data_9AVM # _entry.id 9AVM # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.413 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 9AVM pdb_00009avm 10.2210/pdb9avm/pdb WWPDB D_1000282119 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date _pdbx_audit_revision_history.part_number 1 'Structure model' 1 0 2025-03-12 ? 2 'Structure model' 1 1 2026-04-29 ? # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_audit_revision_group.ordinal 1 _pdbx_audit_revision_group.revision_ordinal 2 _pdbx_audit_revision_group.data_content_type 'Structure model' _pdbx_audit_revision_group.group 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_abbrev' 2 2 'Structure model' '_citation.journal_id_CSD' 3 2 'Structure model' '_citation.journal_id_ISSN' 4 2 'Structure model' '_citation.journal_volume' 5 2 'Structure model' '_citation.page_first' 6 2 'Structure model' '_citation.page_last' 7 2 'Structure model' '_citation.pdbx_database_id_DOI' 8 2 'Structure model' '_citation.pdbx_database_id_PubMed' 9 2 'Structure model' '_citation.title' 10 2 'Structure model' '_citation.year' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 9AVM _pdbx_database_status.recvd_initial_deposition_date 2024-03-04 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_contact_author.id 1 _pdbx_contact_author.email clemke@broadinstitute.org _pdbx_contact_author.name_first Christopher _pdbx_contact_author.name_last Lemke _pdbx_contact_author.name_mi T _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0001-9419-1511 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Raymond, D.D.' 1 0000-0003-4154-6141 'Lemke, C.T.' 2 0000-0001-9419-1511 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Cell _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 1097-4172 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 189 _citation.language ? _citation.page_first 1356 _citation.page_last 1370.e26 _citation.title 'Human genetics guides the discovery of CARD9 inhibitors with anti-inflammatory activity.' _citation.year 2026 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1016/j.cell.2025.12.013 _citation.pdbx_database_id_PubMed 41547356 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Rush, J.S.' 1 ? primary 'Wertheimer, J.D.' 2 ? primary 'Goldberg, S.D.' 3 ? primary 'Raymond, D.' 4 ? primary 'Szuchnicki, M.' 5 ? primary 'Baltus, A.J.' 6 ? primary 'Branson, J.' 7 ? primary 'Stratton, C.F.' 8 ? primary 'Patrick, A.N.' 9 ? primary 'Steele, R.' 10 ? primary 'Adhikary, S.' 11 ? primary 'Del Rosario, A.' 12 ? primary 'Liu, A.' 13 ? primary 'Gomersall, N.J.' 14 ? primary 'Chung, M.' 15 ? primary 'Ranaghan, M.J.' 16 ? primary 'Gu, X.' 17 ? primary 'Brandt, M.' 18 ? primary 'Cao, Z.' 19 ? primary 'Bebenek, A.' 20 ? primary 'Oliver, B.A.' 21 ? primary 'Hoebe, K.' 22 ? primary 'Szewczuk, L.M.' 23 ? primary 'Venable, J.D.' 24 ? primary 'Graham, D.B.' 25 ? primary 'Towne, J.' 26 ? primary 'Xavier, R.J.' 27 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Caspase recruitment domain-containing protein 9' 7139.121 4 ? ? ? ? 2 water nat water 18.015 106 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name hCARD9 # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code AKHQERVQRLKEECEAGSRELKRCKEENYDLAMRLAHQSEEKGAALMRNRDLQLEIDQLK _entity_poly.pdbx_seq_one_letter_code_can AKHQERVQRLKEECEAGSRELKRCKEENYDLAMRLAHQSEEKGAALMRNRDLQLEIDQLK _entity_poly.pdbx_strand_id A,B,C,D _entity_poly.pdbx_target_identifier ? # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ALA n 1 2 LYS n 1 3 HIS n 1 4 GLN n 1 5 GLU n 1 6 ARG n 1 7 VAL n 1 8 GLN n 1 9 ARG n 1 10 LEU n 1 11 LYS n 1 12 GLU n 1 13 GLU n 1 14 CYS n 1 15 GLU n 1 16 ALA n 1 17 GLY n 1 18 SER n 1 19 ARG n 1 20 GLU n 1 21 LEU n 1 22 LYS n 1 23 ARG n 1 24 CYS n 1 25 LYS n 1 26 GLU n 1 27 GLU n 1 28 ASN n 1 29 TYR n 1 30 ASP n 1 31 LEU n 1 32 ALA n 1 33 MET n 1 34 ARG n 1 35 LEU n 1 36 ALA n 1 37 HIS n 1 38 GLN n 1 39 SER n 1 40 GLU n 1 41 GLU n 1 42 LYS n 1 43 GLY n 1 44 ALA n 1 45 ALA n 1 46 LEU n 1 47 MET n 1 48 ARG n 1 49 ASN n 1 50 ARG n 1 51 ASP n 1 52 LEU n 1 53 GLN n 1 54 LEU n 1 55 GLU n 1 56 ILE n 1 57 ASP n 1 58 GLN n 1 59 LEU n 1 60 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 60 _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene CARD9 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ALA 1 155 ? ? ? A . n A 1 2 LYS 2 156 ? ? ? A . n A 1 3 HIS 3 157 ? ? ? A . n A 1 4 GLN 4 158 ? ? ? A . n A 1 5 GLU 5 159 ? ? ? A . n A 1 6 ARG 6 160 ? ? ? A . n A 1 7 VAL 7 161 ? ? ? A . n A 1 8 GLN 8 162 ? ? ? A . n A 1 9 ARG 9 163 163 ARG ARG A . n A 1 10 LEU 10 164 164 LEU LEU A . n A 1 11 LYS 11 165 165 LYS LYS A . n A 1 12 GLU 12 166 166 GLU GLU A . n A 1 13 GLU 13 167 167 GLU GLU A . n A 1 14 CYS 14 168 168 CYS CYS A . n A 1 15 GLU 15 169 169 GLU GLU A . n A 1 16 ALA 16 170 170 ALA ALA A . n A 1 17 GLY 17 171 171 GLY GLY A . n A 1 18 SER 18 172 172 SER SER A . n A 1 19 ARG 19 173 173 ARG ARG A . n A 1 20 GLU 20 174 174 GLU GLU A . n A 1 21 LEU 21 175 175 LEU LEU A . n A 1 22 LYS 22 176 176 LYS LYS A . n A 1 23 ARG 23 177 177 ARG ARG A . n A 1 24 CYS 24 178 178 CYS CYS A . n A 1 25 LYS 25 179 179 LYS LYS A . n A 1 26 GLU 26 180 180 GLU GLU A . n A 1 27 GLU 27 181 181 GLU GLU A . n A 1 28 ASN 28 182 182 ASN ASN A . n A 1 29 TYR 29 183 183 TYR TYR A . n A 1 30 ASP 30 184 184 ASP ASP A . n A 1 31 LEU 31 185 185 LEU LEU A . n A 1 32 ALA 32 186 186 ALA ALA A . n A 1 33 MET 33 187 187 MET MET A . n A 1 34 ARG 34 188 188 ARG ARG A . n A 1 35 LEU 35 189 189 LEU LEU A . n A 1 36 ALA 36 190 190 ALA ALA A . n A 1 37 HIS 37 191 191 HIS HIS A . n A 1 38 GLN 38 192 192 GLN GLN A . n A 1 39 SER 39 193 193 SER SER A . n A 1 40 GLU 40 194 194 GLU GLU A . n A 1 41 GLU 41 195 195 GLU GLU A . n A 1 42 LYS 42 196 196 LYS LYS A . n A 1 43 GLY 43 197 197 GLY GLY A . n A 1 44 ALA 44 198 198 ALA ALA A . n A 1 45 ALA 45 199 199 ALA ALA A . n A 1 46 LEU 46 200 200 LEU LEU A . n A 1 47 MET 47 201 201 MET MET A . n A 1 48 ARG 48 202 202 ARG ARG A . n A 1 49 ASN 49 203 203 ASN ASN A . n A 1 50 ARG 50 204 204 ARG ARG A . n A 1 51 ASP 51 205 205 ASP ASP A . n A 1 52 LEU 52 206 206 LEU LEU A . n A 1 53 GLN 53 207 207 GLN GLN A . n A 1 54 LEU 54 208 208 LEU LEU A . n A 1 55 GLU 55 209 209 GLU GLU A . n A 1 56 ILE 56 210 210 ILE ILE A . n A 1 57 ASP 57 211 211 ASP ASP A . n A 1 58 GLN 58 212 212 GLN GLN A . n A 1 59 LEU 59 213 213 LEU LEU A . n A 1 60 LYS 60 214 214 LYS LYS A . n B 1 1 ALA 1 155 ? ? ? B . n B 1 2 LYS 2 156 ? ? ? B . n B 1 3 HIS 3 157 ? ? ? B . n B 1 4 GLN 4 158 ? ? ? B . n B 1 5 GLU 5 159 ? ? ? B . n B 1 6 ARG 6 160 160 ARG ARG B . n B 1 7 VAL 7 161 161 VAL VAL B . n B 1 8 GLN 8 162 162 GLN GLN B . n B 1 9 ARG 9 163 163 ARG ARG B . n B 1 10 LEU 10 164 164 LEU LEU B . n B 1 11 LYS 11 165 165 LYS LYS B . n B 1 12 GLU 12 166 166 GLU GLU B . n B 1 13 GLU 13 167 167 GLU GLU B . n B 1 14 CYS 14 168 168 CYS CYS B . n B 1 15 GLU 15 169 169 GLU GLU B . n B 1 16 ALA 16 170 170 ALA ALA B . n B 1 17 GLY 17 171 171 GLY GLY B . n B 1 18 SER 18 172 172 SER SER B . n B 1 19 ARG 19 173 173 ARG ARG B . n B 1 20 GLU 20 174 174 GLU GLU B . n B 1 21 LEU 21 175 175 LEU LEU B . n B 1 22 LYS 22 176 176 LYS LYS B . n B 1 23 ARG 23 177 177 ARG ARG B . n B 1 24 CYS 24 178 178 CYS CYS B . n B 1 25 LYS 25 179 179 LYS LYS B . n B 1 26 GLU 26 180 180 GLU GLU B . n B 1 27 GLU 27 181 181 GLU GLU B . n B 1 28 ASN 28 182 182 ASN ASN B . n B 1 29 TYR 29 183 183 TYR TYR B . n B 1 30 ASP 30 184 184 ASP ASP B . n B 1 31 LEU 31 185 185 LEU LEU B . n B 1 32 ALA 32 186 186 ALA ALA B . n B 1 33 MET 33 187 187 MET MET B . n B 1 34 ARG 34 188 188 ARG ARG B . n B 1 35 LEU 35 189 189 LEU LEU B . n B 1 36 ALA 36 190 190 ALA ALA B . n B 1 37 HIS 37 191 191 HIS HIS B . n B 1 38 GLN 38 192 192 GLN GLN B . n B 1 39 SER 39 193 193 SER SER B . n B 1 40 GLU 40 194 194 GLU GLU B . n B 1 41 GLU 41 195 195 GLU GLU B . n B 1 42 LYS 42 196 196 LYS LYS B . n B 1 43 GLY 43 197 197 GLY GLY B . n B 1 44 ALA 44 198 198 ALA ALA B . n B 1 45 ALA 45 199 199 ALA ALA B . n B 1 46 LEU 46 200 200 LEU LEU B . n B 1 47 MET 47 201 201 MET MET B . n B 1 48 ARG 48 202 202 ARG ARG B . n B 1 49 ASN 49 203 203 ASN ASN B . n B 1 50 ARG 50 204 204 ARG ARG B . n B 1 51 ASP 51 205 205 ASP ASP B . n B 1 52 LEU 52 206 206 LEU LEU B . n B 1 53 GLN 53 207 207 GLN GLN B . n B 1 54 LEU 54 208 208 LEU LEU B . n B 1 55 GLU 55 209 209 GLU GLU B . n B 1 56 ILE 56 210 210 ILE ILE B . n B 1 57 ASP 57 211 211 ASP ASP B . n B 1 58 GLN 58 212 212 GLN GLN B . n B 1 59 LEU 59 213 213 LEU LEU B . n B 1 60 LYS 60 214 214 LYS LYS B . n C 1 1 ALA 1 155 155 ALA ALA C . n C 1 2 LYS 2 156 156 LYS LYS C . n C 1 3 HIS 3 157 157 HIS HIS C . n C 1 4 GLN 4 158 158 GLN GLN C . n C 1 5 GLU 5 159 159 GLU GLU C . n C 1 6 ARG 6 160 160 ARG ARG C . n C 1 7 VAL 7 161 161 VAL VAL C . n C 1 8 GLN 8 162 162 GLN GLN C . n C 1 9 ARG 9 163 163 ARG ARG C . n C 1 10 LEU 10 164 164 LEU LEU C . n C 1 11 LYS 11 165 165 LYS LYS C . n C 1 12 GLU 12 166 166 GLU GLU C . n C 1 13 GLU 13 167 167 GLU GLU C . n C 1 14 CYS 14 168 168 CYS CYS C . n C 1 15 GLU 15 169 169 GLU GLU C . n C 1 16 ALA 16 170 170 ALA ALA C . n C 1 17 GLY 17 171 171 GLY GLY C . n C 1 18 SER 18 172 172 SER SER C . n C 1 19 ARG 19 173 173 ARG ARG C . n C 1 20 GLU 20 174 174 GLU GLU C . n C 1 21 LEU 21 175 175 LEU LEU C . n C 1 22 LYS 22 176 176 LYS LYS C . n C 1 23 ARG 23 177 177 ARG ARG C . n C 1 24 CYS 24 178 178 CYS CYS C . n C 1 25 LYS 25 179 179 LYS LYS C . n C 1 26 GLU 26 180 180 GLU GLU C . n C 1 27 GLU 27 181 181 GLU GLU C . n C 1 28 ASN 28 182 182 ASN ASN C . n C 1 29 TYR 29 183 183 TYR TYR C . n C 1 30 ASP 30 184 184 ASP ASP C . n C 1 31 LEU 31 185 185 LEU LEU C . n C 1 32 ALA 32 186 186 ALA ALA C . n C 1 33 MET 33 187 187 MET MET C . n C 1 34 ARG 34 188 188 ARG ARG C . n C 1 35 LEU 35 189 189 LEU LEU C . n C 1 36 ALA 36 190 190 ALA ALA C . n C 1 37 HIS 37 191 191 HIS HIS C . n C 1 38 GLN 38 192 192 GLN GLN C . n C 1 39 SER 39 193 193 SER SER C . n C 1 40 GLU 40 194 194 GLU GLU C . n C 1 41 GLU 41 195 195 GLU GLU C . n C 1 42 LYS 42 196 196 LYS LYS C . n C 1 43 GLY 43 197 197 GLY GLY C . n C 1 44 ALA 44 198 198 ALA ALA C . n C 1 45 ALA 45 199 199 ALA ALA C . n C 1 46 LEU 46 200 200 LEU LEU C . n C 1 47 MET 47 201 201 MET MET C . n C 1 48 ARG 48 202 202 ARG ARG C . n C 1 49 ASN 49 203 203 ASN ASN C . n C 1 50 ARG 50 204 204 ARG ARG C . n C 1 51 ASP 51 205 205 ASP ASP C . n C 1 52 LEU 52 206 206 LEU LEU C . n C 1 53 GLN 53 207 207 GLN GLN C . n C 1 54 LEU 54 208 208 LEU LEU C . n C 1 55 GLU 55 209 209 GLU GLU C . n C 1 56 ILE 56 210 210 ILE ILE C . n C 1 57 ASP 57 211 211 ASP ASP C . n C 1 58 GLN 58 212 212 GLN GLN C . n C 1 59 LEU 59 213 213 LEU LEU C . n C 1 60 LYS 60 214 214 LYS LYS C . n D 1 1 ALA 1 155 155 ALA ALA D . n D 1 2 LYS 2 156 156 LYS LYS D . n D 1 3 HIS 3 157 157 HIS HIS D . n D 1 4 GLN 4 158 158 GLN GLN D . n D 1 5 GLU 5 159 159 GLU GLU D . n D 1 6 ARG 6 160 160 ARG ARG D . n D 1 7 VAL 7 161 161 VAL VAL D . n D 1 8 GLN 8 162 162 GLN GLN D . n D 1 9 ARG 9 163 163 ARG ARG D . n D 1 10 LEU 10 164 164 LEU LEU D . n D 1 11 LYS 11 165 165 LYS LYS D . n D 1 12 GLU 12 166 166 GLU GLU D . n D 1 13 GLU 13 167 167 GLU GLU D . n D 1 14 CYS 14 168 168 CYS CYS D . n D 1 15 GLU 15 169 169 GLU ALA D . n D 1 16 ALA 16 170 170 ALA ALA D . n D 1 17 GLY 17 171 171 GLY GLY D . n D 1 18 SER 18 172 172 SER SER D . n D 1 19 ARG 19 173 173 ARG ARG D . n D 1 20 GLU 20 174 174 GLU GLU D . n D 1 21 LEU 21 175 175 LEU LEU D . n D 1 22 LYS 22 176 176 LYS LYS D . n D 1 23 ARG 23 177 177 ARG ARG D . n D 1 24 CYS 24 178 178 CYS CYS D . n D 1 25 LYS 25 179 179 LYS LYS D . n D 1 26 GLU 26 180 180 GLU GLU D . n D 1 27 GLU 27 181 181 GLU GLU D . n D 1 28 ASN 28 182 182 ASN ASN D . n D 1 29 TYR 29 183 183 TYR TYR D . n D 1 30 ASP 30 184 184 ASP ASP D . n D 1 31 LEU 31 185 185 LEU LEU D . n D 1 32 ALA 32 186 186 ALA ALA D . n D 1 33 MET 33 187 187 MET MET D . n D 1 34 ARG 34 188 188 ARG ARG D . n D 1 35 LEU 35 189 189 LEU LEU D . n D 1 36 ALA 36 190 190 ALA ALA D . n D 1 37 HIS 37 191 191 HIS HIS D . n D 1 38 GLN 38 192 192 GLN GLN D . n D 1 39 SER 39 193 193 SER SER D . n D 1 40 GLU 40 194 194 GLU GLU D . n D 1 41 GLU 41 195 195 GLU GLU D . n D 1 42 LYS 42 196 196 LYS LYS D . n D 1 43 GLY 43 197 197 GLY GLY D . n D 1 44 ALA 44 198 198 ALA ALA D . n D 1 45 ALA 45 199 199 ALA ALA D . n D 1 46 LEU 46 200 200 LEU LEU D . n D 1 47 MET 47 201 201 MET MET D . n D 1 48 ARG 48 202 202 ARG ARG D . n D 1 49 ASN 49 203 203 ASN ASN D . n D 1 50 ARG 50 204 204 ARG ARG D . n D 1 51 ASP 51 205 205 ASP ASP D . n D 1 52 LEU 52 206 206 LEU LEU D . n D 1 53 GLN 53 207 207 GLN GLN D . n D 1 54 LEU 54 208 208 LEU LEU D . n D 1 55 GLU 55 209 209 GLU GLU D . n D 1 56 ILE 56 210 210 ILE ILE D . n D 1 57 ASP 57 211 211 ASP ASP D . n D 1 58 GLN 58 212 212 GLN GLN D . n D 1 59 LEU 59 213 213 LEU LEU D . n D 1 60 LYS 60 214 214 LYS LYS D . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code E 2 HOH 1 301 88 HOH HOH A . E 2 HOH 2 302 32 HOH HOH A . E 2 HOH 3 303 48 HOH HOH A . E 2 HOH 4 304 42 HOH HOH A . E 2 HOH 5 305 47 HOH HOH A . E 2 HOH 6 306 9 HOH HOH A . E 2 HOH 7 307 15 HOH HOH A . E 2 HOH 8 308 76 HOH HOH A . E 2 HOH 9 309 31 HOH HOH A . E 2 HOH 10 310 96 HOH HOH A . E 2 HOH 11 311 58 HOH HOH A . E 2 HOH 12 312 35 HOH HOH A . E 2 HOH 13 313 25 HOH HOH A . E 2 HOH 14 314 22 HOH HOH A . E 2 HOH 15 315 55 HOH HOH A . E 2 HOH 16 316 61 HOH HOH A . E 2 HOH 17 317 106 HOH HOH A . E 2 HOH 18 318 93 HOH HOH A . E 2 HOH 19 319 67 HOH HOH A . E 2 HOH 20 320 90 HOH HOH A . E 2 HOH 21 321 77 HOH HOH A . E 2 HOH 22 322 45 HOH HOH A . E 2 HOH 23 323 91 HOH HOH A . F 2 HOH 1 301 69 HOH HOH B . F 2 HOH 2 302 44 HOH HOH B . F 2 HOH 3 303 51 HOH HOH B . F 2 HOH 4 304 1 HOH HOH B . F 2 HOH 5 305 16 HOH HOH B . F 2 HOH 6 306 6 HOH HOH B . F 2 HOH 7 307 66 HOH HOH B . F 2 HOH 8 308 102 HOH HOH B . F 2 HOH 9 309 23 HOH HOH B . F 2 HOH 10 310 18 HOH HOH B . F 2 HOH 11 311 50 HOH HOH B . F 2 HOH 12 312 86 HOH HOH B . F 2 HOH 13 313 84 HOH HOH B . F 2 HOH 14 314 95 HOH HOH B . F 2 HOH 15 315 65 HOH HOH B . F 2 HOH 16 316 39 HOH HOH B . G 2 HOH 1 301 73 HOH HOH C . G 2 HOH 2 302 29 HOH HOH C . G 2 HOH 3 303 38 HOH HOH C . G 2 HOH 4 304 7 HOH HOH C . G 2 HOH 5 305 75 HOH HOH C . G 2 HOH 6 306 80 HOH HOH C . G 2 HOH 7 307 13 HOH HOH C . G 2 HOH 8 308 46 HOH HOH C . G 2 HOH 9 309 26 HOH HOH C . G 2 HOH 10 310 12 HOH HOH C . G 2 HOH 11 311 53 HOH HOH C . G 2 HOH 12 312 2 HOH HOH C . G 2 HOH 13 313 54 HOH HOH C . G 2 HOH 14 314 41 HOH HOH C . G 2 HOH 15 315 20 HOH HOH C . G 2 HOH 16 316 19 HOH HOH C . G 2 HOH 17 317 34 HOH HOH C . G 2 HOH 18 318 105 HOH HOH C . G 2 HOH 19 319 14 HOH HOH C . G 2 HOH 20 320 40 HOH HOH C . G 2 HOH 21 321 64 HOH HOH C . G 2 HOH 22 322 72 HOH HOH C . G 2 HOH 23 323 57 HOH HOH C . G 2 HOH 24 324 10 HOH HOH C . G 2 HOH 25 325 24 HOH HOH C . G 2 HOH 26 326 8 HOH HOH C . G 2 HOH 27 327 56 HOH HOH C . G 2 HOH 28 328 17 HOH HOH C . G 2 HOH 29 329 60 HOH HOH C . G 2 HOH 30 330 28 HOH HOH C . G 2 HOH 31 331 74 HOH HOH C . G 2 HOH 32 332 98 HOH HOH C . G 2 HOH 33 333 101 HOH HOH C . G 2 HOH 34 334 63 HOH HOH C . G 2 HOH 35 335 21 HOH HOH C . G 2 HOH 36 336 43 HOH HOH C . H 2 HOH 1 301 103 HOH HOH D . H 2 HOH 2 302 5 HOH HOH D . H 2 HOH 3 303 3 HOH HOH D . H 2 HOH 4 304 82 HOH HOH D . H 2 HOH 5 305 68 HOH HOH D . H 2 HOH 6 306 104 HOH HOH D . H 2 HOH 7 307 11 HOH HOH D . H 2 HOH 8 308 52 HOH HOH D . H 2 HOH 9 309 71 HOH HOH D . H 2 HOH 10 310 36 HOH HOH D . H 2 HOH 11 311 89 HOH HOH D . H 2 HOH 12 312 78 HOH HOH D . H 2 HOH 13 313 4 HOH HOH D . H 2 HOH 14 314 33 HOH HOH D . H 2 HOH 15 315 70 HOH HOH D . H 2 HOH 16 316 81 HOH HOH D . H 2 HOH 17 317 49 HOH HOH D . H 2 HOH 18 318 30 HOH HOH D . H 2 HOH 19 319 87 HOH HOH D . H 2 HOH 20 320 62 HOH HOH D . H 2 HOH 21 321 92 HOH HOH D . H 2 HOH 22 322 94 HOH HOH D . H 2 HOH 23 323 99 HOH HOH D . H 2 HOH 24 324 79 HOH HOH D . H 2 HOH 25 325 27 HOH HOH D . H 2 HOH 26 326 37 HOH HOH D . H 2 HOH 27 327 97 HOH HOH D . H 2 HOH 28 328 83 HOH HOH D . H 2 HOH 29 329 85 HOH HOH D . H 2 HOH 30 330 100 HOH HOH D . H 2 HOH 31 331 59 HOH HOH D . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 D GLU 169 ? CG ? D GLU 15 CG 2 1 Y 1 D GLU 169 ? CD ? D GLU 15 CD 3 1 Y 1 D GLU 169 ? OE1 ? D GLU 15 OE1 4 1 Y 1 D GLU 169 ? OE2 ? D GLU 15 OE2 # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? BUSTER ? ? ? '2.10.3 (20-MAY-2020)' 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XSCALE ? ? ? . 2 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 3 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 4 # _cell.angle_alpha 71.41 _cell.angle_alpha_esd ? _cell.angle_beta 79.27 _cell.angle_beta_esd ? _cell.angle_gamma 77.05 _cell.angle_gamma_esd ? _cell.entry_id 9AVM _cell.details ? _cell.formula_units_Z ? _cell.length_a 27.330 _cell.length_a_esd ? _cell.length_b 48.830 _cell.length_b_esd ? _cell.length_c 55.630 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 9AVM _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 9AVM _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.39 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 48.64 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '8-14% PEG 3350' _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 298 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2020-03-20 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'APS BEAMLINE 17-ID' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 17-ID _diffrn_source.pdbx_synchrotron_site APS # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 9AVM _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.79 _reflns.d_resolution_low 26.43 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 23908 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 96.0 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 2.03 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 9.72 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.06 _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.997 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs 0.044000000000000004 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_CC_star _reflns_shell.pdbx_R_split _reflns_shell.percent_possible_all _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_percent_possible_ellipsoidal _reflns_shell.pdbx_percent_possible_spherical _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous _reflns_shell.pdbx_percent_possible_spherical_anomalous _reflns_shell.pdbx_redundancy_anomalous _reflns_shell.pdbx_CC_half_anomalous _reflns_shell.pdbx_absDiff_over_sigma_anomalous _reflns_shell.pdbx_percent_possible_anomalous 1.79 1.9 ? ? ? ? ? ? 3878 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 0.7120000000000001 ? ? 1 1 0.701 ? ? ? ? 0.52 ? ? ? ? ? ? ? ? ? 1.90 2.03 ? ? ? ? ? ? 3600 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 0.467 ? ? 2 1 0.794 ? ? ? ? 0.34 ? ? ? ? ? ? ? ? ? 2.03 2.19 ? ? ? ? ? ? 3336 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 0.217 ? ? 3 1 0.9440000000000001 ? ? ? ? 0.158 ? ? ? ? ? ? ? ? ? 2.19 2.39 ? ? ? ? ? ? 3013 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 0.14 ? ? 4 1 0.971 ? ? ? ? 0.102 ? ? ? ? ? ? ? ? ? 2.39 2.67 ? ? ? ? ? ? 2885 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 0.083 ? ? 5 1 0.9890000000000001 ? ? ? ? 0.061 ? ? ? ? ? ? ? ? ? 2.67 3.08 ? ? ? ? ? ? 2513 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 0.061 ? ? 6 1 0.993 ? ? ? ? 0.045 ? ? ? ? ? ? ? ? ? 3.08 3.76 ? ? ? ? ? ? 2086 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 0.048 ? ? 7 1 0.9940000000000001 ? ? ? ? 0.035 ? ? ? ? ? ? ? ? ? 3.76 5.27 ? ? ? ? ? ? 1654 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 0.043 ? ? 8 1 0.996 ? ? ? ? 0.032 ? ? ? ? ? ? ? ? ? 5.27 26.4 ? ? ? ? ? ? 943 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 0.04 ? ? 9 1 0.997 ? ? ? ? 0.03 ? ? ? ? ? ? ? ? ? # _refine.aniso_B[1][1] 0.31300 _refine.aniso_B[1][2] -1.43920 _refine.aniso_B[1][3] 0.61010 _refine.aniso_B[2][2] 2.12840 _refine.aniso_B[2][3] 8.14840 _refine.aniso_B[3][3] -2.44140 _refine.B_iso_max ? _refine.B_iso_mean 41.36 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc 0.930 _refine.correlation_coeff_Fo_to_Fc_free 0.898 _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 9AVM _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.790 _refine.ls_d_res_low 26.43 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 23908 _refine.ls_number_reflns_R_free 1196 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 96.2 _refine.ls_percent_reflns_R_free 5.000 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2443 _refine.ls_R_factor_R_free 0.2923 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2418 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.000 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI 0.152 _refine.pdbx_overall_SU_R_free_Blow_DPI 0.150 _refine.pdbx_overall_SU_R_Blow_DPI 0.152 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML ? _refine.overall_SU_R_Cruickshank_DPI 0.153 _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_analyze.entry_id 9AVM _refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_analyze.Luzzati_coordinate_error_free ? _refine_analyze.Luzzati_coordinate_error_obs 0.32 _refine_analyze.Luzzati_d_res_low_free ? _refine_analyze.Luzzati_d_res_low_obs ? _refine_analyze.Luzzati_sigma_a_free ? _refine_analyze.Luzzati_sigma_a_free_details ? _refine_analyze.Luzzati_sigma_a_obs ? _refine_analyze.Luzzati_sigma_a_obs_details ? _refine_analyze.number_disordered_residues ? _refine_analyze.occupancy_sum_hydrogen ? _refine_analyze.occupancy_sum_non_hydrogen ? _refine_analyze.RG_d_res_high ? _refine_analyze.RG_d_res_low ? _refine_analyze.RG_free ? _refine_analyze.RG_work ? _refine_analyze.RG_free_work_ratio ? _refine_analyze.pdbx_Luzzati_d_res_high_obs ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 1.790 _refine_hist.d_res_low 26.43 _refine_hist.number_atoms_solvent 106 _refine_hist.number_atoms_total 1971 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 1865 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.008 ? 1871 ? t_bond_d 2.00 HARMONIC 'X-RAY DIFFRACTION' ? 0.82 ? 2473 ? t_angle_deg 2.00 HARMONIC 'X-RAY DIFFRACTION' ? ? ? 783 ? t_dihedral_angle_d 2.00 SINUSOIDAL 'X-RAY DIFFRACTION' ? ? ? ? ? t_incorr_chiral_ct ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? t_pseud_angle ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? t_trig_c_planes ? ? 'X-RAY DIFFRACTION' ? ? ? 334 ? t_gen_planes 5.00 HARMONIC 'X-RAY DIFFRACTION' ? ? ? 1871 ? t_it 10.00 HARMONIC 'X-RAY DIFFRACTION' ? ? ? ? ? t_nbd ? ? 'X-RAY DIFFRACTION' ? 2.11 ? ? ? t_omega_torsion ? ? 'X-RAY DIFFRACTION' ? 18.01 ? ? ? t_other_torsion ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? t_improper_torsion ? ? 'X-RAY DIFFRACTION' ? ? ? 223 ? t_chiral_improper_torsion 5.00 SEMIHARMONIC 'X-RAY DIFFRACTION' ? ? ? ? ? t_sum_occupancies ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? t_utility_distance ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? t_utility_angle ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? t_utility_torsion ? ? 'X-RAY DIFFRACTION' ? ? ? 1612 ? t_ideal_dist_contact 4.00 SEMIHARMONIC # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 1.79 _refine_ls_shell.d_res_low 1.80 _refine_ls_shell.number_reflns_all 479 _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free ? _refine_ls_shell.number_reflns_R_work 455 _refine_ls_shell.percent_reflns_obs 92.15 _refine_ls_shell.percent_reflns_R_free 5.01 _refine_ls_shell.R_factor_all 0.2665 _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.R_factor_R_work 0.2678 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_R_complete ? _refine_ls_shell.pdbx_total_number_of_bins_used 51 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? _refine_ls_shell.R_factor_R_free 0.2391 # _struct.entry_id 9AVM _struct.title 'Crystal Structure of CARD9 coiled-coil K156-K214' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 9AVM _struct_keywords.text 'Adapter protein, immune system' _struct_keywords.pdbx_keywords 'IMMUNE SYSTEM' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? C N N 1 ? D N N 1 ? E N N 2 ? F N N 2 ? G N N 2 ? H N N 2 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code CARD9_HUMAN _struct_ref.pdbx_db_accession Q9H257 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code KHQERVQRLKEECEAGSRELKRCKEENYDLAMRLAHQSEEKGAALMRNRDLQLEIDQLK _struct_ref.pdbx_align_begin 156 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 9AVM A 2 ? 60 ? Q9H257 156 ? 214 ? 156 214 2 1 9AVM B 2 ? 60 ? Q9H257 156 ? 214 ? 156 214 3 1 9AVM C 2 ? 60 ? Q9H257 156 ? 214 ? 156 214 4 1 9AVM D 2 ? 60 ? Q9H257 156 ? 214 ? 156 214 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 9AVM ALA A 1 ? UNP Q9H257 ? ? 'expression tag' 155 1 2 9AVM ALA B 1 ? UNP Q9H257 ? ? 'expression tag' 155 2 3 9AVM ALA C 1 ? UNP Q9H257 ? ? 'expression tag' 155 3 4 9AVM ALA D 1 ? UNP Q9H257 ? ? 'expression tag' 155 4 # loop_ _pdbx_struct_assembly.id _pdbx_struct_assembly.details _pdbx_struct_assembly.method_details _pdbx_struct_assembly.oligomeric_details _pdbx_struct_assembly.oligomeric_count 1 author_and_software_defined_assembly PISA dimeric 2 2 author_and_software_defined_assembly PISA dimeric 2 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 2390 ? 1 MORE -20 ? 1 'SSA (A^2)' 8350 ? 2 'ABSA (A^2)' 2720 ? 2 MORE -26 ? 2 'SSA (A^2)' 9480 ? # loop_ _pdbx_struct_assembly_gen.assembly_id _pdbx_struct_assembly_gen.oper_expression _pdbx_struct_assembly_gen.asym_id_list 1 1 A,B,E,F 2 1 C,D,G,H # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ARG A 9 ? LYS A 60 ? ARG A 163 LYS A 214 1 ? 52 HELX_P HELX_P2 AA2 VAL B 7 ? LYS B 60 ? VAL B 161 LYS B 214 1 ? 54 HELX_P HELX_P3 AA3 LYS C 2 ? LYS C 60 ? LYS C 156 LYS C 214 1 ? 59 HELX_P HELX_P4 AA4 LYS D 2 ? LYS D 60 ? LYS D 156 LYS D 214 1 ? 59 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 24 SG ? ? ? 1_555 B CYS 24 SG ? ? A CYS 178 B CYS 178 1_555 ? ? ? ? ? ? ? 2.851 ? ? disulf2 disulf ? ? C CYS 24 SG ? ? ? 1_555 D CYS 24 SG ? ? C CYS 178 D CYS 178 1_555 ? ? ? ? ? ? ? 2.818 ? ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 CYS A 24 ? CYS B 24 ? CYS A 178 ? 1_555 CYS B 178 ? 1_555 SG SG . . . None 'Disulfide bridge' 2 CYS C 24 ? CYS D 24 ? CYS C 178 ? 1_555 CYS D 178 ? 1_555 SG SG . . . None 'Disulfide bridge' # _pdbx_entry_details.entry_id 9AVM _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A ALA 155 ? A ALA 1 2 1 Y 1 A LYS 156 ? A LYS 2 3 1 Y 1 A HIS 157 ? A HIS 3 4 1 Y 1 A GLN 158 ? A GLN 4 5 1 Y 1 A GLU 159 ? A GLU 5 6 1 Y 1 A ARG 160 ? A ARG 6 7 1 Y 1 A VAL 161 ? A VAL 7 8 1 Y 1 A GLN 162 ? A GLN 8 9 1 Y 1 B ALA 155 ? B ALA 1 10 1 Y 1 B LYS 156 ? B LYS 2 11 1 Y 1 B HIS 157 ? B HIS 3 12 1 Y 1 B GLN 158 ? B GLN 4 13 1 Y 1 B GLU 159 ? B GLU 5 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 HOH O O N N 158 HOH H1 H N N 159 HOH H2 H N N 160 ILE N N N N 161 ILE CA C N S 162 ILE C C N N 163 ILE O O N N 164 ILE CB C N S 165 ILE CG1 C N N 166 ILE CG2 C N N 167 ILE CD1 C N N 168 ILE OXT O N N 169 ILE H H N N 170 ILE H2 H N N 171 ILE HA H N N 172 ILE HB H N N 173 ILE HG12 H N N 174 ILE HG13 H N N 175 ILE HG21 H N N 176 ILE HG22 H N N 177 ILE HG23 H N N 178 ILE HD11 H N N 179 ILE HD12 H N N 180 ILE HD13 H N N 181 ILE HXT H N N 182 LEU N N N N 183 LEU CA C N S 184 LEU C C N N 185 LEU O O N N 186 LEU CB C N N 187 LEU CG C N N 188 LEU CD1 C N N 189 LEU CD2 C N N 190 LEU OXT O N N 191 LEU H H N N 192 LEU H2 H N N 193 LEU HA H N N 194 LEU HB2 H N N 195 LEU HB3 H N N 196 LEU HG H N N 197 LEU HD11 H N N 198 LEU HD12 H N N 199 LEU HD13 H N N 200 LEU HD21 H N N 201 LEU HD22 H N N 202 LEU HD23 H N N 203 LEU HXT H N N 204 LYS N N N N 205 LYS CA C N S 206 LYS C C N N 207 LYS O O N N 208 LYS CB C N N 209 LYS CG C N N 210 LYS CD C N N 211 LYS CE C N N 212 LYS NZ N N N 213 LYS OXT O N N 214 LYS H H N N 215 LYS H2 H N N 216 LYS HA H N N 217 LYS HB2 H N N 218 LYS HB3 H N N 219 LYS HG2 H N N 220 LYS HG3 H N N 221 LYS HD2 H N N 222 LYS HD3 H N N 223 LYS HE2 H N N 224 LYS HE3 H N N 225 LYS HZ1 H N N 226 LYS HZ2 H N N 227 LYS HZ3 H N N 228 LYS HXT H N N 229 MET N N N N 230 MET CA C N S 231 MET C C N N 232 MET O O N N 233 MET CB C N N 234 MET CG C N N 235 MET SD S N N 236 MET CE C N N 237 MET OXT O N N 238 MET H H N N 239 MET H2 H N N 240 MET HA H N N 241 MET HB2 H N N 242 MET HB3 H N N 243 MET HG2 H N N 244 MET HG3 H N N 245 MET HE1 H N N 246 MET HE2 H N N 247 MET HE3 H N N 248 MET HXT H N N 249 SER N N N N 250 SER CA C N S 251 SER C C N N 252 SER O O N N 253 SER CB C N N 254 SER OG O N N 255 SER OXT O N N 256 SER H H N N 257 SER H2 H N N 258 SER HA H N N 259 SER HB2 H N N 260 SER HB3 H N N 261 SER HG H N N 262 SER HXT H N N 263 TYR N N N N 264 TYR CA C N S 265 TYR C C N N 266 TYR O O N N 267 TYR CB C N N 268 TYR CG C Y N 269 TYR CD1 C Y N 270 TYR CD2 C Y N 271 TYR CE1 C Y N 272 TYR CE2 C Y N 273 TYR CZ C Y N 274 TYR OH O N N 275 TYR OXT O N N 276 TYR H H N N 277 TYR H2 H N N 278 TYR HA H N N 279 TYR HB2 H N N 280 TYR HB3 H N N 281 TYR HD1 H N N 282 TYR HD2 H N N 283 TYR HE1 H N N 284 TYR HE2 H N N 285 TYR HH H N N 286 TYR HXT H N N 287 VAL N N N N 288 VAL CA C N S 289 VAL C C N N 290 VAL O O N N 291 VAL CB C N N 292 VAL CG1 C N N 293 VAL CG2 C N N 294 VAL OXT O N N 295 VAL H H N N 296 VAL H2 H N N 297 VAL HA H N N 298 VAL HB H N N 299 VAL HG11 H N N 300 VAL HG12 H N N 301 VAL HG13 H N N 302 VAL HG21 H N N 303 VAL HG22 H N N 304 VAL HG23 H N N 305 VAL HXT H N N 306 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MET N CA sing N N 218 MET N H sing N N 219 MET N H2 sing N N 220 MET CA C sing N N 221 MET CA CB sing N N 222 MET CA HA sing N N 223 MET C O doub N N 224 MET C OXT sing N N 225 MET CB CG sing N N 226 MET CB HB2 sing N N 227 MET CB HB3 sing N N 228 MET CG SD sing N N 229 MET CG HG2 sing N N 230 MET CG HG3 sing N N 231 MET SD CE sing N N 232 MET CE HE1 sing N N 233 MET CE HE2 sing N N 234 MET CE HE3 sing N N 235 MET OXT HXT sing N N 236 SER N CA sing N N 237 SER N H sing N N 238 SER N H2 sing N N 239 SER CA C sing N N 240 SER CA CB sing N N 241 SER CA HA sing N N 242 SER C O doub N N 243 SER C OXT sing N N 244 SER CB OG sing N N 245 SER CB HB2 sing N N 246 SER CB HB3 sing N N 247 SER OG HG sing N N 248 SER OXT HXT sing N N 249 TYR N CA sing N N 250 TYR N H sing N N 251 TYR N H2 sing N N 252 TYR CA C sing N N 253 TYR CA CB sing N N 254 TYR CA HA sing N N 255 TYR C O doub N N 256 TYR C OXT sing N N 257 TYR CB CG sing N N 258 TYR CB HB2 sing N N 259 TYR CB HB3 sing N N 260 TYR CG CD1 doub Y N 261 TYR CG CD2 sing Y N 262 TYR CD1 CE1 sing Y N 263 TYR CD1 HD1 sing N N 264 TYR CD2 CE2 doub Y N 265 TYR CD2 HD2 sing N N 266 TYR CE1 CZ doub Y N 267 TYR CE1 HE1 sing N N 268 TYR CE2 CZ sing Y N 269 TYR CE2 HE2 sing N N 270 TYR CZ OH sing N N 271 TYR OH HH sing N N 272 TYR OXT HXT sing N N 273 VAL N CA sing N N 274 VAL N H sing N N 275 VAL N H2 sing N N 276 VAL CA C sing N N 277 VAL CA CB sing N N 278 VAL CA HA sing N N 279 VAL C O doub N N 280 VAL C OXT sing N N 281 VAL CB CG1 sing N N 282 VAL CB CG2 sing N N 283 VAL CB HB sing N N 284 VAL CG1 HG11 sing N N 285 VAL CG1 HG12 sing N N 286 VAL CG1 HG13 sing N N 287 VAL CG2 HG21 sing N N 288 VAL CG2 HG22 sing N N 289 VAL CG2 HG23 sing N N 290 VAL OXT HXT sing N N 291 # _pdbx_audit_support.funding_organization 'Other private' _pdbx_audit_support.country ? _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'in silico model' _pdbx_initial_refinement_model.source_name Other _pdbx_initial_refinement_model.accession_code ? _pdbx_initial_refinement_model.details 'An idealized helix was used for molecular replacement' # _atom_sites.entry_id 9AVM _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 0.036590 _atom_sites.fract_transf_matrix[1][2] -0.008414 _atom_sites.fract_transf_matrix[1][3] -0.004700 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.021014 _atom_sites.fract_transf_matrix[2][3] -0.006352 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.019113 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C N O S # loop_ #