data_9AZA # _entry.id 9AZA # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.395 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 9AZA pdb_00009aza 10.2210/pdb9aza/pdb WWPDB D_1000282351 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2024-07-17 2 'Structure model' 1 1 2024-08-07 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_audit_revision_group.ordinal 1 _pdbx_audit_revision_group.revision_ordinal 2 _pdbx_audit_revision_group.data_content_type 'Structure model' _pdbx_audit_revision_group.group 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_ASTM' 4 2 'Structure model' '_citation.journal_id_CSD' 5 2 'Structure model' '_citation.journal_id_ISSN' 6 2 'Structure model' '_citation.journal_volume' 7 2 'Structure model' '_citation.page_first' 8 2 'Structure model' '_citation.page_last' 9 2 'Structure model' '_citation.pdbx_database_id_DOI' 10 2 'Structure model' '_citation.pdbx_database_id_PubMed' 11 2 'Structure model' '_citation.title' 12 2 'Structure model' '_citation.year' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 9AZA _pdbx_database_status.recvd_initial_deposition_date 2024-03-10 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_database_related.db_name PDB _pdbx_database_related.details . _pdbx_database_related.db_id 8DL5 _pdbx_database_related.content_type unspecified # _pdbx_contact_author.id 2 _pdbx_contact_author.email hai@chem.ucsb.edu _pdbx_contact_author.name_first Yang _pdbx_contact_author.name_last Hai _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-2039-5367 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Gao, J.' 1 ? 'Hai, Y.' 2 ? # loop_ _citation.abstract _citation.abstract_id_CAS _citation.book_id_ISBN _citation.book_publisher _citation.book_publisher_city _citation.book_title _citation.coordinate_linkage _citation.country _citation.database_id_Medline _citation.details _citation.id _citation.journal_abbrev _citation.journal_id_ASTM _citation.journal_id_CSD _citation.journal_id_ISSN _citation.journal_full _citation.journal_issue _citation.journal_volume _citation.language _citation.page_first _citation.page_last _citation.title _citation.year _citation.database_id_CSD _citation.pdbx_database_id_DOI _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_patent _citation.unpublished_flag ? ? ? ? ? ? ? US ? ? primary J.Am.Chem.Soc. JACSAT ? 1520-5126 ? ? 146 ? 20263 20269 'Enzymatic Synthesis of Unprotected alpha , beta-Diamino Acids via Direct Asymmetric Mannich Reactions.' 2024 ? 10.1021/jacs.4c05581 39001849 ? ? ? ? ? ? ? ? ? DK ? ? 1 'Acta Crystallogr., Sect. D: Biol. Crystallogr.' ABCRE6 0766 0907-4449 ? ? 75 ? 861 877 'Macromolecular structure determination using X-rays, neutrons and electrons: recent developments in Phenix' 2019 ? 10.1107/S2059798319011471 31588918 ? ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Liu, S.' 1 ? primary 'Gao, J.' 2 ? primary 'Zou, Y.' 3 0000-0003-4380-7827 primary 'Hai, Y.' 4 0000-0002-2039-5367 1 'Liebschner, D.' 5 0000-0003-3921-3209 1 'Afonine, P.V.' 6 0000-0002-5052-991X 1 'Baker, M.L.' 7 ? 1 'Bunkoczi, G.' 8 ? 1 'Chen, V.B.' 9 0000-0003-2492-979X 1 'Croll, T.I.' 10 ? 1 'Hintze, B.' 11 0000-0002-4871-2096 1 'Hung, L.W.' 12 0000-0001-6690-8458 1 'Jain, S.' 13 ? 1 'McCoy, A.J.' 14 ? 1 'Moriarty, N.W.' 15 0000-0001-8857-9464 1 'Oeffner, R.D.' 16 0000-0003-3107-2202 1 'Poon, B.K.' 17 0000-0001-9633-6067 1 'Prisant, M.G.' 18 ? 1 'Read, R.J.' 19 0000-0001-8273-0047 1 'Richardson, J.S.' 20 0000-0002-3311-2944 1 'Richardson, D.C.' 21 ? 1 'Sammito, M.D.' 22 0000-0002-8346-9247 1 'Sobolev, O.V.' 23 0000-0002-0623-3214 1 'Stockwell, D.H.' 24 ? 1 'Terwilliger, T.C.' 25 0000-0001-6384-0320 1 'Urzhumtsev, A.G.' 26 ? 1 'Videau, L.L.' 27 ? 1 'Williams, C.J.' 28 ? 1 'Adams, P.D.' 29 0000-0001-9333-8219 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Aminotransferase, class V/Cysteine desulfurase' 52942.410 1 ? ? ? ? 2 non-polymer syn "PYRIDOXAL-5'-PHOSPHATE" 247.142 1 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MPALPLSENEGWKRPTTPFGKPMLKHFCMNPEYRNLNAASCGSWPKTVRDQWRRYLDDLEAQPDYFSEVKQGPVIQEARR EVAQLLHARVSECVFISNATTGIYTVLHNIPFDKDDVIITFSTTYGAIDNAIASMAETQPFQTRKVTVDLPMRGEDIVAR FEGMVAQIKAEGLHPRLAVLETIVSIPAIRMPFESLVQACQREGVLSLVDGAHSIGQFSLNLEVLQPDFFIMDCHKWLFV PRPCAALYVPERNQHYIRSTIPPSFGFIPRDGKPALPLWSKQSGGGSSGSTATDFETIFANVATQDNMPHMCIPTALKFR REVCGGEEAIYQYLRVLAKEGGDRVAAILGTEVLDEKPAGEYKSQRTPSEMRDCGIATVRLPLAVSSSLKPPPHSGTPYS PLSDEEVGPAVHYLSMTLAETHKTWLYLIDHGGYIWVRLCAQIYLDTSDFEWIGNVLKEICETIGKKGHVISKH ; _entity_poly.pdbx_seq_one_letter_code_can ;MPALPLSENEGWKRPTTPFGKPMLKHFCMNPEYRNLNAASCGSWPKTVRDQWRRYLDDLEAQPDYFSEVKQGPVIQEARR EVAQLLHARVSECVFISNATTGIYTVLHNIPFDKDDVIITFSTTYGAIDNAIASMAETQPFQTRKVTVDLPMRGEDIVAR FEGMVAQIKAEGLHPRLAVLETIVSIPAIRMPFESLVQACQREGVLSLVDGAHSIGQFSLNLEVLQPDFFIMDCHKWLFV PRPCAALYVPERNQHYIRSTIPPSFGFIPRDGKPALPLWSKQSGGGSSGSTATDFETIFANVATQDNMPHMCIPTALKFR REVCGGEEAIYQYLRVLAKEGGDRVAAILGTEVLDEKPAGEYKSQRTPSEMRDCGIATVRLPLAVSSSLKPPPHSGTPYS PLSDEEVGPAVHYLSMTLAETHKTWLYLIDHGGYIWVRLCAQIYLDTSDFEWIGNVLKEICETIGKKGHVISKH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name "PYRIDOXAL-5'-PHOSPHATE" _pdbx_entity_nonpoly.comp_id PLP # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 PRO n 1 3 ALA n 1 4 LEU n 1 5 PRO n 1 6 LEU n 1 7 SER n 1 8 GLU n 1 9 ASN n 1 10 GLU n 1 11 GLY n 1 12 TRP n 1 13 LYS n 1 14 ARG n 1 15 PRO n 1 16 THR n 1 17 THR n 1 18 PRO n 1 19 PHE n 1 20 GLY n 1 21 LYS n 1 22 PRO n 1 23 MET n 1 24 LEU n 1 25 LYS n 1 26 HIS n 1 27 PHE n 1 28 CYS n 1 29 MET n 1 30 ASN n 1 31 PRO n 1 32 GLU n 1 33 TYR n 1 34 ARG n 1 35 ASN n 1 36 LEU n 1 37 ASN n 1 38 ALA n 1 39 ALA n 1 40 SER n 1 41 CYS n 1 42 GLY n 1 43 SER n 1 44 TRP n 1 45 PRO n 1 46 LYS n 1 47 THR n 1 48 VAL n 1 49 ARG n 1 50 ASP n 1 51 GLN n 1 52 TRP n 1 53 ARG n 1 54 ARG n 1 55 TYR n 1 56 LEU n 1 57 ASP n 1 58 ASP n 1 59 LEU n 1 60 GLU n 1 61 ALA n 1 62 GLN n 1 63 PRO n 1 64 ASP n 1 65 TYR n 1 66 PHE n 1 67 SER n 1 68 GLU n 1 69 VAL n 1 70 LYS n 1 71 GLN n 1 72 GLY n 1 73 PRO n 1 74 VAL n 1 75 ILE n 1 76 GLN n 1 77 GLU n 1 78 ALA n 1 79 ARG n 1 80 ARG n 1 81 GLU n 1 82 VAL n 1 83 ALA n 1 84 GLN n 1 85 LEU n 1 86 LEU n 1 87 HIS n 1 88 ALA n 1 89 ARG n 1 90 VAL n 1 91 SER n 1 92 GLU n 1 93 CYS n 1 94 VAL n 1 95 PHE n 1 96 ILE n 1 97 SER n 1 98 ASN n 1 99 ALA n 1 100 THR n 1 101 THR n 1 102 GLY n 1 103 ILE n 1 104 TYR n 1 105 THR n 1 106 VAL n 1 107 LEU n 1 108 HIS n 1 109 ASN n 1 110 ILE n 1 111 PRO n 1 112 PHE n 1 113 ASP n 1 114 LYS n 1 115 ASP n 1 116 ASP n 1 117 VAL n 1 118 ILE n 1 119 ILE n 1 120 THR n 1 121 PHE n 1 122 SER n 1 123 THR n 1 124 THR n 1 125 TYR n 1 126 GLY n 1 127 ALA n 1 128 ILE n 1 129 ASP n 1 130 ASN n 1 131 ALA n 1 132 ILE n 1 133 ALA n 1 134 SER n 1 135 MET n 1 136 ALA n 1 137 GLU n 1 138 THR n 1 139 GLN n 1 140 PRO n 1 141 PHE n 1 142 GLN n 1 143 THR n 1 144 ARG n 1 145 LYS n 1 146 VAL n 1 147 THR n 1 148 VAL n 1 149 ASP n 1 150 LEU n 1 151 PRO n 1 152 MET n 1 153 ARG n 1 154 GLY n 1 155 GLU n 1 156 ASP n 1 157 ILE n 1 158 VAL n 1 159 ALA n 1 160 ARG n 1 161 PHE n 1 162 GLU n 1 163 GLY n 1 164 MET n 1 165 VAL n 1 166 ALA n 1 167 GLN n 1 168 ILE n 1 169 LYS n 1 170 ALA n 1 171 GLU n 1 172 GLY n 1 173 LEU n 1 174 HIS n 1 175 PRO n 1 176 ARG n 1 177 LEU n 1 178 ALA n 1 179 VAL n 1 180 LEU n 1 181 GLU n 1 182 THR n 1 183 ILE n 1 184 VAL n 1 185 SER n 1 186 ILE n 1 187 PRO n 1 188 ALA n 1 189 ILE n 1 190 ARG n 1 191 MET n 1 192 PRO n 1 193 PHE n 1 194 GLU n 1 195 SER n 1 196 LEU n 1 197 VAL n 1 198 GLN n 1 199 ALA n 1 200 CYS n 1 201 GLN n 1 202 ARG n 1 203 GLU n 1 204 GLY n 1 205 VAL n 1 206 LEU n 1 207 SER n 1 208 LEU n 1 209 VAL n 1 210 ASP n 1 211 GLY n 1 212 ALA n 1 213 HIS n 1 214 SER n 1 215 ILE n 1 216 GLY n 1 217 GLN n 1 218 PHE n 1 219 SER n 1 220 LEU n 1 221 ASN n 1 222 LEU n 1 223 GLU n 1 224 VAL n 1 225 LEU n 1 226 GLN n 1 227 PRO n 1 228 ASP n 1 229 PHE n 1 230 PHE n 1 231 ILE n 1 232 MET n 1 233 ASP n 1 234 CYS n 1 235 HIS n 1 236 LYS n 1 237 TRP n 1 238 LEU n 1 239 PHE n 1 240 VAL n 1 241 PRO n 1 242 ARG n 1 243 PRO n 1 244 CYS n 1 245 ALA n 1 246 ALA n 1 247 LEU n 1 248 TYR n 1 249 VAL n 1 250 PRO n 1 251 GLU n 1 252 ARG n 1 253 ASN n 1 254 GLN n 1 255 HIS n 1 256 TYR n 1 257 ILE n 1 258 ARG n 1 259 SER n 1 260 THR n 1 261 ILE n 1 262 PRO n 1 263 PRO n 1 264 SER n 1 265 PHE n 1 266 GLY n 1 267 PHE n 1 268 ILE n 1 269 PRO n 1 270 ARG n 1 271 ASP n 1 272 GLY n 1 273 LYS n 1 274 PRO n 1 275 ALA n 1 276 LEU n 1 277 PRO n 1 278 LEU n 1 279 TRP n 1 280 SER n 1 281 LYS n 1 282 GLN n 1 283 SER n 1 284 GLY n 1 285 GLY n 1 286 GLY n 1 287 SER n 1 288 SER n 1 289 GLY n 1 290 SER n 1 291 THR n 1 292 ALA n 1 293 THR n 1 294 ASP n 1 295 PHE n 1 296 GLU n 1 297 THR n 1 298 ILE n 1 299 PHE n 1 300 ALA n 1 301 ASN n 1 302 VAL n 1 303 ALA n 1 304 THR n 1 305 GLN n 1 306 ASP n 1 307 ASN n 1 308 MET n 1 309 PRO n 1 310 HIS n 1 311 MET n 1 312 CYS n 1 313 ILE n 1 314 PRO n 1 315 THR n 1 316 ALA n 1 317 LEU n 1 318 LYS n 1 319 PHE n 1 320 ARG n 1 321 ARG n 1 322 GLU n 1 323 VAL n 1 324 CYS n 1 325 GLY n 1 326 GLY n 1 327 GLU n 1 328 GLU n 1 329 ALA n 1 330 ILE n 1 331 TYR n 1 332 GLN n 1 333 TYR n 1 334 LEU n 1 335 ARG n 1 336 VAL n 1 337 LEU n 1 338 ALA n 1 339 LYS n 1 340 GLU n 1 341 GLY n 1 342 GLY n 1 343 ASP n 1 344 ARG n 1 345 VAL n 1 346 ALA n 1 347 ALA n 1 348 ILE n 1 349 LEU n 1 350 GLY n 1 351 THR n 1 352 GLU n 1 353 VAL n 1 354 LEU n 1 355 ASP n 1 356 GLU n 1 357 LYS n 1 358 PRO n 1 359 ALA n 1 360 GLY n 1 361 GLU n 1 362 TYR n 1 363 LYS n 1 364 SER n 1 365 GLN n 1 366 ARG n 1 367 THR n 1 368 PRO n 1 369 SER n 1 370 GLU n 1 371 MET n 1 372 ARG n 1 373 ASP n 1 374 CYS n 1 375 GLY n 1 376 ILE n 1 377 ALA n 1 378 THR n 1 379 VAL n 1 380 ARG n 1 381 LEU n 1 382 PRO n 1 383 LEU n 1 384 ALA n 1 385 VAL n 1 386 SER n 1 387 SER n 1 388 SER n 1 389 LEU n 1 390 LYS n 1 391 PRO n 1 392 PRO n 1 393 PRO n 1 394 HIS n 1 395 SER n 1 396 GLY n 1 397 THR n 1 398 PRO n 1 399 TYR n 1 400 SER n 1 401 PRO n 1 402 LEU n 1 403 SER n 1 404 ASP n 1 405 GLU n 1 406 GLU n 1 407 VAL n 1 408 GLY n 1 409 PRO n 1 410 ALA n 1 411 VAL n 1 412 HIS n 1 413 TYR n 1 414 LEU n 1 415 SER n 1 416 MET n 1 417 THR n 1 418 LEU n 1 419 ALA n 1 420 GLU n 1 421 THR n 1 422 HIS n 1 423 LYS n 1 424 THR n 1 425 TRP n 1 426 LEU n 1 427 TYR n 1 428 LEU n 1 429 ILE n 1 430 ASP n 1 431 HIS n 1 432 GLY n 1 433 GLY n 1 434 TYR n 1 435 ILE n 1 436 TRP n 1 437 VAL n 1 438 ARG n 1 439 LEU n 1 440 CYS n 1 441 ALA n 1 442 GLN n 1 443 ILE n 1 444 TYR n 1 445 LEU n 1 446 ASP n 1 447 THR n 1 448 SER n 1 449 ASP n 1 450 PHE n 1 451 GLU n 1 452 TRP n 1 453 ILE n 1 454 GLY n 1 455 ASN n 1 456 VAL n 1 457 LEU n 1 458 LYS n 1 459 GLU n 1 460 ILE n 1 461 CYS n 1 462 GLU n 1 463 THR n 1 464 ILE n 1 465 GLY n 1 466 LYS n 1 467 LYS n 1 468 GLY n 1 469 HIS n 1 470 VAL n 1 471 ILE n 1 472 SER n 1 473 LYS n 1 474 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 474 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene PEX2_110450 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Penicillium expansum' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 27334 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PLP non-polymer . "PYRIDOXAL-5'-PHOSPHATE" 'VITAMIN B6 Phosphate' 'C8 H10 N O6 P' 247.142 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 PRO 2 2 ? ? ? A . n A 1 3 ALA 3 3 ? ? ? A . n A 1 4 LEU 4 4 ? ? ? A . n A 1 5 PRO 5 5 ? ? ? A . n A 1 6 LEU 6 6 ? ? ? A . n A 1 7 SER 7 7 ? ? ? A . n A 1 8 GLU 8 8 ? ? ? A . n A 1 9 ASN 9 9 ? ? ? A . n A 1 10 GLU 10 10 ? ? ? A . n A 1 11 GLY 11 11 ? ? ? A . n A 1 12 TRP 12 12 ? ? ? A . n A 1 13 LYS 13 13 ? ? ? A . n A 1 14 ARG 14 14 ? ? ? A . n A 1 15 PRO 15 15 ? ? ? A . n A 1 16 THR 16 16 16 THR THR A . n A 1 17 THR 17 17 17 THR THR A . n A 1 18 PRO 18 18 18 PRO PRO A . n A 1 19 PHE 19 19 19 PHE PHE A . n A 1 20 GLY 20 20 20 GLY GLY A . n A 1 21 LYS 21 21 21 LYS LYS A . n A 1 22 PRO 22 22 22 PRO PRO A . n A 1 23 MET 23 23 23 MET MET A . n A 1 24 LEU 24 24 24 LEU LEU A . n A 1 25 LYS 25 25 25 LYS LYS A . n A 1 26 HIS 26 26 26 HIS HIS A . n A 1 27 PHE 27 27 27 PHE PHE A . n A 1 28 CYS 28 28 28 CYS CYS A . n A 1 29 MET 29 29 29 MET MET A . n A 1 30 ASN 30 30 30 ASN ASN A . n A 1 31 PRO 31 31 31 PRO PRO A . n A 1 32 GLU 32 32 32 GLU GLU A . n A 1 33 TYR 33 33 33 TYR TYR A . n A 1 34 ARG 34 34 34 ARG ARG A . n A 1 35 ASN 35 35 35 ASN ASN A . n A 1 36 LEU 36 36 36 LEU LEU A . n A 1 37 ASN 37 37 37 ASN ASN A . n A 1 38 ALA 38 38 38 ALA ALA A . n A 1 39 ALA 39 39 39 ALA ALA A . n A 1 40 SER 40 40 40 SER SER A . n A 1 41 CYS 41 41 41 CYS CYS A . n A 1 42 GLY 42 42 42 GLY GLY A . n A 1 43 SER 43 43 43 SER SER A . n A 1 44 TRP 44 44 44 TRP TRP A . n A 1 45 PRO 45 45 45 PRO PRO A . n A 1 46 LYS 46 46 46 LYS LYS A . n A 1 47 THR 47 47 47 THR THR A . n A 1 48 VAL 48 48 48 VAL VAL A . n A 1 49 ARG 49 49 49 ARG ARG A . n A 1 50 ASP 50 50 50 ASP ASP A . n A 1 51 GLN 51 51 51 GLN GLN A . n A 1 52 TRP 52 52 52 TRP TRP A . n A 1 53 ARG 53 53 53 ARG ARG A . n A 1 54 ARG 54 54 54 ARG ARG A . n A 1 55 TYR 55 55 55 TYR TYR A . n A 1 56 LEU 56 56 56 LEU LEU A . n A 1 57 ASP 57 57 57 ASP ASP A . n A 1 58 ASP 58 58 58 ASP ASP A . n A 1 59 LEU 59 59 59 LEU LEU A . n A 1 60 GLU 60 60 60 GLU GLU A . n A 1 61 ALA 61 61 61 ALA ALA A . n A 1 62 GLN 62 62 62 GLN GLN A . n A 1 63 PRO 63 63 63 PRO PRO A . n A 1 64 ASP 64 64 64 ASP ASP A . n A 1 65 TYR 65 65 65 TYR TYR A . n A 1 66 PHE 66 66 66 PHE PHE A . n A 1 67 SER 67 67 67 SER SER A . n A 1 68 GLU 68 68 68 GLU GLU A . n A 1 69 VAL 69 69 69 VAL VAL A . n A 1 70 LYS 70 70 70 LYS LYS A . n A 1 71 GLN 71 71 71 GLN GLN A . n A 1 72 GLY 72 72 72 GLY GLY A . n A 1 73 PRO 73 73 73 PRO PRO A . n A 1 74 VAL 74 74 74 VAL VAL A . n A 1 75 ILE 75 75 75 ILE ILE A . n A 1 76 GLN 76 76 76 GLN GLN A . n A 1 77 GLU 77 77 77 GLU GLU A . n A 1 78 ALA 78 78 78 ALA ALA A . n A 1 79 ARG 79 79 79 ARG ARG A . n A 1 80 ARG 80 80 80 ARG ARG A . n A 1 81 GLU 81 81 81 GLU GLU A . n A 1 82 VAL 82 82 82 VAL VAL A . n A 1 83 ALA 83 83 83 ALA ALA A . n A 1 84 GLN 84 84 84 GLN GLN A . n A 1 85 LEU 85 85 85 LEU LEU A . n A 1 86 LEU 86 86 86 LEU LEU A . n A 1 87 HIS 87 87 87 HIS HIS A . n A 1 88 ALA 88 88 88 ALA ALA A . n A 1 89 ARG 89 89 89 ARG ARG A . n A 1 90 VAL 90 90 90 VAL VAL A . n A 1 91 SER 91 91 91 SER SER A . n A 1 92 GLU 92 92 92 GLU GLU A . n A 1 93 CYS 93 93 93 CYS CYS A . n A 1 94 VAL 94 94 94 VAL VAL A . n A 1 95 PHE 95 95 95 PHE PHE A . n A 1 96 ILE 96 96 96 ILE ILE A . n A 1 97 SER 97 97 97 SER SER A . n A 1 98 ASN 98 98 98 ASN ASN A . n A 1 99 ALA 99 99 99 ALA ALA A . n A 1 100 THR 100 100 100 THR THR A . n A 1 101 THR 101 101 101 THR THR A . n A 1 102 GLY 102 102 102 GLY GLY A . n A 1 103 ILE 103 103 103 ILE ILE A . n A 1 104 TYR 104 104 104 TYR TYR A . n A 1 105 THR 105 105 105 THR THR A . n A 1 106 VAL 106 106 106 VAL VAL A . n A 1 107 LEU 107 107 107 LEU LEU A . n A 1 108 HIS 108 108 108 HIS HIS A . n A 1 109 ASN 109 109 109 ASN ASN A . n A 1 110 ILE 110 110 110 ILE ILE A . n A 1 111 PRO 111 111 111 PRO PRO A . n A 1 112 PHE 112 112 112 PHE PHE A . n A 1 113 ASP 113 113 113 ASP ASP A . n A 1 114 LYS 114 114 114 LYS LYS A . n A 1 115 ASP 115 115 115 ASP ASP A . n A 1 116 ASP 116 116 116 ASP ASP A . n A 1 117 VAL 117 117 117 VAL VAL A . n A 1 118 ILE 118 118 118 ILE ILE A . n A 1 119 ILE 119 119 119 ILE ILE A . n A 1 120 THR 120 120 120 THR THR A . n A 1 121 PHE 121 121 121 PHE PHE A . n A 1 122 SER 122 122 122 SER SER A . n A 1 123 THR 123 123 123 THR THR A . n A 1 124 THR 124 124 124 THR THR A . n A 1 125 TYR 125 125 125 TYR TYR A . n A 1 126 GLY 126 126 126 GLY GLY A . n A 1 127 ALA 127 127 127 ALA ALA A . n A 1 128 ILE 128 128 128 ILE ILE A . n A 1 129 ASP 129 129 129 ASP ASP A . n A 1 130 ASN 130 130 130 ASN ASN A . n A 1 131 ALA 131 131 131 ALA ALA A . n A 1 132 ILE 132 132 132 ILE ILE A . n A 1 133 ALA 133 133 133 ALA ALA A . n A 1 134 SER 134 134 134 SER SER A . n A 1 135 MET 135 135 135 MET MET A . n A 1 136 ALA 136 136 136 ALA ALA A . n A 1 137 GLU 137 137 137 GLU GLU A . n A 1 138 THR 138 138 138 THR THR A . n A 1 139 GLN 139 139 139 GLN GLN A . n A 1 140 PRO 140 140 140 PRO PRO A . n A 1 141 PHE 141 141 141 PHE PHE A . n A 1 142 GLN 142 142 142 GLN GLN A . n A 1 143 THR 143 143 143 THR THR A . n A 1 144 ARG 144 144 144 ARG ARG A . n A 1 145 LYS 145 145 145 LYS LYS A . n A 1 146 VAL 146 146 146 VAL VAL A . n A 1 147 THR 147 147 147 THR THR A . n A 1 148 VAL 148 148 148 VAL VAL A . n A 1 149 ASP 149 149 149 ASP ASP A . n A 1 150 LEU 150 150 150 LEU LEU A . n A 1 151 PRO 151 151 151 PRO PRO A . n A 1 152 MET 152 152 152 MET MET A . n A 1 153 ARG 153 153 153 ARG ARG A . n A 1 154 GLY 154 154 154 GLY GLY A . n A 1 155 GLU 155 155 155 GLU GLU A . n A 1 156 ASP 156 156 156 ASP ASP A . n A 1 157 ILE 157 157 157 ILE ILE A . n A 1 158 VAL 158 158 158 VAL VAL A . n A 1 159 ALA 159 159 159 ALA ALA A . n A 1 160 ARG 160 160 160 ARG ARG A . n A 1 161 PHE 161 161 161 PHE PHE A . n A 1 162 GLU 162 162 162 GLU GLU A . n A 1 163 GLY 163 163 163 GLY GLY A . n A 1 164 MET 164 164 164 MET MET A . n A 1 165 VAL 165 165 165 VAL VAL A . n A 1 166 ALA 166 166 166 ALA ALA A . n A 1 167 GLN 167 167 167 GLN GLN A . n A 1 168 ILE 168 168 168 ILE ILE A . n A 1 169 LYS 169 169 169 LYS LYS A . n A 1 170 ALA 170 170 170 ALA ALA A . n A 1 171 GLU 171 171 171 GLU GLU A . n A 1 172 GLY 172 172 172 GLY GLY A . n A 1 173 LEU 173 173 173 LEU LEU A . n A 1 174 HIS 174 174 174 HIS HIS A . n A 1 175 PRO 175 175 175 PRO PRO A . n A 1 176 ARG 176 176 176 ARG ARG A . n A 1 177 LEU 177 177 177 LEU LEU A . n A 1 178 ALA 178 178 178 ALA ALA A . n A 1 179 VAL 179 179 179 VAL VAL A . n A 1 180 LEU 180 180 180 LEU LEU A . n A 1 181 GLU 181 181 181 GLU GLU A . n A 1 182 THR 182 182 182 THR THR A . n A 1 183 ILE 183 183 183 ILE ILE A . n A 1 184 VAL 184 184 184 VAL VAL A . n A 1 185 SER 185 185 185 SER SER A . n A 1 186 ILE 186 186 186 ILE ILE A . n A 1 187 PRO 187 187 187 PRO PRO A . n A 1 188 ALA 188 188 188 ALA ALA A . n A 1 189 ILE 189 189 189 ILE ILE A . n A 1 190 ARG 190 190 190 ARG ARG A . n A 1 191 MET 191 191 191 MET MET A . n A 1 192 PRO 192 192 192 PRO PRO A . n A 1 193 PHE 193 193 193 PHE PHE A . n A 1 194 GLU 194 194 194 GLU GLU A . n A 1 195 SER 195 195 195 SER SER A . n A 1 196 LEU 196 196 196 LEU LEU A . n A 1 197 VAL 197 197 197 VAL VAL A . n A 1 198 GLN 198 198 198 GLN GLN A . n A 1 199 ALA 199 199 199 ALA ALA A . n A 1 200 CYS 200 200 200 CYS CYS A . n A 1 201 GLN 201 201 201 GLN GLN A . n A 1 202 ARG 202 202 202 ARG ARG A . n A 1 203 GLU 203 203 203 GLU GLU A . n A 1 204 GLY 204 204 204 GLY GLY A . n A 1 205 VAL 205 205 205 VAL VAL A . n A 1 206 LEU 206 206 206 LEU LEU A . n A 1 207 SER 207 207 207 SER SER A . n A 1 208 LEU 208 208 208 LEU LEU A . n A 1 209 VAL 209 209 209 VAL VAL A . n A 1 210 ASP 210 210 210 ASP ASP A . n A 1 211 GLY 211 211 211 GLY GLY A . n A 1 212 ALA 212 212 212 ALA ALA A . n A 1 213 HIS 213 213 213 HIS HIS A . n A 1 214 SER 214 214 214 SER SER A . n A 1 215 ILE 215 215 215 ILE ILE A . n A 1 216 GLY 216 216 216 GLY GLY A . n A 1 217 GLN 217 217 217 GLN GLN A . n A 1 218 PHE 218 218 218 PHE PHE A . n A 1 219 SER 219 219 219 SER SER A . n A 1 220 LEU 220 220 220 LEU LEU A . n A 1 221 ASN 221 221 221 ASN ASN A . n A 1 222 LEU 222 222 222 LEU LEU A . n A 1 223 GLU 223 223 223 GLU GLU A . n A 1 224 VAL 224 224 224 VAL VAL A . n A 1 225 LEU 225 225 225 LEU LEU A . n A 1 226 GLN 226 226 226 GLN GLN A . n A 1 227 PRO 227 227 227 PRO PRO A . n A 1 228 ASP 228 228 228 ASP ASP A . n A 1 229 PHE 229 229 229 PHE PHE A . n A 1 230 PHE 230 230 230 PHE PHE A . n A 1 231 ILE 231 231 231 ILE ILE A . n A 1 232 MET 232 232 232 MET MET A . n A 1 233 ASP 233 233 233 ASP ASP A . n A 1 234 CYS 234 234 234 CYS CYS A . n A 1 235 HIS 235 235 235 HIS HIS A . n A 1 236 LYS 236 236 236 LYS LLP A . n A 1 237 TRP 237 237 237 TRP TRP A . n A 1 238 LEU 238 238 238 LEU LEU A . n A 1 239 PHE 239 239 239 PHE PHE A . n A 1 240 VAL 240 240 240 VAL VAL A . n A 1 241 PRO 241 241 241 PRO PRO A . n A 1 242 ARG 242 242 242 ARG ARG A . n A 1 243 PRO 243 243 243 PRO PRO A . n A 1 244 CYS 244 244 244 CYS CYS A . n A 1 245 ALA 245 245 245 ALA ALA A . n A 1 246 ALA 246 246 246 ALA ALA A . n A 1 247 LEU 247 247 247 LEU LEU A . n A 1 248 TYR 248 248 248 TYR TYR A . n A 1 249 VAL 249 249 249 VAL VAL A . n A 1 250 PRO 250 250 250 PRO PRO A . n A 1 251 GLU 251 251 251 GLU GLU A . n A 1 252 ARG 252 252 252 ARG ARG A . n A 1 253 ASN 253 253 253 ASN ASN A . n A 1 254 GLN 254 254 254 GLN GLN A . n A 1 255 HIS 255 255 255 HIS HIS A . n A 1 256 TYR 256 256 256 TYR TYR A . n A 1 257 ILE 257 257 257 ILE ILE A . n A 1 258 ARG 258 258 258 ARG ARG A . n A 1 259 SER 259 259 259 SER SER A . n A 1 260 THR 260 260 260 THR THR A . n A 1 261 ILE 261 261 261 ILE ILE A . n A 1 262 PRO 262 262 262 PRO PRO A . n A 1 263 PRO 263 263 263 PRO PRO A . n A 1 264 SER 264 264 264 SER SER A . n A 1 265 PHE 265 265 265 PHE PHE A . n A 1 266 GLY 266 266 266 GLY GLY A . n A 1 267 PHE 267 267 267 PHE PHE A . n A 1 268 ILE 268 268 268 ILE ILE A . n A 1 269 PRO 269 269 269 PRO PRO A . n A 1 270 ARG 270 270 270 ARG ARG A . n A 1 271 ASP 271 271 ? ? ? A . n A 1 272 GLY 272 272 ? ? ? A . n A 1 273 LYS 273 273 ? ? ? A . n A 1 274 PRO 274 274 ? ? ? A . n A 1 275 ALA 275 275 ? ? ? A . n A 1 276 LEU 276 276 ? ? ? A . n A 1 277 PRO 277 277 ? ? ? A . n A 1 278 LEU 278 278 ? ? ? A . n A 1 279 TRP 279 279 ? ? ? A . n A 1 280 SER 280 280 ? ? ? A . n A 1 281 LYS 281 281 ? ? ? A . n A 1 282 GLN 282 282 ? ? ? A . n A 1 283 SER 283 283 ? ? ? A . n A 1 284 GLY 284 284 ? ? ? A . n A 1 285 GLY 285 285 ? ? ? A . n A 1 286 GLY 286 286 ? ? ? A . n A 1 287 SER 287 287 ? ? ? A . n A 1 288 SER 288 288 ? ? ? A . n A 1 289 GLY 289 289 ? ? ? A . n A 1 290 SER 290 290 ? ? ? A . n A 1 291 THR 291 291 291 THR THR A . n A 1 292 ALA 292 292 292 ALA ALA A . n A 1 293 THR 293 293 293 THR THR A . n A 1 294 ASP 294 294 294 ASP ASP A . n A 1 295 PHE 295 295 295 PHE PHE A . n A 1 296 GLU 296 296 296 GLU GLU A . n A 1 297 THR 297 297 297 THR THR A . n A 1 298 ILE 298 298 298 ILE ILE A . n A 1 299 PHE 299 299 299 PHE PHE A . n A 1 300 ALA 300 300 300 ALA ALA A . n A 1 301 ASN 301 301 301 ASN ASN A . n A 1 302 VAL 302 302 302 VAL VAL A . n A 1 303 ALA 303 303 303 ALA ALA A . n A 1 304 THR 304 304 304 THR THR A . n A 1 305 GLN 305 305 305 GLN GLN A . n A 1 306 ASP 306 306 306 ASP ASP A . n A 1 307 ASN 307 307 307 ASN ASN A . n A 1 308 MET 308 308 308 MET MET A . n A 1 309 PRO 309 309 309 PRO PRO A . n A 1 310 HIS 310 310 310 HIS HIS A . n A 1 311 MET 311 311 311 MET MET A . n A 1 312 CYS 312 312 312 CYS CYS A . n A 1 313 ILE 313 313 313 ILE ILE A . n A 1 314 PRO 314 314 314 PRO PRO A . n A 1 315 THR 315 315 315 THR THR A . n A 1 316 ALA 316 316 316 ALA ALA A . n A 1 317 LEU 317 317 317 LEU LEU A . n A 1 318 LYS 318 318 318 LYS LYS A . n A 1 319 PHE 319 319 319 PHE PHE A . n A 1 320 ARG 320 320 320 ARG ARG A . n A 1 321 ARG 321 321 321 ARG ARG A . n A 1 322 GLU 322 322 322 GLU GLU A . n A 1 323 VAL 323 323 323 VAL VAL A . n A 1 324 CYS 324 324 324 CYS CYS A . n A 1 325 GLY 325 325 325 GLY GLY A . n A 1 326 GLY 326 326 326 GLY GLY A . n A 1 327 GLU 327 327 327 GLU GLU A . n A 1 328 GLU 328 328 328 GLU GLU A . n A 1 329 ALA 329 329 329 ALA ALA A . n A 1 330 ILE 330 330 330 ILE ILE A . n A 1 331 TYR 331 331 331 TYR TYR A . n A 1 332 GLN 332 332 332 GLN GLN A . n A 1 333 TYR 333 333 333 TYR TYR A . n A 1 334 LEU 334 334 334 LEU LEU A . n A 1 335 ARG 335 335 335 ARG ARG A . n A 1 336 VAL 336 336 336 VAL VAL A . n A 1 337 LEU 337 337 337 LEU LEU A . n A 1 338 ALA 338 338 338 ALA ALA A . n A 1 339 LYS 339 339 339 LYS LYS A . n A 1 340 GLU 340 340 340 GLU GLU A . n A 1 341 GLY 341 341 341 GLY GLY A . n A 1 342 GLY 342 342 342 GLY GLY A . n A 1 343 ASP 343 343 343 ASP ASP A . n A 1 344 ARG 344 344 344 ARG ARG A . n A 1 345 VAL 345 345 345 VAL VAL A . n A 1 346 ALA 346 346 346 ALA ALA A . n A 1 347 ALA 347 347 347 ALA ALA A . n A 1 348 ILE 348 348 348 ILE ILE A . n A 1 349 LEU 349 349 349 LEU LEU A . n A 1 350 GLY 350 350 350 GLY GLY A . n A 1 351 THR 351 351 351 THR THR A . n A 1 352 GLU 352 352 352 GLU GLU A . n A 1 353 VAL 353 353 353 VAL VAL A . n A 1 354 LEU 354 354 354 LEU LEU A . n A 1 355 ASP 355 355 355 ASP ASP A . n A 1 356 GLU 356 356 356 GLU GLU A . n A 1 357 LYS 357 357 357 LYS LYS A . n A 1 358 PRO 358 358 ? ? ? A . n A 1 359 ALA 359 359 ? ? ? A . n A 1 360 GLY 360 360 ? ? ? A . n A 1 361 GLU 361 361 ? ? ? A . n A 1 362 TYR 362 362 ? ? ? A . n A 1 363 LYS 363 363 ? ? ? A . n A 1 364 SER 364 364 ? ? ? A . n A 1 365 GLN 365 365 ? ? ? A . n A 1 366 ARG 366 366 ? ? ? A . n A 1 367 THR 367 367 ? ? ? A . n A 1 368 PRO 368 368 ? ? ? A . n A 1 369 SER 369 369 ? ? ? A . n A 1 370 GLU 370 370 370 GLU GLU A . n A 1 371 MET 371 371 371 MET MET A . n A 1 372 ARG 372 372 372 ARG ARG A . n A 1 373 ASP 373 373 373 ASP ASP A . n A 1 374 CYS 374 374 374 CYS CYS A . n A 1 375 GLY 375 375 375 GLY GLY A . n A 1 376 ILE 376 376 376 ILE ILE A . n A 1 377 ALA 377 377 377 ALA ALA A . n A 1 378 THR 378 378 378 THR THR A . n A 1 379 VAL 379 379 379 VAL VAL A . n A 1 380 ARG 380 380 380 ARG ARG A . n A 1 381 LEU 381 381 381 LEU LEU A . n A 1 382 PRO 382 382 382 PRO PRO A . n A 1 383 LEU 383 383 383 LEU LEU A . n A 1 384 ALA 384 384 384 ALA ALA A . n A 1 385 VAL 385 385 ? ? ? A . n A 1 386 SER 386 386 ? ? ? A . n A 1 387 SER 387 387 ? ? ? A . n A 1 388 SER 388 388 ? ? ? A . n A 1 389 LEU 389 389 ? ? ? A . n A 1 390 LYS 390 390 ? ? ? A . n A 1 391 PRO 391 391 ? ? ? A . n A 1 392 PRO 392 392 ? ? ? A . n A 1 393 PRO 393 393 ? ? ? A . n A 1 394 HIS 394 394 ? ? ? A . n A 1 395 SER 395 395 ? ? ? A . n A 1 396 GLY 396 396 ? ? ? A . n A 1 397 THR 397 397 ? ? ? A . n A 1 398 PRO 398 398 ? ? ? A . n A 1 399 TYR 399 399 ? ? ? A . n A 1 400 SER 400 400 ? ? ? A . n A 1 401 PRO 401 401 ? ? ? A . n A 1 402 LEU 402 402 ? ? ? A . n A 1 403 SER 403 403 ? ? ? A . n A 1 404 ASP 404 404 ? ? ? A . n A 1 405 GLU 405 405 ? ? ? A . n A 1 406 GLU 406 406 ? ? ? A . n A 1 407 VAL 407 407 407 VAL VAL A . n A 1 408 GLY 408 408 408 GLY GLY A . n A 1 409 PRO 409 409 409 PRO PRO A . n A 1 410 ALA 410 410 410 ALA ALA A . n A 1 411 VAL 411 411 411 VAL VAL A . n A 1 412 HIS 412 412 412 HIS HIS A . n A 1 413 TYR 413 413 413 TYR TYR A . n A 1 414 LEU 414 414 414 LEU LEU A . n A 1 415 SER 415 415 415 SER SER A . n A 1 416 MET 416 416 416 MET MET A . n A 1 417 THR 417 417 417 THR THR A . n A 1 418 LEU 418 418 418 LEU LEU A . n A 1 419 ALA 419 419 419 ALA ALA A . n A 1 420 GLU 420 420 420 GLU GLU A . n A 1 421 THR 421 421 421 THR THR A . n A 1 422 HIS 422 422 422 HIS HIS A . n A 1 423 LYS 423 423 423 LYS LYS A . n A 1 424 THR 424 424 424 THR THR A . n A 1 425 TRP 425 425 425 TRP TRP A . n A 1 426 LEU 426 426 426 LEU LEU A . n A 1 427 TYR 427 427 427 TYR TYR A . n A 1 428 LEU 428 428 428 LEU LEU A . n A 1 429 ILE 429 429 429 ILE ILE A . n A 1 430 ASP 430 430 430 ASP ASP A . n A 1 431 HIS 431 431 431 HIS HIS A . n A 1 432 GLY 432 432 432 GLY GLY A . n A 1 433 GLY 433 433 433 GLY GLY A . n A 1 434 TYR 434 434 434 TYR TYR A . n A 1 435 ILE 435 435 435 ILE ILE A . n A 1 436 TRP 436 436 436 TRP TRP A . n A 1 437 VAL 437 437 437 VAL VAL A . n A 1 438 ARG 438 438 438 ARG ARG A . n A 1 439 LEU 439 439 439 LEU LEU A . n A 1 440 CYS 440 440 440 CYS CYS A . n A 1 441 ALA 441 441 441 ALA ALA A . n A 1 442 GLN 442 442 442 GLN GLN A . n A 1 443 ILE 443 443 443 ILE ILE A . n A 1 444 TYR 444 444 444 TYR TYR A . n A 1 445 LEU 445 445 445 LEU LEU A . n A 1 446 ASP 446 446 446 ASP ASP A . n A 1 447 THR 447 447 447 THR THR A . n A 1 448 SER 448 448 448 SER SER A . n A 1 449 ASP 449 449 449 ASP ASP A . n A 1 450 PHE 450 450 450 PHE PHE A . n A 1 451 GLU 451 451 451 GLU GLU A . n A 1 452 TRP 452 452 452 TRP TRP A . n A 1 453 ILE 453 453 453 ILE ILE A . n A 1 454 GLY 454 454 454 GLY GLY A . n A 1 455 ASN 455 455 455 ASN ASN A . n A 1 456 VAL 456 456 456 VAL VAL A . n A 1 457 LEU 457 457 457 LEU LEU A . n A 1 458 LYS 458 458 458 LYS LYS A . n A 1 459 GLU 459 459 459 GLU GLU A . n A 1 460 ILE 460 460 460 ILE ILE A . n A 1 461 CYS 461 461 461 CYS CYS A . n A 1 462 GLU 462 462 462 GLU GLU A . n A 1 463 THR 463 463 463 THR THR A . n A 1 464 ILE 464 464 ? ? ? A . n A 1 465 GLY 465 465 ? ? ? A . n A 1 466 LYS 466 466 ? ? ? A . n A 1 467 LYS 467 467 ? ? ? A . n A 1 468 GLY 468 468 ? ? ? A . n A 1 469 HIS 469 469 ? ? ? A . n A 1 470 VAL 470 470 ? ? ? A . n A 1 471 ILE 471 471 ? ? ? A . n A 1 472 SER 472 472 ? ? ? A . n A 1 473 LYS 473 473 ? ? ? A . n A 1 474 HIS 474 474 ? ? ? A . n # _pdbx_nonpoly_scheme.asym_id B _pdbx_nonpoly_scheme.entity_id 2 _pdbx_nonpoly_scheme.mon_id PLP _pdbx_nonpoly_scheme.ndb_seq_num 1 _pdbx_nonpoly_scheme.pdb_seq_num 501 _pdbx_nonpoly_scheme.auth_seq_num 236 _pdbx_nonpoly_scheme.pdb_mon_id PLP _pdbx_nonpoly_scheme.auth_mon_id LLP _pdbx_nonpoly_scheme.pdb_strand_id A _pdbx_nonpoly_scheme.pdb_ins_code . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.21_5207 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-3000 ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-3000 ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 120.000 _cell.angle_gamma_esd ? _cell.entry_id 9AZA _cell.details ? _cell.formula_units_Z ? _cell.length_a 74.239 _cell.length_a_esd ? _cell.length_b 74.239 _cell.length_b_esd ? _cell.length_c 154.669 _cell.length_c_esd ? _cell.volume 738240.957 _cell.volume_esd ? _cell.Z_PDB 6 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 9AZA _symmetry.cell_setting ? _symmetry.Int_Tables_number 154 _symmetry.space_group_name_Hall ;P 32 2" ; _symmetry.space_group_name_H-M 'P 32 2 1' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 9AZA _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.31 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 46.85 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.2 M MES buffer, pH=5.6, 18%PEG4000' _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 293 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER2 X 16M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2024-03-05 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97946 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SSRL BEAMLINE BL12-1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.97946 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL12-1 _diffrn_source.pdbx_synchrotron_site SSRL # _reflns.B_iso_Wilson_estimate 93.11 _reflns.entry_id 9AZA _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.84 _reflns.d_resolution_low 37.12 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 11705 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 96.2 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 18.8 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 52.0 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all 0.020 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.997 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 2.84 _reflns_shell.d_res_low 2.90 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 566 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all 0.302 _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.895 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.percent_possible_all ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 89.18 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 9AZA _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.84 _refine.ls_d_res_low 37.12 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 11591 _refine.ls_number_reflns_R_free 551 _refine.ls_number_reflns_R_work 11040 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 95.20 _refine.ls_percent_reflns_R_free 4.75 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2285 _refine.ls_R_factor_R_free 0.2548 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2270 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.34 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values 'GeoStd + Monomer Library + CDL v1.2' _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1000 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 36.7932 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.3535 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 2.84 _refine_hist.d_res_low 37.12 _refine_hist.number_atoms_solvent 0 _refine_hist.number_atoms_total 3142 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 3142 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.0055 ? 3217 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.8774 ? 4374 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.0501 ? 489 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.0078 ? 563 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 16.0755 ? 1176 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free _refine_ls_shell.R_factor_R_free 'X-RAY DIFFRACTION' 2.84 3.13 . . 130 2781 98.05 . . . . 0.3437 . . . . . . . . . . . 0.4302 'X-RAY DIFFRACTION' 3.13 3.58 . . 130 2834 98.77 . . . . 0.2711 . . . . . . . . . . . 0.3594 'X-RAY DIFFRACTION' 3.58 4.50 . . 132 2432 85.15 . . . . 0.2653 . . . . . . . . . . . 0.2620 'X-RAY DIFFRACTION' 4.51 37.12 . . 159 2993 98.65 . . . . 0.1869 . . . . . . . . . . . 0.2163 # _struct.entry_id 9AZA _struct.title 'Crystal structure of LolTv4' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 9AZA _struct_keywords.text 'Mannichase, BIOSYNTHETIC PROTEIN' _struct_keywords.pdbx_keywords 'BIOSYNTHETIC PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code A0A0A2J6G6_PENEN _struct_ref.pdbx_db_accession A0A0A2J6G6 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MPALPLSENEGWKRPTTPFGKPMLKHFCMNPEYRNLNAPSCGSWPKTVRDQWRRYLDDLEAQPDYFSEVKQGPVIQEARR EVAQLLHARVSECVFISNATTGIYTVLHNIPFDKDDVIITFSTTYGAIDNAIASMAETQPFQTRKVTVDLPMRGEDIVAR FEGMVAQIKAEGLHPRLAVLETIVSIPAIRMPFESLVQACQREGVLSLVDGAHSIGQFSLNLEVLQPDFFIMDCHKWLFV PRPCAALYVPERNQHYIRSTIPPSFGFIPRDGKPALPLWSKQSGGGSSGSTATDFETIFAYVATSDNMPHMCIPTALKFR REVCGGEEAIYQYLRVLAKEGGDRVAAILGTEVLDEKPAGEYKSQRTPSEMRDCGIATVRLPLAVSSSLKPPPHSGTPYS PLSDEEVGPAVHYLSMTLAETHKTWLPLIDHGGYIWVRLCAQIYLDTSDFEWIGNVLKEICETIGKKGHVISKH ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 9AZA _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 474 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession A0A0A2J6G6 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 474 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 474 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 9AZA ALA A 39 ? UNP A0A0A2J6G6 PRO 39 conflict 39 1 1 9AZA ASN A 301 ? UNP A0A0A2J6G6 TYR 301 conflict 301 2 1 9AZA GLN A 305 ? UNP A0A0A2J6G6 SER 305 conflict 305 3 1 9AZA TYR A 427 ? UNP A0A0A2J6G6 PRO 427 conflict 427 4 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 6790 ? 1 MORE -31 ? 1 'SSA (A^2)' 29190 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 5_555 x-y,-y,-z+1/3 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 51.5563333333 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 PRO A 22 ? PHE A 27 ? PRO A 22 PHE A 27 5 ? 6 HELX_P HELX_P2 AA2 PRO A 45 ? GLN A 62 ? PRO A 45 GLN A 62 1 ? 18 HELX_P HELX_P3 AA3 GLN A 62 ? VAL A 69 ? GLN A 62 VAL A 69 1 ? 8 HELX_P HELX_P4 AA4 LYS A 70 ? HIS A 87 ? LYS A 70 HIS A 87 1 ? 18 HELX_P HELX_P5 AA5 ARG A 89 ? SER A 91 ? ARG A 89 SER A 91 5 ? 3 HELX_P HELX_P6 AA6 ASN A 98 ? ILE A 110 ? ASN A 98 ILE A 110 1 ? 13 HELX_P HELX_P7 AA7 TYR A 125 ? GLN A 139 ? TYR A 125 GLN A 139 1 ? 15 HELX_P HELX_P8 AA8 ARG A 153 ? GLU A 171 ? ARG A 153 GLU A 171 1 ? 19 HELX_P HELX_P9 AA9 PRO A 192 ? GLU A 203 ? PRO A 192 GLU A 203 1 ? 12 HELX_P HELX_P10 AB1 ASN A 221 ? GLN A 226 ? ASN A 221 GLN A 226 1 ? 6 HELX_P HELX_P11 AB2 PRO A 250 ? GLN A 254 ? PRO A 250 GLN A 254 5 ? 5 HELX_P HELX_P12 AB3 THR A 293 ? PHE A 299 ? THR A 293 PHE A 299 1 ? 7 HELX_P HELX_P13 AB4 ASN A 307 ? VAL A 323 ? ASN A 307 VAL A 323 1 ? 17 HELX_P HELX_P14 AB5 GLY A 326 ? GLY A 350 ? GLY A 326 GLY A 350 1 ? 25 HELX_P HELX_P15 AB6 GLY A 408 ? GLU A 420 ? GLY A 408 GLU A 420 1 ? 13 HELX_P HELX_P16 AB7 ASP A 446 ? THR A 463 ? ASP A 446 THR A 463 1 ? 18 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id covale1 _struct_conn.conn_type_id covale _struct_conn.pdbx_leaving_atom_flag one _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id LYS _struct_conn.ptnr1_label_seq_id 236 _struct_conn.ptnr1_label_atom_id NZ _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id B _struct_conn.ptnr2_label_comp_id PLP _struct_conn.ptnr2_label_seq_id . _struct_conn.ptnr2_label_atom_id C4A _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id LYS _struct_conn.ptnr1_auth_seq_id 236 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id PLP _struct_conn.ptnr2_auth_seq_id 501 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 1.286 _struct_conn.pdbx_value_order ? _struct_conn.pdbx_role ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 LEU 150 A . ? LEU 150 A PRO 151 A ? PRO 151 A 1 6.38 2 ILE 186 A . ? ILE 186 A PRO 187 A ? PRO 187 A 1 1.99 3 ARG 242 A . ? ARG 242 A PRO 243 A ? PRO 243 A 1 -3.42 4 ILE 261 A . ? ILE 261 A PRO 262 A ? PRO 262 A 1 0.17 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 7 ? AA2 ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? parallel AA1 4 5 ? parallel AA1 5 6 ? parallel AA1 6 7 ? parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 CYS A 93 ? ILE A 96 ? CYS A 93 ILE A 96 AA1 2 ALA A 245 ? TYR A 248 ? ALA A 245 TYR A 248 AA1 3 PHE A 229 ? ASP A 233 ? PHE A 229 ASP A 233 AA1 4 LEU A 206 ? ASP A 210 ? LEU A 206 ASP A 210 AA1 5 HIS A 174 ? GLU A 181 ? HIS A 174 GLU A 181 AA1 6 ASP A 116 ? PHE A 121 ? ASP A 116 PHE A 121 AA1 7 GLN A 142 ? VAL A 146 ? GLN A 142 VAL A 146 AA2 1 ILE A 376 ? ARG A 380 ? ILE A 376 ARG A 380 AA2 2 TYR A 434 ? CYS A 440 ? TYR A 434 CYS A 440 AA2 3 LEU A 428 ? HIS A 431 ? LEU A 428 HIS A 431 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N VAL A 94 ? N VAL A 94 O LEU A 247 ? O LEU A 247 AA1 2 3 O TYR A 248 ? O TYR A 248 N PHE A 230 ? N PHE A 230 AA1 3 4 O PHE A 229 ? O PHE A 229 N VAL A 209 ? N VAL A 209 AA1 4 5 O LEU A 206 ? O LEU A 206 N ALA A 178 ? N ALA A 178 AA1 5 6 O VAL A 179 ? O VAL A 179 N ILE A 119 ? N ILE A 119 AA1 6 7 N THR A 120 ? N THR A 120 O VAL A 146 ? O VAL A 146 AA2 1 2 N ALA A 377 ? N ALA A 377 O LEU A 439 ? O LEU A 439 AA2 2 3 O TRP A 436 ? O TRP A 436 N ILE A 429 ? N ILE A 429 # _pdbx_validate_rmsd_angle.id 1 _pdbx_validate_rmsd_angle.PDB_model_num 1 _pdbx_validate_rmsd_angle.auth_atom_id_1 CB _pdbx_validate_rmsd_angle.auth_asym_id_1 A _pdbx_validate_rmsd_angle.auth_comp_id_1 LEU _pdbx_validate_rmsd_angle.auth_seq_id_1 86 _pdbx_validate_rmsd_angle.PDB_ins_code_1 ? _pdbx_validate_rmsd_angle.label_alt_id_1 ? _pdbx_validate_rmsd_angle.auth_atom_id_2 CG _pdbx_validate_rmsd_angle.auth_asym_id_2 A _pdbx_validate_rmsd_angle.auth_comp_id_2 LEU _pdbx_validate_rmsd_angle.auth_seq_id_2 86 _pdbx_validate_rmsd_angle.PDB_ins_code_2 ? _pdbx_validate_rmsd_angle.label_alt_id_2 ? _pdbx_validate_rmsd_angle.auth_atom_id_3 CD1 _pdbx_validate_rmsd_angle.auth_asym_id_3 A _pdbx_validate_rmsd_angle.auth_comp_id_3 LEU _pdbx_validate_rmsd_angle.auth_seq_id_3 86 _pdbx_validate_rmsd_angle.PDB_ins_code_3 ? _pdbx_validate_rmsd_angle.label_alt_id_3 ? _pdbx_validate_rmsd_angle.angle_value 97.94 _pdbx_validate_rmsd_angle.angle_target_value 111.00 _pdbx_validate_rmsd_angle.angle_deviation -13.06 _pdbx_validate_rmsd_angle.angle_standard_deviation 1.70 _pdbx_validate_rmsd_angle.linker_flag N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ALA A 39 ? ? -88.53 48.39 2 1 SER A 40 ? ? -135.84 -71.81 3 1 VAL A 69 ? ? -127.45 -52.19 4 1 SER A 214 ? ? -160.66 -77.70 5 1 TRP A 237 ? ? -147.58 -6.97 6 1 ARG A 252 ? ? -58.36 -6.67 7 1 SER A 264 ? ? -148.49 -143.87 8 1 ALA A 303 ? ? -68.20 -178.26 9 1 THR A 351 ? ? -112.84 -133.84 10 1 ASP A 355 ? ? -154.37 -145.22 11 1 GLU A 356 ? ? -91.94 -103.74 12 1 ALA A 419 ? ? -96.31 -88.74 13 1 LYS A 423 ? ? 60.97 73.43 14 1 THR A 424 ? ? 176.48 159.31 # loop_ _space_group_symop.id _space_group_symop.operation_xyz 1 x,y,z 2 -y,x-y,z+2/3 3 -x+y,-x,z+1/3 4 x-y,-y,-z+1/3 5 -x,-x+y,-z+2/3 6 y,x,-z # _pdbx_entry_details.entry_id 9AZA _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A PRO 2 ? A PRO 2 3 1 Y 1 A ALA 3 ? A ALA 3 4 1 Y 1 A LEU 4 ? A LEU 4 5 1 Y 1 A PRO 5 ? A PRO 5 6 1 Y 1 A LEU 6 ? A LEU 6 7 1 Y 1 A SER 7 ? A SER 7 8 1 Y 1 A GLU 8 ? A GLU 8 9 1 Y 1 A ASN 9 ? A ASN 9 10 1 Y 1 A GLU 10 ? A GLU 10 11 1 Y 1 A GLY 11 ? A GLY 11 12 1 Y 1 A TRP 12 ? A TRP 12 13 1 Y 1 A LYS 13 ? A LYS 13 14 1 Y 1 A ARG 14 ? A ARG 14 15 1 Y 1 A PRO 15 ? A PRO 15 16 1 Y 1 A ASP 271 ? A ASP 271 17 1 Y 1 A GLY 272 ? A GLY 272 18 1 Y 1 A LYS 273 ? A LYS 273 19 1 Y 1 A PRO 274 ? A PRO 274 20 1 Y 1 A ALA 275 ? A ALA 275 21 1 Y 1 A LEU 276 ? A LEU 276 22 1 Y 1 A PRO 277 ? A PRO 277 23 1 Y 1 A LEU 278 ? A LEU 278 24 1 Y 1 A TRP 279 ? A TRP 279 25 1 Y 1 A SER 280 ? A SER 280 26 1 Y 1 A LYS 281 ? A LYS 281 27 1 Y 1 A GLN 282 ? A GLN 282 28 1 Y 1 A SER 283 ? A SER 283 29 1 Y 1 A GLY 284 ? A GLY 284 30 1 Y 1 A GLY 285 ? A GLY 285 31 1 Y 1 A GLY 286 ? A GLY 286 32 1 Y 1 A SER 287 ? A SER 287 33 1 Y 1 A SER 288 ? A SER 288 34 1 Y 1 A GLY 289 ? A GLY 289 35 1 Y 1 A SER 290 ? A SER 290 36 1 Y 1 A PRO 358 ? A PRO 358 37 1 Y 1 A ALA 359 ? A ALA 359 38 1 Y 1 A GLY 360 ? A GLY 360 39 1 Y 1 A GLU 361 ? A GLU 361 40 1 Y 1 A TYR 362 ? A TYR 362 41 1 Y 1 A LYS 363 ? A LYS 363 42 1 Y 1 A SER 364 ? A SER 364 43 1 Y 1 A GLN 365 ? A GLN 365 44 1 Y 1 A ARG 366 ? A ARG 366 45 1 Y 1 A THR 367 ? A THR 367 46 1 Y 1 A PRO 368 ? A PRO 368 47 1 Y 1 A SER 369 ? A SER 369 48 1 Y 1 A VAL 385 ? A VAL 385 49 1 Y 1 A SER 386 ? A SER 386 50 1 Y 1 A SER 387 ? A SER 387 51 1 Y 1 A SER 388 ? A SER 388 52 1 Y 1 A LEU 389 ? A LEU 389 53 1 Y 1 A LYS 390 ? A LYS 390 54 1 Y 1 A PRO 391 ? A PRO 391 55 1 Y 1 A PRO 392 ? A PRO 392 56 1 Y 1 A PRO 393 ? A PRO 393 57 1 Y 1 A HIS 394 ? A HIS 394 58 1 Y 1 A SER 395 ? A SER 395 59 1 Y 1 A GLY 396 ? A GLY 396 60 1 Y 1 A THR 397 ? A THR 397 61 1 Y 1 A PRO 398 ? A PRO 398 62 1 Y 1 A TYR 399 ? A TYR 399 63 1 Y 1 A SER 400 ? A SER 400 64 1 Y 1 A PRO 401 ? A PRO 401 65 1 Y 1 A LEU 402 ? A LEU 402 66 1 Y 1 A SER 403 ? A SER 403 67 1 Y 1 A ASP 404 ? A ASP 404 68 1 Y 1 A GLU 405 ? A GLU 405 69 1 Y 1 A GLU 406 ? A GLU 406 70 1 Y 1 A ILE 464 ? A ILE 464 71 1 Y 1 A GLY 465 ? A GLY 465 72 1 Y 1 A LYS 466 ? A LYS 466 73 1 Y 1 A LYS 467 ? A LYS 467 74 1 Y 1 A GLY 468 ? A GLY 468 75 1 Y 1 A HIS 469 ? A HIS 469 76 1 Y 1 A VAL 470 ? A VAL 470 77 1 Y 1 A ILE 471 ? A ILE 471 78 1 Y 1 A SER 472 ? A SER 472 79 1 Y 1 A LYS 473 ? A LYS 473 80 1 Y 1 A HIS 474 ? A HIS 474 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 ILE N N N N 158 ILE CA C N S 159 ILE C C N N 160 ILE O O N N 161 ILE CB C N S 162 ILE CG1 C N N 163 ILE CG2 C N N 164 ILE CD1 C N N 165 ILE OXT O N N 166 ILE H H N N 167 ILE H2 H N N 168 ILE HA H N N 169 ILE HB H N N 170 ILE HG12 H N N 171 ILE HG13 H N N 172 ILE HG21 H N N 173 ILE HG22 H N N 174 ILE HG23 H N N 175 ILE HD11 H N N 176 ILE HD12 H N N 177 ILE HD13 H N N 178 ILE HXT H N N 179 LEU N N N N 180 LEU CA C N S 181 LEU C C N N 182 LEU O O N N 183 LEU CB C N N 184 LEU CG C N N 185 LEU CD1 C N N 186 LEU CD2 C N N 187 LEU OXT O N N 188 LEU H H N N 189 LEU H2 H N N 190 LEU HA H N N 191 LEU HB2 H N N 192 LEU HB3 H N N 193 LEU HG H N N 194 LEU HD11 H N N 195 LEU HD12 H N N 196 LEU HD13 H N N 197 LEU HD21 H N N 198 LEU HD22 H N N 199 LEU HD23 H N N 200 LEU HXT H N N 201 LYS N N N N 202 LYS CA C N S 203 LYS C C N N 204 LYS O O N N 205 LYS CB C N N 206 LYS CG C N N 207 LYS CD C N N 208 LYS CE C N N 209 LYS NZ N N N 210 LYS OXT O N N 211 LYS H H N N 212 LYS H2 H N N 213 LYS HA H N N 214 LYS HB2 H N N 215 LYS HB3 H N N 216 LYS HG2 H N N 217 LYS HG3 H N N 218 LYS HD2 H N N 219 LYS HD3 H N N 220 LYS HE2 H N N 221 LYS HE3 H N N 222 LYS HZ1 H N N 223 LYS HZ2 H N N 224 LYS HZ3 H N N 225 LYS HXT H N N 226 MET N N N N 227 MET CA C N S 228 MET C C N N 229 MET O O N N 230 MET CB C N N 231 MET CG C N N 232 MET SD S N N 233 MET CE C N N 234 MET OXT O N N 235 MET H H N N 236 MET H2 H N N 237 MET HA H N N 238 MET HB2 H N N 239 MET HB3 H N N 240 MET HG2 H N N 241 MET HG3 H N N 242 MET HE1 H N N 243 MET HE2 H N N 244 MET HE3 H N N 245 MET HXT H N N 246 PHE N N N N 247 PHE CA C N S 248 PHE C C N N 249 PHE O O N N 250 PHE CB C N N 251 PHE CG C Y N 252 PHE CD1 C Y N 253 PHE CD2 C Y N 254 PHE CE1 C Y N 255 PHE CE2 C Y N 256 PHE CZ C Y N 257 PHE OXT O N N 258 PHE H H N N 259 PHE H2 H N N 260 PHE HA H N N 261 PHE HB2 H N N 262 PHE HB3 H N N 263 PHE HD1 H N N 264 PHE HD2 H N N 265 PHE HE1 H N N 266 PHE HE2 H N N 267 PHE HZ H N N 268 PHE HXT H N N 269 PLP N1 N Y N 270 PLP C2 C Y N 271 PLP C2A C N N 272 PLP C3 C Y N 273 PLP O3 O N N 274 PLP C4 C Y N 275 PLP C4A C N N 276 PLP O4A O N N 277 PLP C5 C Y N 278 PLP C6 C Y N 279 PLP C5A C N N 280 PLP O4P O N N 281 PLP P P N N 282 PLP O1P O N N 283 PLP O2P O N N 284 PLP O3P O N N 285 PLP H2A1 H N N 286 PLP H2A2 H N N 287 PLP H2A3 H N N 288 PLP HO3 H N N 289 PLP H4A H N N 290 PLP H6 H N N 291 PLP H5A1 H N N 292 PLP H5A2 H N N 293 PLP HOP2 H N N 294 PLP HOP3 H N N 295 PRO N N N N 296 PRO CA C N S 297 PRO C C N N 298 PRO O O N N 299 PRO CB C N N 300 PRO CG C N N 301 PRO CD C N N 302 PRO OXT O N N 303 PRO H H N N 304 PRO HA H N N 305 PRO HB2 H N N 306 PRO HB3 H N N 307 PRO HG2 H N N 308 PRO HG3 H N N 309 PRO HD2 H N N 310 PRO HD3 H N N 311 PRO HXT H N N 312 SER N N N N 313 SER CA C N S 314 SER C C N N 315 SER O O N N 316 SER CB C N N 317 SER OG O N N 318 SER OXT O N N 319 SER H H N N 320 SER H2 H N N 321 SER HA H N N 322 SER HB2 H N N 323 SER HB3 H N N 324 SER HG H N N 325 SER HXT H N N 326 THR N N N N 327 THR CA C N S 328 THR C C N N 329 THR O O N N 330 THR CB C N R 331 THR OG1 O N N 332 THR CG2 C N N 333 THR OXT O N N 334 THR H H N N 335 THR H2 H N N 336 THR HA H N N 337 THR HB H N N 338 THR HG1 H N N 339 THR HG21 H N N 340 THR HG22 H N N 341 THR HG23 H N N 342 THR HXT H N N 343 TRP N N N N 344 TRP CA C N S 345 TRP C C N N 346 TRP O O N N 347 TRP CB C N N 348 TRP CG C Y N 349 TRP CD1 C Y N 350 TRP CD2 C Y N 351 TRP NE1 N Y N 352 TRP CE2 C Y N 353 TRP CE3 C Y N 354 TRP CZ2 C Y N 355 TRP CZ3 C Y N 356 TRP CH2 C Y N 357 TRP OXT O N N 358 TRP H H N N 359 TRP H2 H N N 360 TRP HA H N N 361 TRP HB2 H N N 362 TRP HB3 H N N 363 TRP HD1 H N N 364 TRP HE1 H N N 365 TRP HE3 H N N 366 TRP HZ2 H N N 367 TRP HZ3 H N N 368 TRP HH2 H N N 369 TRP HXT H N N 370 TYR N N N N 371 TYR CA C N S 372 TYR C C N N 373 TYR O O N N 374 TYR CB C N N 375 TYR CG C Y N 376 TYR CD1 C Y N 377 TYR CD2 C Y N 378 TYR CE1 C Y N 379 TYR CE2 C Y N 380 TYR CZ C Y N 381 TYR OH O N N 382 TYR OXT O N N 383 TYR H H N N 384 TYR H2 H N N 385 TYR HA H N N 386 TYR HB2 H N N 387 TYR HB3 H N N 388 TYR HD1 H N N 389 TYR HD2 H N N 390 TYR HE1 H N N 391 TYR HE2 H N N 392 TYR HH H N N 393 TYR HXT H N N 394 VAL N N N N 395 VAL CA C N S 396 VAL C C N N 397 VAL O O N N 398 VAL CB C N N 399 VAL CG1 C N N 400 VAL CG2 C N N 401 VAL OXT O N N 402 VAL H H N N 403 VAL H2 H N N 404 VAL HA H N N 405 VAL HB H N N 406 VAL HG11 H N N 407 VAL HG12 H N N 408 VAL HG13 H N N 409 VAL HG21 H N N 410 VAL HG22 H N N 411 VAL HG23 H N N 412 VAL HXT H N N 413 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 ILE N CA sing N N 150 ILE N H sing N N 151 ILE N H2 sing N N 152 ILE CA C sing N N 153 ILE CA CB sing N N 154 ILE CA HA sing N N 155 ILE C O doub N N 156 ILE C OXT sing N N 157 ILE CB CG1 sing N N 158 ILE CB CG2 sing N N 159 ILE CB HB sing N N 160 ILE CG1 CD1 sing N N 161 ILE CG1 HG12 sing N N 162 ILE CG1 HG13 sing N N 163 ILE CG2 HG21 sing N N 164 ILE CG2 HG22 sing N N 165 ILE CG2 HG23 sing N N 166 ILE CD1 HD11 sing N N 167 ILE CD1 HD12 sing N N 168 ILE CD1 HD13 sing N N 169 ILE OXT HXT sing N N 170 LEU N CA sing N N 171 LEU N H sing N N 172 LEU N H2 sing N N 173 LEU CA C sing N N 174 LEU CA CB sing N N 175 LEU CA HA sing N N 176 LEU C O doub N N 177 LEU C OXT sing N N 178 LEU CB CG sing N N 179 LEU CB HB2 sing N N 180 LEU CB HB3 sing N N 181 LEU CG CD1 sing N N 182 LEU CG CD2 sing N N 183 LEU CG HG sing N N 184 LEU CD1 HD11 sing N N 185 LEU CD1 HD12 sing N N 186 LEU CD1 HD13 sing N N 187 LEU CD2 HD21 sing N N 188 LEU CD2 HD22 sing N N 189 LEU CD2 HD23 sing N N 190 LEU OXT HXT sing N N 191 LYS N CA sing N N 192 LYS N H sing N N 193 LYS N H2 sing N N 194 LYS CA C sing N N 195 LYS CA CB sing N N 196 LYS CA HA sing N N 197 LYS C O doub N N 198 LYS C OXT sing N N 199 LYS CB CG sing N N 200 LYS CB HB2 sing N N 201 LYS CB HB3 sing N N 202 LYS CG CD sing N N 203 LYS CG HG2 sing N N 204 LYS CG HG3 sing N N 205 LYS CD CE sing N N 206 LYS CD HD2 sing N N 207 LYS CD HD3 sing N N 208 LYS CE NZ sing N N 209 LYS CE HE2 sing N N 210 LYS CE HE3 sing N N 211 LYS NZ HZ1 sing N N 212 LYS NZ HZ2 sing N N 213 LYS NZ HZ3 sing N N 214 LYS OXT HXT sing N N 215 MET N CA sing N N 216 MET N H sing N N 217 MET N H2 sing N N 218 MET CA C sing N N 219 MET CA CB sing N N 220 MET CA HA sing N N 221 MET C O doub N N 222 MET C OXT sing N N 223 MET CB CG sing N N 224 MET CB HB2 sing N N 225 MET CB HB3 sing N N 226 MET CG SD sing N N 227 MET CG HG2 sing N N 228 MET CG HG3 sing N N 229 MET SD CE sing N N 230 MET CE HE1 sing N N 231 MET CE HE2 sing N N 232 MET CE HE3 sing N N 233 MET OXT HXT sing N N 234 PHE N CA sing N N 235 PHE N H sing N N 236 PHE N H2 sing N N 237 PHE CA C sing N N 238 PHE CA CB sing N N 239 PHE CA HA sing N N 240 PHE C O doub N N 241 PHE C OXT sing N N 242 PHE CB CG sing N N 243 PHE CB HB2 sing N N 244 PHE CB HB3 sing N N 245 PHE CG CD1 doub Y N 246 PHE CG CD2 sing Y N 247 PHE CD1 CE1 sing Y N 248 PHE CD1 HD1 sing N N 249 PHE CD2 CE2 doub Y N 250 PHE CD2 HD2 sing N N 251 PHE CE1 CZ doub Y N 252 PHE CE1 HE1 sing N N 253 PHE CE2 CZ sing Y N 254 PHE CE2 HE2 sing N N 255 PHE CZ HZ sing N N 256 PHE OXT HXT sing N N 257 PLP N1 C2 doub Y N 258 PLP N1 C6 sing Y N 259 PLP C2 C2A sing N N 260 PLP C2 C3 sing Y N 261 PLP C2A H2A1 sing N N 262 PLP C2A H2A2 sing N N 263 PLP C2A H2A3 sing N N 264 PLP C3 O3 sing N N 265 PLP C3 C4 doub Y N 266 PLP O3 HO3 sing N N 267 PLP C4 C4A sing N N 268 PLP C4 C5 sing Y N 269 PLP C4A O4A doub N N 270 PLP C4A H4A sing N N 271 PLP C5 C6 doub Y N 272 PLP C5 C5A sing N N 273 PLP C6 H6 sing N N 274 PLP C5A O4P sing N N 275 PLP C5A H5A1 sing N N 276 PLP C5A H5A2 sing N N 277 PLP O4P P sing N N 278 PLP P O1P doub N N 279 PLP P O2P sing N N 280 PLP P O3P sing N N 281 PLP O2P HOP2 sing N N 282 PLP O3P HOP3 sing N N 283 PRO N CA sing N N 284 PRO N CD sing N N 285 PRO N H sing N N 286 PRO CA C sing N N 287 PRO CA CB sing N N 288 PRO CA HA sing N N 289 PRO C O doub N N 290 PRO C OXT sing N N 291 PRO CB CG sing N N 292 PRO CB HB2 sing N N 293 PRO CB HB3 sing N N 294 PRO CG CD sing N N 295 PRO CG HG2 sing N N 296 PRO CG HG3 sing N N 297 PRO CD HD2 sing N N 298 PRO CD HD3 sing N N 299 PRO OXT HXT sing N N 300 SER N CA sing N N 301 SER N H sing N N 302 SER N H2 sing N N 303 SER CA C sing N N 304 SER CA CB sing N N 305 SER CA HA sing N N 306 SER C O doub N N 307 SER C OXT sing N N 308 SER CB OG sing N N 309 SER CB HB2 sing N N 310 SER CB HB3 sing N N 311 SER OG HG sing N N 312 SER OXT HXT sing N N 313 THR N CA sing N N 314 THR N H sing N N 315 THR N H2 sing N N 316 THR CA C sing N N 317 THR CA CB sing N N 318 THR CA HA sing N N 319 THR C O doub N N 320 THR C OXT sing N N 321 THR CB OG1 sing N N 322 THR CB CG2 sing N N 323 THR CB HB sing N N 324 THR OG1 HG1 sing N N 325 THR CG2 HG21 sing N N 326 THR CG2 HG22 sing N N 327 THR CG2 HG23 sing N N 328 THR OXT HXT sing N N 329 TRP N CA sing N N 330 TRP N H sing N N 331 TRP N H2 sing N N 332 TRP CA C sing N N 333 TRP CA CB sing N N 334 TRP CA HA sing N N 335 TRP C O doub N N 336 TRP C OXT sing N N 337 TRP CB CG sing N N 338 TRP CB HB2 sing N N 339 TRP CB HB3 sing N N 340 TRP CG CD1 doub Y N 341 TRP CG CD2 sing Y N 342 TRP CD1 NE1 sing Y N 343 TRP CD1 HD1 sing N N 344 TRP CD2 CE2 doub Y N 345 TRP CD2 CE3 sing Y N 346 TRP NE1 CE2 sing Y N 347 TRP NE1 HE1 sing N N 348 TRP CE2 CZ2 sing Y N 349 TRP CE3 CZ3 doub Y N 350 TRP CE3 HE3 sing N N 351 TRP CZ2 CH2 doub Y N 352 TRP CZ2 HZ2 sing N N 353 TRP CZ3 CH2 sing Y N 354 TRP CZ3 HZ3 sing N N 355 TRP CH2 HH2 sing N N 356 TRP OXT HXT sing N N 357 TYR N CA sing N N 358 TYR N H sing N N 359 TYR N H2 sing N N 360 TYR CA C sing N N 361 TYR CA CB sing N N 362 TYR CA HA sing N N 363 TYR C O doub N N 364 TYR C OXT sing N N 365 TYR CB CG sing N N 366 TYR CB HB2 sing N N 367 TYR CB HB3 sing N N 368 TYR CG CD1 doub Y N 369 TYR CG CD2 sing Y N 370 TYR CD1 CE1 sing Y N 371 TYR CD1 HD1 sing N N 372 TYR CD2 CE2 doub Y N 373 TYR CD2 HD2 sing N N 374 TYR CE1 CZ doub Y N 375 TYR CE1 HE1 sing N N 376 TYR CE2 CZ sing Y N 377 TYR CE2 HE2 sing N N 378 TYR CZ OH sing N N 379 TYR OH HH sing N N 380 TYR OXT HXT sing N N 381 VAL N CA sing N N 382 VAL N H sing N N 383 VAL N H2 sing N N 384 VAL CA C sing N N 385 VAL CA CB sing N N 386 VAL CA HA sing N N 387 VAL C O doub N N 388 VAL C OXT sing N N 389 VAL CB CG1 sing N N 390 VAL CB CG2 sing N N 391 VAL CB HB sing N N 392 VAL CG1 HG11 sing N N 393 VAL CG1 HG12 sing N N 394 VAL CG1 HG13 sing N N 395 VAL CG2 HG21 sing N N 396 VAL CG2 HG22 sing N N 397 VAL CG2 HG23 sing N N 398 VAL OXT HXT sing N N 399 # _pdbx_audit_support.funding_organization 'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' _pdbx_audit_support.country 'United States' _pdbx_audit_support.grant_number GM151205 _pdbx_audit_support.ordinal 1 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id PLP _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id PLP _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 8DL5 _pdbx_initial_refinement_model.details ? # _space_group.name_H-M_alt 'P 32 2 1' _space_group.name_Hall ;P 32 2" ; _space_group.IT_number 154 _space_group.crystal_system trigonal _space_group.id 1 # _atom_sites.entry_id 9AZA _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 0.013470 _atom_sites.fract_transf_matrix[1][2] 0.007777 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.015554 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.006465 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.scat_dispersion_real _atom_type.scat_dispersion_imag _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c _atom_type.scat_source _atom_type.scat_dispersion_source C ? ? 3.54356 2.42580 ? ? 25.62398 1.50364 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? N ? ? 4.01032 2.96436 ? ? 19.97189 1.75589 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O ? ? 7.96527 ? ? ? 9.05267 ? ? ? 0.0 ;1-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? P ? ? 9.51135 5.44231 ? ? 1.42069 35.72801 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? S ? ? 9.55732 6.39887 ? ? 1.23737 29.19336 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? # loop_