soichi.wakatsuki@stanford.edu _pdbx_contact_author.name_first Soichi _pdbx_contact_author.name_last Wakatsuki _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0001-5896-7968 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Mathews, I.I.' 1 0000-0001-6254-3519 'Pokhrel, S.' 2 0000-0003-2258-8768 'Wakatsuki, S.' 3 0000-0001-5896-7968 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Nat Commun' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2041-1723 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 16 _citation.language ? _citation.page_first 4187 _citation.page_last 4187 _citation.title 'A hidden cysteine in Fis1 targeted to prevent excessive mitochondrial fission and dysfunction under oxidative stress.' _citation.year 2025 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1038/s41467-025-59434-6 _citation.pdbx_database_id_PubMed 40328741 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Pokhrel, S.' 1 0000-0003-2258-8768 primary 'Heo, G.' 2 0000-0001-5324-4074 primary 'Mathews, I.' 3 0000-0001-6254-3519 primary 'Yokoi, S.' 4 0000-0003-2684-3420 primary 'Matsui, T.' 5 0000-0001-7101-5259 primary 'Mitsutake, A.' 6 0000-0002-4194-7255 primary 'Wakatsuki, S.' 7 0000-0001-5896-7968 primary 'Mochly-Rosen, D.' 8 0000-0002-6691-8733 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Mitochondrial fission 1 protein' 15107.357 1 ? T34E ? ? 2 water nat water 18.015 19 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'FIS1 homolog,hFis1,Tetratricopeptide repeat protein 11,TPR repeat protein 11' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MEAVLNELVSVEDLLKFEKKFQSEKAAGSVSKSEQFEYAWCLVRSKYNDDIRKGIVLLEELLPKGSKEEQRDYVFYLAVG NYRLKEYEKALKYVRGLLQTEPQNNQAKELERLIDKAMKKDGLLEVLFQ ; _entity_poly.pdbx_seq_one_letter_code_can ;MEAVLNELVSVEDLLKFEKKFQSEKAAGSVSKSEQFEYAWCLVRSKYNDDIRKGIVLLEELLPKGSKEEQRDYVFYLAVG NYRLKEYEKALKYVRGLLQTEPQNNQAKELERLIDKAMKKDGLLEVLFQ ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLU n 1 3 ALA n 1 4 VAL n 1 5 LEU n 1 6 ASN n 1 7 GLU n 1 8 LEU n 1 9 VAL n 1 10 SER n 1 11 VAL n 1 12 GLU n 1 13 ASP n 1 14 LEU n 1 15 LEU n 1 16 LYS n 1 17 PHE n 1 18 GLU n 1 19 LYS n 1 20 LYS n 1 21 PHE n 1 22 GLN n 1 23 SER n 1 24 GLU n 1 25 LYS n 1 26 ALA n 1 27 ALA n 1 28 GLY n 1 29 SER n 1 30 VAL n 1 31 SER n 1 32 LYS n 1 33 SER n 1 34 GLU n 1 35 GLN n 1 36 PHE n 1 37 GLU n 1 38 TYR n 1 39 ALA n 1 40 TRP n 1 41 CYS n 1 42 LEU n 1 43 VAL n 1 44 ARG n 1 45 SER n 1 46 LYS n 1 47 TYR n 1 48 ASN n 1 49 ASP n 1 50 ASP n 1 51 ILE n 1 52 ARG n 1 53 LYS n 1 54 GLY n 1 55 ILE n 1 56 VAL n 1 57 LEU n 1 58 LEU n 1 59 GLU n 1 60 GLU n 1 61 LEU n 1 62 LEU n 1 63 PRO n 1 64 LYS n 1 65 GLY n 1 66 SER n 1 67 LYS n 1 68 GLU n 1 69 GLU n 1 70 GLN n 1 71 ARG n 1 72 ASP n 1 73 TYR n 1 74 VAL n 1 75 PHE n 1 76 TYR n 1 77 LEU n 1 78 ALA n 1 79 VAL n 1 80 GLY n 1 81 ASN n 1 82 TYR n 1 83 ARG n 1 84 LEU n 1 85 LYS n 1 86 GLU n 1 87 TYR n 1 88 GLU n 1 89 LYS n 1 90 ALA n 1 91 LEU n 1 92 LYS n 1 93 TYR n 1 94 VAL n 1 95 ARG n 1 96 GLY n 1 97 LEU n 1 98 LEU n 1 99 GLN n 1 100 THR n 1 101 GLU n 1 102 PRO n 1 103 GLN n 1 104 ASN n 1 105 ASN n 1 106 GLN n 1 107 ALA n 1 108 LYS n 1 109 GLU n 1 110 LEU n 1 111 GLU n 1 112 ARG n 1 113 LEU n 1 114 ILE n 1 115 ASP n 1 116 LYS n 1 117 ALA n 1 118 MET n 1 119 LYS n 1 120 LYS n 1 121 ASP n 1 122 GLY n 1 123 LEU n 1 124 LEU n 1 125 GLU n 1 126 VAL n 1 127 LEU n 1 128 PHE n 1 129 GLN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 129 _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'FIS1, TTC11, CGI-135' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell 'BL21 (DE3)' _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type pET-28a _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 GLU 2 2 ? ? ? A . n A 1 3 ALA 3 3 ? ? ? A . n A 1 4 VAL 4 4 ? ? ? A . n A 1 5 LEU 5 5 ? ? ? A . n A 1 6 ASN 6 6 ? ? ? A . n A 1 7 GLU 7 7 ? ? ? A . n A 1 8 LEU 8 8 ? ? ? A . n A 1 9 VAL 9 9 ? ? ? A . n A 1 10 SER 10 10 ? ? ? A . n A 1 11 VAL 11 11 ? ? ? A . n A 1 12 GLU 12 12 ? ? ? A . n A 1 13 ASP 13 13 ? ? ? A . n A 1 14 LEU 14 14 ? ? ? A . n A 1 15 LEU 15 15 ? ? ? A . n A 1 16 LYS 16 16 ? ? ? A . n A 1 17 PHE 17 17 ? ? ? A . n A 1 18 GLU 18 18 ? ? ? A . n A 1 19 LYS 19 19 ? ? ? A . n A 1 20 LYS 20 20 ? ? ? A . n A 1 21 PHE 21 21 ? ? ? A . n A 1 22 GLN 22 22 ? ? ? A . n A 1 23 SER 23 23 ? ? ? A . n A 1 24 GLU 24 24 ? ? ? A . n A 1 25 LYS 25 25 ? ? ? A . n A 1 26 ALA 26 26 ? ? ? A . n A 1 27 ALA 27 27 ? ? ? A . n A 1 28 GLY 28 28 ? ? ? A . n A 1 29 SER 29 29 ? ? ? A . n A 1 30 VAL 30 30 ? ? ? A . n A 1 31 SER 31 31 ? ? ? A . n A 1 32 LYS 32 32 32 LYS LYS A . n A 1 33 SER 33 33 33 SER SER A . n A 1 34 GLU 34 34 34 GLU GLU A . n A 1 35 GLN 35 35 35 GLN GLN A . n A 1 36 PHE 36 36 36 PHE PHE A . n A 1 37 GLU 37 37 37 GLU GLU A . n A 1 38 TYR 38 38 38 TYR TYR A . n A 1 39 ALA 39 39 39 ALA ALA A . n A 1 40 TRP 40 40 40 TRP TRP A . n A 1 41 CYS 41 41 41 CYS CYS A . n A 1 42 LEU 42 42 42 LEU LEU A . n A 1 43 VAL 43 43 43 VAL VAL A . n A 1 44 ARG 44 44 44 ARG ARG A . n A 1 45 SER 45 45 45 SER SER A . n A 1 46 LYS 46 46 46 LYS LYS A . n A 1 47 TYR 47 47 47 TYR TYR A . n A 1 48 ASN 48 48 48 ASN ASN A . n A 1 49 ASP 49 49 49 ASP ASP A . n A 1 50 ASP 50 50 50 ASP ASP A . n A 1 51 ILE 51 51 51 ILE ILE A . n A 1 52 ARG 52 52 52 ARG ARG A . n A 1 53 LYS 53 53 53 LYS LYS A . n A 1 54 GLY 54 54 54 GLY GLY A . n A 1 55 ILE 55 55 55 ILE ILE A . n A 1 56 VAL 56 56 56 VAL VAL A . n A 1 57 LEU 57 57 57 LEU LEU A . n A 1 58 LEU 58 58 58 LEU LEU A . n A 1 59 GLU 59 59 59 GLU GLU A . n A 1 60 GLU 60 60 60 GLU GLU A . n A 1 61 LEU 61 61 61 LEU LEU A . n A 1 62 LEU 62 62 62 LEU LEU A . n A 1 63 PRO 63 63 63 PRO PRO A . n A 1 64 LYS 64 64 64 LYS LYS A . n A 1 65 GLY 65 65 65 GLY GLY A . n A 1 66 SER 66 66 66 SER SER A . n A 1 67 LYS 67 67 67 LYS LYS A . n A 1 68 GLU 68 68 68 GLU GLU A . n A 1 69 GLU 69 69 69 GLU GLU A . n A 1 70 GLN 70 70 70 GLN GLN A . n A 1 71 ARG 71 71 71 ARG ARG A . n A 1 72 ASP 72 72 72 ASP ASP A . n A 1 73 TYR 73 73 73 TYR TYR A . n A 1 74 VAL 74 74 74 VAL VAL A . n A 1 75 PHE 75 75 75 PHE PHE A . n A 1 76 TYR 76 76 76 TYR TYR A . n A 1 77 LEU 77 77 77 LEU LEU A . n A 1 78 ALA 78 78 78 ALA ALA A . n A 1 79 VAL 79 79 79 VAL VAL A . n A 1 80 GLY 80 80 80 GLY GLY A . n A 1 81 ASN 81 81 81 ASN ASN A . n A 1 82 TYR 82 82 82 TYR TYR A . n A 1 83 ARG 83 83 83 ARG ARG A . n A 1 84 LEU 84 84 84 LEU LEU A . n A 1 85 LYS 85 85 85 LYS LYS A . n A 1 86 GLU 86 86 86 GLU GLU A . n A 1 87 TYR 87 87 87 TYR TYR A . n A 1 88 GLU 88 88 88 GLU GLU A . n A 1 89 LYS 89 89 89 LYS LYS A . n A 1 90 ALA 90 90 90 ALA ALA A . n A 1 91 LEU 91 91 91 LEU LEU A . n A 1 92 LYS 92 92 92 LYS LYS A . n A 1 93 TYR 93 93 93 TYR TYR A . n A 1 94 VAL 94 94 94 VAL VAL A . n A 1 95 ARG 95 95 95 ARG ARG A . n A 1 96 GLY 96 96 96 GLY GLY A . n A 1 97 LEU 97 97 97 LEU LEU A . n A 1 98 LEU 98 98 98 LEU LEU A . n A 1 99 GLN 99 99 99 GLN GLN A . n A 1 100 THR 100 100 100 THR THR A . n A 1 101 GLU 101 101 101 GLU GLU A . n A 1 102 PRO 102 102 102 PRO PRO A . n A 1 103 GLN 103 103 103 GLN GLN A . n A 1 104 ASN 104 104 104 ASN ASN A . n A 1 105 ASN 105 105 105 ASN ASN A . n A 1 106 GLN 106 106 106 GLN GLN A . n A 1 107 ALA 107 107 107 ALA ALA A . n A 1 108 LYS 108 108 108 LYS LYS A . n A 1 109 GLU 109 109 109 GLU GLU A . n A 1 110 LEU 110 110 110 LEU LEU A . n A 1 111 GLU 111 111 111 GLU GLU A . n A 1 112 ARG 112 112 112 ARG ARG A . n A 1 113 LEU 113 113 113 LEU LEU A . n A 1 114 ILE 114 114 114 ILE ILE A . n A 1 115 ASP 115 115 115 ASP ASP A . n A 1 116 LYS 116 116 116 LYS LYS A . n A 1 117 ALA 117 117 117 ALA ALA A . n A 1 118 MET 118 118 118 MET MET A . n A 1 119 LYS 119 119 119 LYS LYS A . n A 1 120 LYS 120 120 120 LYS LYS A . n A 1 121 ASP 121 121 121 ASP ASP A . n A 1 122 GLY 122 122 122 GLY GLY A . n A 1 123 LEU 123 123 123 LEU LEU A . n A 1 124 LEU 124 124 124 LEU LEU A . n A 1 125 GLU 125 125 125 GLU GLU A . n A 1 126 VAL 126 126 126 VAL VAL A . n A 1 127 LEU 127 127 127 LEU LEU A . n A 1 128 PHE 128 128 128 PHE PHE A . n A 1 129 GLN 129 129 129 GLN GLN A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HOH 1 201 18 HOH HOH A . B 2 HOH 2 202 3 HOH HOH A . B 2 HOH 3 203 7 HOH HOH A . B 2 HOH 4 204 13 HOH HOH A . B 2 HOH 5 205 16 HOH HOH A . B 2 HOH 6 206 10 HOH HOH A . B 2 HOH 7 207 1 HOH HOH A . B 2 HOH 8 208 2 HOH HOH A . B 2 HOH 9 209 11 HOH HOH A . B 2 HOH 10 210 19 HOH HOH A . B 2 HOH 11 211 6 HOH HOH A . B 2 HOH 12 212 8 HOH HOH A . B 2 HOH 13 213 9 HOH HOH A . B 2 HOH 14 214 15 HOH HOH A . B 2 HOH 15 215 17 HOH HOH A . B 2 HOH 16 216 4 HOH HOH A . B 2 HOH 17 217 12 HOH HOH A . B 2 HOH 18 218 14 HOH HOH A . B 2 HOH 19 219 5 HOH HOH A . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? '(1.20.1_4487: ???)' 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XSCALE ? ? ? . 2 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? MOLREP ? ? ? . 4 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 9AVE _cell.details ? _cell.formula_units_Z ? _cell.length_a 43.250 _cell.length_a_esd ? _cell.length_b 43.250 _cell.length_b_esd ? _cell.length_c 119.810 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 9AVE _symmetry.cell_setting ? _symmetry.Int_Tables_number 92 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 41 21 2' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 9AVE _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 1.85 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 33.67 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 7.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.2M Ammonium Acetate, 0.1M HEPES (pH 7.5), 25% PEG 3350' _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 292 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details 'Rh coated collimating mirrors, K-B focusing mirrors' _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2022-05-10 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator 'Si(111)' _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97946 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SSRL BEAMLINE BL12-2' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.97946 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL12-2 _diffrn_source.pdbx_synchrotron_site SSRL # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 9AVE _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.37 _reflns.d_resolution_low 35.1 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 5063 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 100.0 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 10.6 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 18.74 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.063 _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 1.0 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs 0.06 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_CC_star _reflns_shell.pdbx_R_split _reflns_shell.percent_possible_all _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_percent_possible_ellipsoidal _reflns_shell.pdbx_percent_possible_spherical _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous _reflns_shell.pdbx_percent_possible_spherical_anomalous _reflns_shell.pdbx_redundancy_anomalous _reflns_shell.pdbx_CC_half_anomalous _reflns_shell.pdbx_absDiff_over_sigma_anomalous _reflns_shell.pdbx_percent_possible_anomalous 2.37 2.43 ? ? ? ? ? ? 357 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 2.136 ? ? 1 1 0.654 ? ? ? ? 2.036 ? ? ? ? ? ? ? ? ? 2.43 2.5 ? ? ? ? ? ? 343 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 1.864 ? ? 2 1 0.7090000000000001 ? ? ? ? 1.765 ? ? ? ? ? ? ? ? ? 2.50 2.57 ? ? ? ? ? ? 351 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 1.2009999999999998 ? ? 3 1 0.83 ? ? ? ? 1.146 ? ? ? ? ? ? ? ? ? 2.57 2.65 ? ? ? ? ? ? 332 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 0.958 ? ? 4 1 0.9159999999999999 ? ? ? ? 0.917 ? ? ? ? ? ? ? ? ? 2.65 2.74 ? ? ? ? ? ? 333 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 0.83 ? ? 5 1 0.9359999999999999 ? ? ? ? 0.7929999999999999 ? ? ? ? ? ? ? ? ? 2.74 2.83 ? ? ? ? ? ? 313 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 0.544 ? ? 6 1 0.9670000000000001 ? ? ? ? 0.519 ? ? ? ? ? ? ? ? ? 2.83 2.94 ? ? ? ? ? ? 295 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 0.342 ? ? 7 1 0.992 ? ? ? ? 0.327 ? ? ? ? ? ? ? ? ? 2.94 3.06 ? ? ? ? ? ? 304 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 0.247 ? ? 8 1 0.992 ? ? ? ? 0.235 ? ? ? ? ? ? ? ? ? 3.06 3.2 ? ? ? ? ? ? 275 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 0.21100000000000002 ? ? 9 1 0.993 ? ? ? ? 0.201 ? ? ? ? ? ? ? ? ? 3.20 3.35 ? ? ? ? ? ? 287 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 0.142 ? ? 10 1 0.996 ? ? ? ? 0.135 ? ? ? ? ? ? ? ? ? 3.35 3.53 ? ? ? ? ? ? 251 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 0.09699999999999999 ? ? 11 1 0.998 ? ? ? ? 0.092 ? ? ? ? ? ? ? ? ? 3.53 3.75 ? ? ? ? ? ? 250 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 0.07200000000000001 ? ? 12 1 0.9990000000000001 ? ? ? ? 0.069 ? ? ? ? ? ? ? ? ? 3.75 4.01 ? ? ? ? ? ? 237 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 0.061 ? ? 13 1 0.9990000000000001 ? ? ? ? 0.057999999999999996 ? ? ? ? ? ? ? ? ? 4.01 4.33 ? ? ? ? ? ? 228 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 0.051 ? ? 14 1 0.9990000000000001 ? ? ? ? 0.048 ? ? ? ? ? ? ? ? ? 4.33 4.74 ? ? ? ? ? ? 198 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 0.042 ? ? 15 1 0.9990000000000001 ? ? ? ? 0.04 ? ? ? ? ? ? ? ? ? 4.74 5.3 ? ? ? ? ? ? 189 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 0.042 ? ? 16 1 0.9990000000000001 ? ? ? ? 0.04 ? ? ? ? ? ? ? ? ? 5.30 6.12 ? ? ? ? ? ? 180 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 0.038 ? ? 17 1 1.0 ? ? ? ? 0.036000000000000004 ? ? ? ? ? ? ? ? ? 6.12 7.5 ? ? ? ? ? ? 145 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 0.035 ? ? 18 1 0.9990000000000001 ? ? ? ? 0.033 ? ? ? ? ? ? ? ? ? 7.50 10.6 ? ? ? ? ? ? 120 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 0.026000000000000002 ? ? 19 1 1.0 ? ? ? ? 0.025 ? ? ? ? ? ? ? ? ? 10.60 35.1 ? ? ? ? ? ? 75 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 0.032 ? ? 20 1 1.0 ? ? ? ? 0.03 ? ? ? ? ? ? ? ? ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean ? _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 9AVE _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.37 _refine.ls_d_res_low 35.07 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 5059 _refine.ls_number_reflns_R_free 304 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.90 _refine.ls_percent_reflns_R_free 6.01 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2422 _refine.ls_R_factor_R_free 0.2907 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2389 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.34 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.10 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 39.11 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.39 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 823 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 19 _refine_hist.number_atoms_total 842 _refine_hist.d_res_high 2.37 _refine_hist.d_res_low 35.07 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.009 ? 836 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 1.085 ? 1119 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 5.562 ? 110 ? f_dihedral_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.054 ? 118 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.008 ? 143 ? f_plane_restr ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free _refine_ls_shell.R_factor_R_free 'X-RAY DIFFRACTION' 2.37 2.99 . . 146 2292 100.00 . . . . 0.3529 . . . . . . . . . . . 0.4282 'X-RAY DIFFRACTION' 2.99 35.07 . . 158 2463 100.00 . . . . 0.2209 . . . . . . . . . . . 0.2690 # _struct.entry_id 9AVE _struct.title 'Mitochondrial fission 1 protein Fis1 T34E mutation' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 9AVE _struct_keywords.text 'FIS1, mitochondrial fission, Drug design, UNKNOWN FUNCTION' _struct_keywords.pdbx_keywords 'UNKNOWN FUNCTION' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code FIS1_HUMAN _struct_ref.pdbx_db_accession Q9Y3D6 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MEAVLNELVSVEDLLKFEKKFQSEKAAGSVSKSTQFEYAWCLVRSKYNDDIRKGIVLLEELLPKGSKEEQRDYVFYLAVG NYRLKEYEKALKYVRGLLQTEPQNNQAKELERLIDKAMKKDGL ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 9AVE _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 123 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9Y3D6 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 123 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 123 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 9AVE GLU A 34 ? UNP Q9Y3D6 THR 34 'engineered mutation' 34 1 1 9AVE LEU A 124 ? UNP Q9Y3D6 ? ? 'expression tag' 124 2 1 9AVE GLU A 125 ? UNP Q9Y3D6 ? ? 'expression tag' 125 3 1 9AVE VAL A 126 ? UNP Q9Y3D6 ? ? 'expression tag' 126 4 1 9AVE LEU A 127 ? UNP Q9Y3D6 ? ? 'expression tag' 127 5 1 9AVE PHE A 128 ? UNP Q9Y3D6 ? ? 'expression tag' 128 6 1 9AVE GLN A 129 ? UNP Q9Y3D6 ? ? 'expression tag' 129 7 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 990 ? 1 MORE -6 ? 1 'SSA (A^2)' 12670 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 7_555 y,x,-z 0.0000000000 1.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 GLU A 34 ? ARG A 44 ? GLU A 34 ARG A 44 1 ? 11 HELX_P HELX_P2 AA2 TYR A 47 ? GLY A 65 ? TYR A 47 GLY A 65 1 ? 19 HELX_P HELX_P3 AA3 SER A 66 ? LEU A 84 ? SER A 66 LEU A 84 1 ? 19 HELX_P HELX_P4 AA4 GLU A 86 ? GLU A 101 ? GLU A 86 GLU A 101 1 ? 16 HELX_P HELX_P5 AA5 ASN A 104 ? VAL A 126 ? ASN A 104 VAL A 126 1 ? 23 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id disulf1 _struct_conn.conn_type_id disulf _struct_conn.pdbx_leaving_atom_flag ? _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id CYS _struct_conn.ptnr1_label_seq_id 41 _struct_conn.ptnr1_label_atom_id SG _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id A _struct_conn.ptnr2_label_comp_id CYS _struct_conn.ptnr2_label_seq_id 41 _struct_conn.ptnr2_label_atom_id SG _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id CYS _struct_conn.ptnr1_auth_seq_id 41 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id CYS _struct_conn.ptnr2_auth_seq_id 41 _struct_conn.ptnr2_symmetry 7_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 2.104 _struct_conn.pdbx_value_order ? _struct_conn.pdbx_role ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # _pdbx_modification_feature.ordinal 1 _pdbx_modification_feature.label_comp_id CYS _pdbx_modification_feature.label_asym_id A _pdbx_modification_feature.label_seq_id 41 _pdbx_modification_feature.label_alt_id ? _pdbx_modification_feature.modified_residue_label_comp_id CYS _pdbx_modification_feature.modified_residue_label_asym_id A _pdbx_modification_feature.modified_residue_label_seq_id 41 _pdbx_modification_feature.modified_residue_label_alt_id ? _pdbx_modification_feature.auth_comp_id CYS _pdbx_modification_feature.auth_asym_id A _pdbx_modification_feature.auth_seq_id 41 _pdbx_modification_feature.PDB_ins_code ? _pdbx_modification_feature.symmetry 1_555 _pdbx_modification_feature.modified_residue_auth_comp_id CYS _pdbx_modification_feature.modified_residue_auth_asym_id A _pdbx_modification_feature.modified_residue_auth_seq_id 41 _pdbx_modification_feature.modified_residue_PDB_ins_code ? _pdbx_modification_feature.modified_residue_symmetry 7_555 _pdbx_modification_feature.comp_id_linking_atom SG _pdbx_modification_feature.modified_residue_id_linking_atom SG _pdbx_modification_feature.modified_residue_id . _pdbx_modification_feature.ref_pcm_id . _pdbx_modification_feature.ref_comp_id . _pdbx_modification_feature.type None _pdbx_modification_feature.category 'Disulfide bridge' # _pdbx_entry_details.entry_id 9AVE _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LYS A 85 ? ? 54.74 11.68 2 1 ASN A 104 ? ? -57.09 107.89 # loop_ _pdbx_struct_special_symmetry.id _pdbx_struct_special_symmetry.PDB_model_num _pdbx_struct_special_symmetry.auth_asym_id _pdbx_struct_special_symmetry.auth_comp_id _pdbx_struct_special_symmetry.auth_seq_id _pdbx_struct_special_symmetry.PDB_ins_code _pdbx_struct_special_symmetry.label_asym_id _pdbx_struct_special_symmetry.label_comp_id _pdbx_struct_special_symmetry.label_seq_id 1 1 A HOH 213 ? B HOH . 2 1 A HOH 218 ? B HOH . # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A GLU 2 ? A GLU 2 3 1 Y 1 A ALA 3 ? A ALA 3 4 1 Y 1 A VAL 4 ? A VAL 4 5 1 Y 1 A LEU 5 ? A LEU 5 6 1 Y 1 A ASN 6 ? A ASN 6 7 1 Y 1 A GLU 7 ? A GLU 7 8 1 Y 1 A LEU 8 ? A LEU 8 9 1 Y 1 A VAL 9 ? A VAL 9 10 1 Y 1 A SER 10 ? A SER 10 11 1 Y 1 A VAL 11 ? A VAL 11 12 1 Y 1 A GLU 12 ? A GLU 12 13 1 Y 1 A ASP 13 ? A ASP 13 14 1 Y 1 A LEU 14 ? A LEU 14 15 1 Y 1 A LEU 15 ? A LEU 15 16 1 Y 1 A LYS 16 ? A LYS 16 17 1 Y 1 A PHE 17 ? A PHE 17 18 1 Y 1 A GLU 18 ? A GLU 18 19 1 Y 1 A LYS 19 ? A LYS 19 20 1 Y 1 A LYS 20 ? A LYS 20 21 1 Y 1 A PHE 21 ? A PHE 21 22 1 Y 1 A GLN 22 ? A GLN 22 23 1 Y 1 A SER 23 ? A SER 23 24 1 Y 1 A GLU 24 ? A GLU 24 25 1 Y 1 A LYS 25 ? A LYS 25 26 1 Y 1 A ALA 26 ? A ALA 26 27 1 Y 1 A ALA 27 ? A ALA 27 28 1 Y 1 A GLY 28 ? A GLY 28 29 1 Y 1 A SER 29 ? A SER 29 30 1 Y 1 A VAL 30 ? A VAL 30 31 1 Y 1 A SER 31 ? A SER 31 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HOH O O N N 137 HOH H1 H N N 138 HOH H2 H N N 139 ILE N N N N 140 ILE CA C N S 141 ILE C C N N 142 ILE O O N N 143 ILE CB C N S 144 ILE CG1 C N N 145 ILE CG2 C N N 146 ILE CD1 C N N 147 ILE OXT O N N 148 ILE H H N N 149 ILE H2 H N N 150 ILE HA H N N 151 ILE HB H N N 152 ILE HG12 H N N 153 ILE HG13 H N N 154 ILE HG21 H N N 155 ILE HG22 H N N 156 ILE HG23 H N N 157 ILE HD11 H N N 158 ILE HD12 H N N 159 ILE HD13 H N N 160 ILE HXT H N N 161 LEU N N N N 162 LEU CA C N S 163 LEU C C N N 164 LEU O O N N 165 LEU CB C N N 166 LEU CG C N N 167 LEU CD1 C N N 168 LEU CD2 C N N 169 LEU OXT O N N 170 LEU H H N N 171 LEU H2 H N N 172 LEU HA H N N 173 LEU HB2 H N N 174 LEU HB3 H N N 175 LEU HG H N N 176 LEU HD11 H N N 177 LEU HD12 H N N 178 LEU HD13 H N N 179 LEU HD21 H N N 180 LEU HD22 H N N 181 LEU HD23 H N N 182 LEU HXT H N N 183 LYS N N N N 184 LYS CA C N S 185 LYS C C N N 186 LYS O O N N 187 LYS CB C N N 188 LYS CG C N N 189 LYS CD C N N 190 LYS CE C N N 191 LYS NZ N N N 192 LYS OXT O N N 193 LYS H H N N 194 LYS H2 H N N 195 LYS HA H N N 196 LYS HB2 H N N 197 LYS HB3 H N N 198 LYS HG2 H N N 199 LYS HG3 H N N 200 LYS HD2 H N N 201 LYS HD3 H N N 202 LYS HE2 H N N 203 LYS HE3 H N N 204 LYS HZ1 H N N 205 LYS HZ2 H N N 206 LYS HZ3 H N N 207 LYS HXT H N N 208 MET N N N N 209 MET CA C N S 210 MET C C N N 211 MET O O N N 212 MET CB C N N 213 MET CG C N N 214 MET SD S N N 215 MET CE C N N 216 MET OXT O N N 217 MET H H N N 218 MET H2 H N N 219 MET HA H N N 220 MET HB2 H N N 221 MET HB3 H N N 222 MET HG2 H N N 223 MET HG3 H N N 224 MET HE1 H N N 225 MET HE2 H N N 226 MET HE3 H N N 227 MET HXT H N N 228 PHE N N N N 229 PHE CA C N S 230 PHE C C N N 231 PHE O O N N 232 PHE CB C N N 233 PHE CG C Y N 234 PHE CD1 C Y N 235 PHE CD2 C Y N 236 PHE CE1 C Y N 237 PHE CE2 C Y N 238 PHE CZ C Y N 239 PHE OXT O N N 240 PHE H H N N 241 PHE H2 H N N 242 PHE HA H N N 243 PHE HB2 H N N 244 PHE HB3 H N N 245 PHE HD1 H N N 246 PHE HD2 H N N 247 PHE HE1 H N N 248 PHE HE2 H N N 249 PHE HZ H N N 250 PHE HXT H N N 251 PRO N N N N 252 PRO CA C N S 253 PRO C C N N 254 PRO O O N N 255 PRO CB C N N 256 PRO CG C N N 257 PRO CD C N N 258 PRO OXT O N N 259 PRO H H N N 260 PRO HA H N N 261 PRO HB2 H N N 262 PRO HB3 H N N 263 PRO HG2 H N N 264 PRO HG3 H N N 265 PRO HD2 H N N 266 PRO HD3 H N N 267 PRO HXT H N N 268 SER N N N N 269 SER CA C N S 270 SER C C N N 271 SER O O N N 272 SER CB C N N 273 SER OG O N N 274 SER OXT O N N 275 SER H H N N 276 SER H2 H N N 277 SER HA H N N 278 SER HB2 H N N 279 SER HB3 H N N 280 SER HG H N N 281 SER HXT H N N 282 THR N N N N 283 THR CA C N S 284 THR C C N N 285 THR O O N N 286 THR CB C N R 287 THR OG1 O N N 288 THR CG2 C N N 289 THR OXT O N N 290 THR H H N N 291 THR H2 H N N 292 THR HA H N N 293 THR HB H N N 294 THR HG1 H N N 295 THR HG21 H N N 296 THR HG22 H N N 297 THR HG23 H N N 298 THR HXT H N N 299 TRP N N N N 300 TRP CA C N S 301 TRP C C N N 302 TRP O O N N 303 TRP CB C N N 304 TRP CG C Y N 305 TRP CD1 C Y N 306 TRP CD2 C Y N 307 TRP NE1 N Y N 308 TRP CE2 C Y N 309 TRP CE3 C Y N 310 TRP CZ2 C Y N 311 TRP CZ3 C Y N 312 TRP CH2 C Y N 313 TRP OXT O N N 314 TRP H H N N 315 TRP H2 H N N 316 TRP HA H N N 317 TRP HB2 H N N 318 TRP HB3 H N N 319 TRP HD1 H N N 320 TRP HE1 H N N 321 TRP HE3 H N N 322 TRP HZ2 H N N 323 TRP HZ3 H N N 324 TRP HH2 H N N 325 TRP HXT H N N 326 TYR N N N N 327 TYR CA C N S 328 TYR C C N N 329 TYR O O N N 330 TYR CB C N N 331 TYR CG C Y N 332 TYR CD1 C Y N 333 TYR CD2 C Y N 334 TYR CE1 C Y N 335 TYR CE2 C Y N 336 TYR CZ C Y N 337 TYR OH O N N 338 TYR OXT O N N 339 TYR H H N N 340 TYR H2 H N N 341 TYR HA H N N 342 TYR HB2 H N N 343 TYR HB3 H N N 344 TYR HD1 H N N 345 TYR HD2 H N N 346 TYR HE1 H N N 347 TYR HE2 H N N 348 TYR HH H N N 349 TYR HXT H N N 350 VAL N N N N 351 VAL CA C N S 352 VAL C C N N 353 VAL O O N N 354 VAL CB C N N 355 VAL CG1 C N N 356 VAL CG2 C N N 357 VAL OXT O N N 358 VAL H H N N 359 VAL H2 H N N 360 VAL HA H N N 361 VAL HB H N N 362 VAL HG11 H N N 363 VAL HG12 H N N 364 VAL HG13 H N N 365 VAL HG21 H N N 366 VAL HG22 H N N 367 VAL HG23 H N N 368 VAL HXT H N N 369 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HOH O H1 sing N N 129 HOH O H2 sing N N 130 ILE N CA sing N N 131 ILE N H sing N N 132 ILE N H2 sing N N 133 ILE CA C sing N N 134 ILE CA CB sing N N 135 ILE CA HA sing N N 136 ILE C O doub N N 137 ILE C OXT sing N N 138 ILE CB CG1 sing N N 139 ILE CB CG2 sing N N 140 ILE CB HB sing N N 141 ILE CG1 CD1 sing N N 142 ILE CG1 HG12 sing N N 143 ILE CG1 HG13 sing N N 144 ILE CG2 HG21 sing N N 145 ILE CG2 HG22 sing N N 146 ILE CG2 HG23 sing N N 147 ILE CD1 HD11 sing N N 148 ILE CD1 HD12 sing N N 149 ILE CD1 HD13 sing N N 150 ILE OXT HXT sing N N 151 LEU N CA sing N N 152 LEU N H sing N N 153 LEU N H2 sing N N 154 LEU CA C sing N N 155 LEU CA CB sing N N 156 LEU CA HA sing N N 157 LEU C O doub N N 158 LEU C OXT sing N N 159 LEU CB CG sing N N 160 LEU CB HB2 sing N N 161 LEU CB HB3 sing N N 162 LEU CG CD1 sing N N 163 LEU CG CD2 sing N N 164 LEU CG HG sing N N 165 LEU CD1 HD11 sing N N 166 LEU CD1 HD12 sing N N 167 LEU CD1 HD13 sing N N 168 LEU CD2 HD21 sing N N 169 LEU CD2 HD22 sing N N 170 LEU CD2 HD23 sing N N 171 LEU OXT HXT sing N N 172 LYS N CA sing N N 173 LYS N H sing N N 174 LYS N H2 sing N N 175 LYS CA C sing N N 176 LYS CA CB sing N N 177 LYS CA HA sing N N 178 LYS C O doub N N 179 LYS C OXT sing N N 180 LYS CB CG sing N N 181 LYS CB HB2 sing N N 182 LYS CB HB3 sing N N 183 LYS CG CD sing N N 184 LYS CG HG2 sing N N 185 LYS CG HG3 sing N N 186 LYS CD CE sing N N 187 LYS CD HD2 sing N N 188 LYS CD HD3 sing N N 189 LYS CE NZ sing N N 190 LYS CE HE2 sing N N 191 LYS CE HE3 sing N N 192 LYS NZ HZ1 sing N N 193 LYS NZ HZ2 sing N N 194 LYS NZ HZ3 sing N N 195 LYS OXT HXT sing N N 196 MET N CA sing N N 197 MET N H sing N N 198 MET N H2 sing N N 199 MET CA C sing N N 200 MET CA CB sing N N 201 MET CA HA sing N N 202 MET C O doub N N 203 MET C OXT sing N N 204 MET CB CG sing N N 205 MET CB HB2 sing N N 206 MET CB HB3 sing N N 207 MET CG SD sing N N 208 MET CG HG2 sing N N 209 MET CG HG3 sing N N 210 MET SD CE sing N N 211 MET CE HE1 sing N N 212 MET CE HE2 sing N N 213 MET CE HE3 sing N N 214 MET OXT HXT sing N N 215 PHE N CA sing N N 216 PHE N H sing N N 217 PHE N H2 sing N N 218 PHE CA C sing N N 219 PHE CA CB sing N N 220 PHE CA HA sing N N 221 PHE C O doub N N 222 PHE C OXT sing N N 223 PHE CB CG sing N N 224 PHE CB HB2 sing N N 225 PHE CB HB3 sing N N 226 PHE CG CD1 doub Y N 227 PHE CG CD2 sing Y N 228 PHE CD1 CE1 sing Y N 229 PHE CD1 HD1 sing N N 230 PHE CD2 CE2 doub Y N 231 PHE CD2 HD2 sing N N 232 PHE CE1 CZ doub Y N 233 PHE CE1 HE1 sing N N 234 PHE CE2 CZ sing Y N 235 PHE CE2 HE2 sing N N 236 PHE CZ HZ sing N N 237 PHE OXT HXT sing N N 238 PRO N CA sing N N 239 PRO N CD sing N N 240 PRO N H sing N N 241 PRO CA C sing N N 242 PRO CA CB sing N N 243 PRO CA HA sing N N 244 PRO C O doub N N 245 PRO C OXT sing N N 246 PRO CB CG sing N N 247 PRO CB HB2 sing N N 248 PRO CB HB3 sing N N 249 PRO CG CD sing N N 250 PRO CG HG2 sing N N 251 PRO CG HG3 sing N N 252 PRO CD HD2 sing N N 253 PRO CD HD3 sing N N 254 PRO OXT HXT sing N N 255 SER N CA sing N N 256 SER N H sing N N 257 SER N H2 sing N N 258 SER CA C sing N N 259 SER CA CB sing N N 260 SER CA HA sing N N 261 SER C O doub N N 262 SER C OXT sing N N 263 SER CB OG sing N N 264 SER CB HB2 sing N N 265 SER CB HB3 sing N N 266 SER OG HG sing N N 267 SER OXT HXT sing N N 268 THR N CA sing N N 269 THR N H sing N N 270 THR N H2 sing N N 271 THR CA C sing N N 272 THR CA CB sing N N 273 THR CA HA sing N N 274 THR C O doub N N 275 THR C OXT sing N N 276 THR CB OG1 sing N N 277 THR CB CG2 sing N N 278 THR CB HB sing N N 279 THR OG1 HG1 sing N N 280 THR CG2 HG21 sing N N 281 THR CG2 HG22 sing N N 282 THR CG2 HG23 sing N N 283 THR OXT HXT sing N N 284 TRP N CA sing N N 285 TRP N H sing N N 286 TRP N H2 sing N N 287 TRP CA C sing N N 288 TRP CA CB sing N N 289 TRP CA HA sing N N 290 TRP C O doub N N 291 TRP C OXT sing N N 292 TRP CB CG sing N N 293 TRP CB HB2 sing N N 294 TRP CB HB3 sing N N 295 TRP CG CD1 doub Y N 296 TRP CG CD2 sing Y N 297 TRP CD1 NE1 sing Y N 298 TRP CD1 HD1 sing N N 299 TRP CD2 CE2 doub Y N 300 TRP CD2 CE3 sing Y N 301 TRP NE1 CE2 sing Y N 302 TRP NE1 HE1 sing N N 303 TRP CE2 CZ2 sing Y N 304 TRP CE3 CZ3 doub Y N 305 TRP CE3 HE3 sing N N 306 TRP CZ2 CH2 doub Y N 307 TRP CZ2 HZ2 sing N N 308 TRP CZ3 CH2 sing Y N 309 TRP CZ3 HZ3 sing N N 310 TRP CH2 HH2 sing N N 311 TRP OXT HXT sing N N 312 TYR N CA sing N N 313 TYR N H sing N N 314 TYR N H2 sing N N 315 TYR CA C sing N N 316 TYR CA CB sing N N 317 TYR CA HA sing N N 318 TYR C O doub N N 319 TYR C OXT sing N N 320 TYR CB CG sing N N 321 TYR CB HB2 sing N N 322 TYR CB HB3 sing N N 323 TYR CG CD1 doub Y N 324 TYR CG CD2 sing Y N 325 TYR CD1 CE1 sing Y N 326 TYR CD1 HD1 sing N N 327 TYR CD2 CE2 doub Y N 328 TYR CD2 HD2 sing N N 329 TYR CE1 CZ doub Y N 330 TYR CE1 HE1 sing N N 331 TYR CE2 CZ sing Y N 332 TYR CE2 HE2 sing N N 333 TYR CZ OH sing N N 334 TYR OH HH sing N N 335 TYR OXT HXT sing N N 336 VAL N CA sing N N 337 VAL N H sing N N 338 VAL N H2 sing N N 339 VAL CA C sing N N 340 VAL CA CB sing N N 341 VAL CA HA sing N N 342 VAL C O doub N N 343 VAL C OXT sing N N 344 VAL CB CG1 sing N N 345 VAL CB CG2 sing N N 346 VAL CB HB sing N N 347 VAL CG1 HG11 sing N N 348 VAL CG1 HG12 sing N N 349 VAL CG1 HG13 sing N N 350 VAL CG2 HG21 sing N N 351 VAL CG2 HG22 sing N N 352 VAL CG2 HG23 sing N N 353 VAL OXT HXT sing N N 354 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'Department of Energy (DOE, United States)' 'United States' DE-AC02-76SF00515 1 'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' 'United States' P30GM133894 2 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name Other _pdbx_initial_refinement_model.accession_code ? _pdbx_initial_refinement_model.details 'Wild type structure' # _atom_sites.entry_id 9AVE _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 0.023121 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.023121 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.008347 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C N O S # loop_ #