data_9B4W # _entry.id 9B4W # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.398 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 9B4W pdb_00009b4w 10.2210/pdb9b4w/pdb WWPDB D_1000282672 ? ? BMRB 31153 ? 10.13018/BMR31153 # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2024-11-06 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr . _pdbx_database_status.entry_id 9B4W _pdbx_database_status.recvd_initial_deposition_date 2024-03-21 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs . _pdbx_database_status.status_code_nmr_data REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_database_related.db_name BMRB _pdbx_database_related.details '4F-Trp labeled Oscillatoria Agardhii Agglutinin (OAA)' _pdbx_database_related.db_id 31153 _pdbx_database_related.content_type unspecified # loop_ _pdbx_contact_author.id _pdbx_contact_author.email _pdbx_contact_author.name_first _pdbx_contact_author.name_last _pdbx_contact_author.name_mi _pdbx_contact_author.role _pdbx_contact_author.identifier_ORCID 11 tpolenov@udel.edu Tatyana Polenova ? 'principal investigator/group leader' 0000-0002-0346-1131 12 amg100@pitt.edu Angela Gronenborn M 'principal investigator/group leader' 0000-0001-9072-3525 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Runge, B.R.' 1 0000-0003-3759-5143 'Zadorozhnyi, R.R.' 2 0000-0003-2767-2002 'Quinn, C.M.' 3 0000-0001-6172-7324 'Russell, R.W.' 4 0000-0002-3599-133X 'Lu, M.' 5 0000-0002-4156-4975 'Antolinez, S.' 6 0009-0006-9415-9873 'Struppe, J.' 7 0000-0001-9001-5991 'Schwieters, C.D.' 8 0000-0002-4216-4658 'Byeon, I.L.' 9 0000-0002-8444-0606 'Hadden-Perilla, J.' 10 0000-0003-4685-8291 'Gronenborn, A.M.' 11 0000-0001-9072-3525 'Polenova, T.' 12 0000-0002-0346-1131 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev J.Am.Chem.Soc. _citation.journal_id_ASTM JACSAT _citation.journal_id_CSD ? _citation.journal_id_ISSN 1520-5126 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Integrating 19 F Distance Restraints for Accurate Protein Structure Determination by Magic Angle Spinning NMR Spectroscopy.' _citation.year 2024 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1021/jacs.4c11373 _citation.pdbx_database_id_PubMed 39440810 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Runge, B.R.' 1 0000-0003-3759-5143 primary 'Zadorozhnyi, R.' 2 ? primary 'Quinn, C.M.' 3 0000-0001-6172-7324 primary 'Russell, R.W.' 4 ? primary 'Lu, M.' 5 0000-0002-4156-4975 primary 'Antolinez, S.' 6 0009-0006-9415-9873 primary 'Struppe, J.' 7 0000-0001-9001-5991 primary 'Schwieters, C.D.' 8 ? primary 'Byeon, I.L.' 9 ? primary 'Hadden-Perilla, J.A.' 10 0000-0003-4685-8291 primary 'Gronenborn, A.M.' 11 0000-0001-9072-3525 primary 'Polenova, T.' 12 0000-0002-0346-1131 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description Lectin _entity.formula_weight 14169.901 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;MALYNVENQ(4FW)GGSSAP(4FW)NEGGQ(4FW)EIGSRSDQNVVAINVESGDDGQTLNGTMTYAGEGPIGFRATLLGN NSYEVENQ(4FW)GGDSAP(4FW)HSGGN(4FW)ILGSRENQNVVAINVESGDDGQTLNGTMTYAGEGPIGFKGTLT ; _entity_poly.pdbx_seq_one_letter_code_can ;MALYNVENQWGGSSAPWNEGGQWEIGSRSDQNVVAINVESGDDGQTLNGTMTYAGEGPIGFRATLLGNNSYEVENQWGGD SAPWHSGGNWILGSRENQNVVAINVESGDDGQTLNGTMTYAGEGPIGFKGTLT ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ALA n 1 3 LEU n 1 4 TYR n 1 5 ASN n 1 6 VAL n 1 7 GLU n 1 8 ASN n 1 9 GLN n 1 10 4FW n 1 11 GLY n 1 12 GLY n 1 13 SER n 1 14 SER n 1 15 ALA n 1 16 PRO n 1 17 4FW n 1 18 ASN n 1 19 GLU n 1 20 GLY n 1 21 GLY n 1 22 GLN n 1 23 4FW n 1 24 GLU n 1 25 ILE n 1 26 GLY n 1 27 SER n 1 28 ARG n 1 29 SER n 1 30 ASP n 1 31 GLN n 1 32 ASN n 1 33 VAL n 1 34 VAL n 1 35 ALA n 1 36 ILE n 1 37 ASN n 1 38 VAL n 1 39 GLU n 1 40 SER n 1 41 GLY n 1 42 ASP n 1 43 ASP n 1 44 GLY n 1 45 GLN n 1 46 THR n 1 47 LEU n 1 48 ASN n 1 49 GLY n 1 50 THR n 1 51 MET n 1 52 THR n 1 53 TYR n 1 54 ALA n 1 55 GLY n 1 56 GLU n 1 57 GLY n 1 58 PRO n 1 59 ILE n 1 60 GLY n 1 61 PHE n 1 62 ARG n 1 63 ALA n 1 64 THR n 1 65 LEU n 1 66 LEU n 1 67 GLY n 1 68 ASN n 1 69 ASN n 1 70 SER n 1 71 TYR n 1 72 GLU n 1 73 VAL n 1 74 GLU n 1 75 ASN n 1 76 GLN n 1 77 4FW n 1 78 GLY n 1 79 GLY n 1 80 ASP n 1 81 SER n 1 82 ALA n 1 83 PRO n 1 84 4FW n 1 85 HIS n 1 86 SER n 1 87 GLY n 1 88 GLY n 1 89 ASN n 1 90 4FW n 1 91 ILE n 1 92 LEU n 1 93 GLY n 1 94 SER n 1 95 ARG n 1 96 GLU n 1 97 ASN n 1 98 GLN n 1 99 ASN n 1 100 VAL n 1 101 VAL n 1 102 ALA n 1 103 ILE n 1 104 ASN n 1 105 VAL n 1 106 GLU n 1 107 SER n 1 108 GLY n 1 109 ASP n 1 110 ASP n 1 111 GLY n 1 112 GLN n 1 113 THR n 1 114 LEU n 1 115 ASN n 1 116 GLY n 1 117 THR n 1 118 MET n 1 119 THR n 1 120 TYR n 1 121 ALA n 1 122 GLY n 1 123 GLU n 1 124 GLY n 1 125 PRO n 1 126 ILE n 1 127 GLY n 1 128 PHE n 1 129 LYS n 1 130 GLY n 1 131 THR n 1 132 LEU n 1 133 THR n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 133 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'OAA, NO365_04266' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Oscillatoria agardhii' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 1160 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 511693 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant Rosetta _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name 'pET-26b(+)' _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight 4FW 'L-peptide linking' n 4-FLUOROTRYPTOPHANE ? 'C11 H11 F N2 O2' 222.216 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 ALA 2 2 2 ALA ALA A . n A 1 3 LEU 3 3 3 LEU LEU A . n A 1 4 TYR 4 4 4 TYR TYR A . n A 1 5 ASN 5 5 5 ASN ASN A . n A 1 6 VAL 6 6 6 VAL VAL A . n A 1 7 GLU 7 7 7 GLU GLU A . n A 1 8 ASN 8 8 8 ASN ASN A . n A 1 9 GLN 9 9 9 GLN GLN A . n A 1 10 4FW 10 10 10 4FW 4FW A . n A 1 11 GLY 11 11 11 GLY GLY A . n A 1 12 GLY 12 12 12 GLY GLY A . n A 1 13 SER 13 13 13 SER SER A . n A 1 14 SER 14 14 14 SER SER A . n A 1 15 ALA 15 15 15 ALA ALA A . n A 1 16 PRO 16 16 16 PRO PRO A . n A 1 17 4FW 17 17 17 4FW 4FW A . n A 1 18 ASN 18 18 18 ASN ASN A . n A 1 19 GLU 19 19 19 GLU GLU A . n A 1 20 GLY 20 20 20 GLY GLY A . n A 1 21 GLY 21 21 21 GLY GLY A . n A 1 22 GLN 22 22 22 GLN GLN A . n A 1 23 4FW 23 23 23 4FW 4FW A . n A 1 24 GLU 24 24 24 GLU GLU A . n A 1 25 ILE 25 25 25 ILE ILE A . n A 1 26 GLY 26 26 26 GLY GLY A . n A 1 27 SER 27 27 27 SER SER A . n A 1 28 ARG 28 28 28 ARG ARG A . n A 1 29 SER 29 29 29 SER SER A . n A 1 30 ASP 30 30 30 ASP ASP A . n A 1 31 GLN 31 31 31 GLN GLN A . n A 1 32 ASN 32 32 32 ASN ASN A . n A 1 33 VAL 33 33 33 VAL VAL A . n A 1 34 VAL 34 34 34 VAL VAL A . n A 1 35 ALA 35 35 35 ALA ALA A . n A 1 36 ILE 36 36 36 ILE ILE A . n A 1 37 ASN 37 37 37 ASN ASN A . n A 1 38 VAL 38 38 38 VAL VAL A . n A 1 39 GLU 39 39 39 GLU GLU A . n A 1 40 SER 40 40 40 SER SER A . n A 1 41 GLY 41 41 41 GLY GLY A . n A 1 42 ASP 42 42 42 ASP ASP A . n A 1 43 ASP 43 43 43 ASP ASP A . n A 1 44 GLY 44 44 44 GLY GLY A . n A 1 45 GLN 45 45 45 GLN GLN A . n A 1 46 THR 46 46 46 THR THR A . n A 1 47 LEU 47 47 47 LEU LEU A . n A 1 48 ASN 48 48 48 ASN ASN A . n A 1 49 GLY 49 49 49 GLY GLY A . n A 1 50 THR 50 50 50 THR THR A . n A 1 51 MET 51 51 51 MET MET A . n A 1 52 THR 52 52 52 THR THR A . n A 1 53 TYR 53 53 53 TYR TYR A . n A 1 54 ALA 54 54 54 ALA ALA A . n A 1 55 GLY 55 55 55 GLY GLY A . n A 1 56 GLU 56 56 56 GLU GLU A . n A 1 57 GLY 57 57 57 GLY GLY A . n A 1 58 PRO 58 58 58 PRO PRO A . n A 1 59 ILE 59 59 59 ILE ILE A . n A 1 60 GLY 60 60 60 GLY GLY A . n A 1 61 PHE 61 61 61 PHE PHE A . n A 1 62 ARG 62 62 62 ARG ARG A . n A 1 63 ALA 63 63 63 ALA ALA A . n A 1 64 THR 64 64 64 THR THR A . n A 1 65 LEU 65 65 65 LEU LEU A . n A 1 66 LEU 66 66 66 LEU LEU A . n A 1 67 GLY 67 67 67 GLY GLY A . n A 1 68 ASN 68 68 68 ASN ASN A . n A 1 69 ASN 69 69 69 ASN ASN A . n A 1 70 SER 70 70 70 SER SER A . n A 1 71 TYR 71 71 71 TYR TYR A . n A 1 72 GLU 72 72 72 GLU GLU A . n A 1 73 VAL 73 73 73 VAL VAL A . n A 1 74 GLU 74 74 74 GLU GLU A . n A 1 75 ASN 75 75 75 ASN ASN A . n A 1 76 GLN 76 76 76 GLN GLN A . n A 1 77 4FW 77 77 77 4FW 4FW A . n A 1 78 GLY 78 78 78 GLY GLY A . n A 1 79 GLY 79 79 79 GLY GLY A . n A 1 80 ASP 80 80 80 ASP ASP A . n A 1 81 SER 81 81 81 SER SER A . n A 1 82 ALA 82 82 82 ALA ALA A . n A 1 83 PRO 83 83 83 PRO PRO A . n A 1 84 4FW 84 84 84 4FW 4FW A . n A 1 85 HIS 85 85 85 HIS HIS A . n A 1 86 SER 86 86 86 SER SER A . n A 1 87 GLY 87 87 87 GLY GLY A . n A 1 88 GLY 88 88 88 GLY GLY A . n A 1 89 ASN 89 89 89 ASN ASN A . n A 1 90 4FW 90 90 90 4FW 4FW A . n A 1 91 ILE 91 91 91 ILE ILE A . n A 1 92 LEU 92 92 92 LEU LEU A . n A 1 93 GLY 93 93 93 GLY GLY A . n A 1 94 SER 94 94 94 SER SER A . n A 1 95 ARG 95 95 95 ARG ARG A . n A 1 96 GLU 96 96 96 GLU GLU A . n A 1 97 ASN 97 97 97 ASN ASN A . n A 1 98 GLN 98 98 98 GLN GLN A . n A 1 99 ASN 99 99 99 ASN ASN A . n A 1 100 VAL 100 100 100 VAL VAL A . n A 1 101 VAL 101 101 101 VAL VAL A . n A 1 102 ALA 102 102 102 ALA ALA A . n A 1 103 ILE 103 103 103 ILE ILE A . n A 1 104 ASN 104 104 104 ASN ASN A . n A 1 105 VAL 105 105 105 VAL VAL A . n A 1 106 GLU 106 106 106 GLU GLU A . n A 1 107 SER 107 107 107 SER SER A . n A 1 108 GLY 108 108 108 GLY GLY A . n A 1 109 ASP 109 109 109 ASP ASP A . n A 1 110 ASP 110 110 110 ASP ASP A . n A 1 111 GLY 111 111 111 GLY GLY A . n A 1 112 GLN 112 112 112 GLN GLN A . n A 1 113 THR 113 113 113 THR THR A . n A 1 114 LEU 114 114 114 LEU LEU A . n A 1 115 ASN 115 115 115 ASN ASN A . n A 1 116 GLY 116 116 116 GLY GLY A . n A 1 117 THR 117 117 117 THR THR A . n A 1 118 MET 118 118 118 MET MET A . n A 1 119 THR 119 119 119 THR THR A . n A 1 120 TYR 120 120 120 TYR TYR A . n A 1 121 ALA 121 121 121 ALA ALA A . n A 1 122 GLY 122 122 122 GLY GLY A . n A 1 123 GLU 123 123 123 GLU GLU A . n A 1 124 GLY 124 124 124 GLY GLY A . n A 1 125 PRO 125 125 125 PRO PRO A . n A 1 126 ILE 126 126 126 ILE ILE A . n A 1 127 GLY 127 127 127 GLY GLY A . n A 1 128 PHE 128 128 128 PHE PHE A . n A 1 129 LYS 129 129 129 LYS LYS A . n A 1 130 GLY 130 130 130 GLY GLY A . n A 1 131 THR 131 131 131 THR THR A . n A 1 132 LEU 132 132 132 LEU LEU A . n A 1 133 THR 133 133 133 THR THR A . n # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id 4FW _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id 4FW _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 9B4W _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLID-STATE NMR' _exptl.method_details ? # _struct.entry_id 9B4W _struct.title '4F-Trp labeled Oscillatoria Agardhii Agglutinin (OAA)' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 9B4W _struct_keywords.text 'Beta Barrel, carbohydrate binding, SUGAR BINDING PROTEIN' _struct_keywords.pdbx_keywords 'SUGAR BINDING PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code C0STD7_PLAAG _struct_ref.pdbx_db_accession C0STD7 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MALYNVENQWGGSSAPWNEGGQWEIGSRSDQNVVAINVESGDDGQTLNGTMTYAGEGPIGFRATLLGNNSYEVENQWGGD SAPWHSGGNWILGSRENQNVVAINVESGDDGQTLNGTMTYAGEGPIGFKGTLT ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 9B4W _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 133 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession C0STD7 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 133 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 133 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'NMR Distance Restraints' _pdbx_struct_assembly_auth_evidence.details 'not applicable' # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0 _pdbx_struct_oper_list.matrix[1][2] 0.0 _pdbx_struct_oper_list.matrix[1][3] 0.0 _pdbx_struct_oper_list.vector[1] 0.0 _pdbx_struct_oper_list.matrix[2][1] 0.0 _pdbx_struct_oper_list.matrix[2][2] 1.0 _pdbx_struct_oper_list.matrix[2][3] 0.0 _pdbx_struct_oper_list.vector[2] 0.0 _pdbx_struct_oper_list.matrix[3][1] 0.0 _pdbx_struct_oper_list.matrix[3][2] 0.0 _pdbx_struct_oper_list.matrix[3][3] 1.0 _pdbx_struct_oper_list.vector[3] 0.0 # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? A GLN 9 C ? ? ? 1_555 A 4FW 10 N ? ? A GLN 9 A 4FW 10 1_555 ? ? ? ? ? ? ? 1.329 ? ? covale2 covale both ? A 4FW 10 C ? ? ? 1_555 A GLY 11 N ? ? A 4FW 10 A GLY 11 1_555 ? ? ? ? ? ? ? 1.330 ? ? covale3 covale both ? A PRO 16 C ? ? ? 1_555 A 4FW 17 N ? ? A PRO 16 A 4FW 17 1_555 ? ? ? ? ? ? ? 1.328 ? ? covale4 covale both ? A 4FW 17 C ? ? ? 1_555 A ASN 18 N ? ? A 4FW 17 A ASN 18 1_555 ? ? ? ? ? ? ? 1.331 ? ? covale5 covale both ? A GLN 22 C ? ? ? 1_555 A 4FW 23 N ? ? A GLN 22 A 4FW 23 1_555 ? ? ? ? ? ? ? 1.319 ? ? covale6 covale both ? A 4FW 23 C ? ? ? 1_555 A GLU 24 N ? ? A 4FW 23 A GLU 24 1_555 ? ? ? ? ? ? ? 1.320 ? ? covale7 covale both ? A GLN 76 C ? ? ? 1_555 A 4FW 77 N ? ? A GLN 76 A 4FW 77 1_555 ? ? ? ? ? ? ? 1.328 ? ? covale8 covale both ? A 4FW 77 C ? ? ? 1_555 A GLY 78 N ? ? A 4FW 77 A GLY 78 1_555 ? ? ? ? ? ? ? 1.327 ? ? covale9 covale both ? A PRO 83 C ? ? ? 1_555 A 4FW 84 N ? ? A PRO 83 A 4FW 84 1_555 ? ? ? ? ? ? ? 1.332 ? ? covale10 covale both ? A 4FW 84 C ? ? ? 1_555 A HIS 85 N ? ? A 4FW 84 A HIS 85 1_555 ? ? ? ? ? ? ? 1.330 ? ? covale11 covale both ? A ASN 89 C ? ? ? 1_555 A 4FW 90 N ? ? A ASN 89 A 4FW 90 1_555 ? ? ? ? ? ? ? 1.338 ? ? covale12 covale both ? A 4FW 90 C ? ? ? 1_555 A ILE 91 N ? ? A 4FW 90 A ILE 91 1_555 ? ? ? ? ? ? ? 1.323 ? ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 4FW A 10 ? . . . . 4FW A 10 ? 1_555 . . . . . . . TRP 1 4FW Fluorination 'Named protein modification' 2 4FW A 17 ? . . . . 4FW A 17 ? 1_555 . . . . . . . TRP 1 4FW Fluorination 'Named protein modification' 3 4FW A 23 ? . . . . 4FW A 23 ? 1_555 . . . . . . . TRP 1 4FW Fluorination 'Named protein modification' 4 4FW A 77 ? . . . . 4FW A 77 ? 1_555 . . . . . . . TRP 1 4FW Fluorination 'Named protein modification' 5 4FW A 84 ? . . . . 4FW A 84 ? 1_555 . . . . . . . TRP 1 4FW Fluorination 'Named protein modification' 6 4FW A 90 ? . . . . 4FW A 90 ? 1_555 . . . . . . . TRP 1 4FW Fluorination 'Named protein modification' # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 12 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA1 5 6 ? anti-parallel AA1 6 7 ? anti-parallel AA1 7 8 ? anti-parallel AA1 8 9 ? anti-parallel AA1 9 10 ? anti-parallel AA1 10 11 ? anti-parallel AA1 11 12 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 4FW A 84 ? HIS A 85 ? 4FW A 84 HIS A 85 AA1 2 SER A 70 ? GLN A 76 ? SER A 70 GLN A 76 AA1 3 4FW A 90 ? ILE A 91 ? 4FW A 90 ILE A 91 AA1 4 ASN A 18 ? GLU A 24 ? ASN A 18 GLU A 24 AA1 5 LEU A 3 ? GLN A 9 ? LEU A 3 GLN A 9 AA1 6 PRO A 125 ? LEU A 132 ? PRO A 125 LEU A 132 AA1 7 THR A 117 ? THR A 119 ? THR A 117 THR A 119 AA1 8 ALA A 102 ? GLU A 106 ? ALA A 102 GLU A 106 AA1 9 ALA A 35 ? VAL A 38 ? ALA A 35 VAL A 38 AA1 10 THR A 50 ? THR A 52 ? THR A 50 THR A 52 AA1 11 PRO A 58 ? LEU A 65 ? PRO A 58 LEU A 65 AA1 12 SER A 70 ? GLN A 76 ? SER A 70 GLN A 76 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O HIS A 85 ? O HIS A 85 N ASN A 75 ? N ASN A 75 AA1 2 3 N TYR A 71 ? N TYR A 71 O 4FW A 90 ? O 4FW A 90 AA1 3 4 O ILE A 91 ? O ILE A 91 N GLU A 24 ? N GLU A 24 AA1 4 5 O GLY A 21 ? O GLY A 21 N VAL A 6 ? N VAL A 6 AA1 5 6 N ASN A 5 ? N ASN A 5 O THR A 131 ? O THR A 131 AA1 6 7 O ILE A 126 ? O ILE A 126 N MET A 118 ? N MET A 118 AA1 7 8 O THR A 119 ? O THR A 119 N ALA A 102 ? N ALA A 102 AA1 8 9 O VAL A 105 ? O VAL A 105 N ILE A 36 ? N ILE A 36 AA1 9 10 N ASN A 37 ? N ASN A 37 O THR A 50 ? O THR A 50 AA1 10 11 N MET A 51 ? N MET A 51 O ILE A 59 ? O ILE A 59 AA1 11 12 N GLY A 60 ? N GLY A 60 O GLN A 76 ? O GLN A 76 # _pdbx_entry_details.entry_id 9B4W _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ARG A 28 ? ? -170.19 144.51 2 1 VAL A 34 ? ? 64.91 -70.26 3 1 THR A 46 ? ? 176.25 99.75 4 1 LEU A 92 ? ? -103.77 -162.15 5 1 ASN A 97 ? ? 59.17 18.58 6 1 VAL A 101 ? ? 72.15 -68.58 7 1 GLN A 112 ? ? -61.52 -168.35 8 2 VAL A 34 ? ? 69.70 -52.15 9 2 THR A 46 ? ? 175.94 98.27 10 2 LEU A 92 ? ? -102.89 -165.94 11 2 ASN A 97 ? ? 57.83 17.80 12 2 VAL A 101 ? ? 67.57 -64.32 13 2 GLN A 112 ? ? -62.53 -168.49 14 3 VAL A 34 ? ? 60.89 -75.59 15 3 GLN A 45 ? ? -101.84 67.38 16 3 THR A 46 ? ? 176.60 100.48 17 3 VAL A 101 ? ? 58.68 -86.16 18 3 GLN A 112 ? ? -61.72 -168.26 19 4 VAL A 34 ? ? 62.94 -73.30 20 4 THR A 46 ? ? 175.68 97.99 21 4 LEU A 92 ? ? -100.40 -165.39 22 4 VAL A 101 ? ? 78.50 -67.48 23 4 GLN A 112 ? ? -61.83 -167.85 24 5 VAL A 34 ? ? 65.39 -66.13 25 5 THR A 46 ? ? 175.45 97.77 26 5 LEU A 66 ? ? -95.12 -60.30 27 5 ASN A 68 ? ? -66.00 -172.64 28 5 LEU A 92 ? ? -101.14 -165.41 29 5 VAL A 101 ? ? 72.99 -73.27 30 5 GLN A 112 ? ? -61.61 -168.66 31 6 GLU A 19 ? ? -48.66 161.43 32 6 VAL A 34 ? ? 52.81 -84.43 33 6 THR A 46 ? ? 177.97 98.32 34 6 ASN A 48 ? ? -106.31 40.86 35 6 LEU A 92 ? ? -103.38 -167.43 36 6 ASN A 97 ? ? 57.67 17.44 37 6 VAL A 101 ? ? 65.14 -69.69 38 6 GLN A 112 ? ? -62.39 -169.42 39 7 VAL A 34 ? ? 69.79 -52.39 40 7 THR A 46 ? ? 175.17 97.97 41 7 LEU A 92 ? ? -107.27 -164.50 42 7 ASN A 97 ? ? 58.72 19.60 43 7 VAL A 101 ? ? 60.90 -83.73 44 7 GLN A 112 ? ? -62.76 -168.44 45 8 ARG A 28 ? ? -166.52 113.94 46 8 VAL A 34 ? ? 64.21 -69.96 47 8 THR A 46 ? ? 175.47 99.06 48 8 LEU A 92 ? ? -131.21 -158.03 49 8 VAL A 101 ? ? 60.28 -80.56 50 8 ASP A 110 ? ? 71.30 49.54 51 8 GLN A 112 ? ? -61.57 -165.89 52 9 VAL A 34 ? ? 61.76 -72.67 53 9 THR A 46 ? ? 173.54 98.98 54 9 LEU A 92 ? ? -109.10 -162.45 55 9 VAL A 101 ? ? 57.47 -85.63 56 9 GLN A 112 ? ? -61.93 -167.44 57 10 ARG A 28 ? ? -166.84 117.41 58 10 VAL A 34 ? ? 44.90 14.97 59 10 ALA A 35 ? ? 173.29 122.80 60 10 THR A 46 ? ? 176.53 99.75 61 10 ASN A 48 ? ? -105.05 40.15 62 10 LEU A 92 ? ? -109.27 -163.08 63 10 VAL A 101 ? ? 60.32 -82.28 64 10 GLN A 112 ? ? -61.50 -167.51 # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A 4FW 10 A 4FW 10 ? TRP 'modified residue' 2 A 4FW 17 A 4FW 17 ? TRP 'modified residue' 3 A 4FW 23 A 4FW 23 ? TRP 'modified residue' 4 A 4FW 77 A 4FW 77 ? TRP 'modified residue' 5 A 4FW 84 A 4FW 84 ? TRP 'modified residue' 6 A 4FW 90 A 4FW 90 ? TRP 'modified residue' # _pdbx_nmr_ensemble.entry_id 9B4W _pdbx_nmr_ensemble.conformers_calculated_total_number 1000 _pdbx_nmr_ensemble.conformers_submitted_total_number 10 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 9B4W _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '1.2 mM NaH2PO4, 0.8 mM K2HPO4, 0.2 mM Li2SO4, 0.1 mM CAPS, 30 mg/mL [U-100% 19F]-4F-Trp, U-100% 13C, U-100% 15N] OAA, H2O' _pdbx_nmr_sample_details.solvent_system H2O _pdbx_nmr_sample_details.label 4F-Trp,U-13C-15N-OAA _pdbx_nmr_sample_details.type 'single crystal' _pdbx_nmr_sample_details.details ;Protein was buffer exchanged into 20 mM Tris-HCl, 100 mM NaCl (pH 8.0) and concentrated to 30 mg/mL for crystallization.Sample prepared by sitting drop diffusion crystallization with a 1:1 ratio of protein buffer to crystallization buffer. ; # loop_ _pdbx_nmr_exptl_sample.solution_id _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling 1 NaH2PO4 1.2 ? mM 'natural abundance' 1 K2HPO4 0.8 ? mM 'natural abundance' 1 Li2SO4 0.2 ? mM 'natural abundance' 1 CAPS 0.1 ? mM 'natural abundance' 1 OAA 30 ? mg/mL '[U-100% 19F]-4F-Trp, U-100% 13C, U-100% 15N]' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 6.3 _pdbx_nmr_exptl_sample_conditions.ionic_strength 2.3 _pdbx_nmr_exptl_sample_conditions.details '4F-Trp,U-13C-15N-OAA crystals grown in 1.2 mM NaH2PO4/0.8 mM K2HPO4 (pH 5.5), 0.2 mM Li2SO4, and 0.1 mM CAPS (pH 10.5) at pH 6.3.' _pdbx_nmr_exptl_sample_conditions.ionic_strength_err ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units mM _pdbx_nmr_exptl_sample_conditions.label 'CAPS condition' _pdbx_nmr_exptl_sample_conditions.pH_err ? _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 '2D CORD 25 ms' 1 isotropic 2 1 1 '2D CORD 50 ms' 1 isotropic 3 1 1 '2D CORD 100 ms' 2 isotropic 4 1 1 '2D CORD 250 ms' 2 isotropic 5 1 1 '2D CORD 500 ms' 2 isotropic 6 1 1 '2D NCACX 50 ms' 1 isotropic 7 1 1 '2D NCOCX 25 ms' 1 isotropic 8 1 1 '3D NCACX 50 ms' 1 isotropic 9 1 1 '3D NCOCX 25 ms' 1 isotropic 10 1 1 '2D hCH HETCOR' 2 isotropic 11 1 1 '2D hNH HETCOR' 2 isotropic 12 1 1 '2D 19F-19F RFDR' 3 isotropic 13 1 1 '2D hCF HETCOR' 3 isotropic 14 1 1 '3D hCHF HETCOR' 3 isotropic # _pdbx_nmr_refine.entry_id 9B4W _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 7 # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 collection TopSpin ? 'Bruker Biospin' 2 processing NMRPipe ? 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' 3 'data analysis' 'CcpNmr Analysis' ? CCPN 4 'peak picking' 'CcpNmr Analysis' ? CCPN 5 'chemical shift assignment' NMRFAM-SPARKY ? 'Lee W, Tonelli M, Markley JL.' 6 'structure calculation' 'X-PLOR NIH' ? 'Schwieters, Kuszewski, Tjandra and Clore' 7 refinement 'X-PLOR NIH' ? 'Schwieters, Kuszewski, Tjandra and Clore' # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 2 Y 1 A MET 1 ? A MET 1 3 3 Y 1 A MET 1 ? A MET 1 4 4 Y 1 A MET 1 ? A MET 1 5 5 Y 1 A MET 1 ? A MET 1 6 6 Y 1 A MET 1 ? A MET 1 7 7 Y 1 A MET 1 ? A MET 1 8 8 Y 1 A MET 1 ? A MET 1 9 9 Y 1 A MET 1 ? A MET 1 10 10 Y 1 A MET 1 ? A MET 1 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal 4FW N N N N 1 4FW CA C N S 2 4FW CB C N N 3 4FW CG C Y N 4 4FW CD2 C Y N 5 4FW CE2 C Y N 6 4FW CE3 C Y N 7 4FW CD1 C Y N 8 4FW NE1 N Y N 9 4FW CZ2 C Y N 10 4FW CZ3 C Y N 11 4FW F F N N 12 4FW CH2 C Y N 13 4FW C C N N 14 4FW O O N N 15 4FW OXT O N N 16 4FW H H N N 17 4FW H2 H N N 18 4FW HA H N N 19 4FW HB2 H N N 20 4FW HB3 H N N 21 4FW HD1 H N N 22 4FW HE1 H N N 23 4FW HZ2 H N N 24 4FW HZ3 H N N 25 4FW HH2 H N N 26 4FW HXT H N N 27 ALA N N N N 28 ALA CA C N S 29 ALA C C N N 30 ALA O O N N 31 ALA CB C N N 32 ALA OXT O N N 33 ALA H H N N 34 ALA H2 H N N 35 ALA HA H N N 36 ALA HB1 H N N 37 ALA HB2 H N N 38 ALA HB3 H N N 39 ALA HXT H N N 40 ARG N N N N 41 ARG CA C N S 42 ARG C C N N 43 ARG O O N N 44 ARG CB C N N 45 ARG CG C N N 46 ARG CD C N N 47 ARG NE N N N 48 ARG CZ C N N 49 ARG NH1 N N N 50 ARG NH2 N N N 51 ARG OXT O N N 52 ARG H H N N 53 ARG H2 H N N 54 ARG HA H N N 55 ARG HB2 H N N 56 ARG HB3 H N N 57 ARG HG2 H N N 58 ARG HG3 H N N 59 ARG HD2 H N N 60 ARG HD3 H N N 61 ARG HE H N N 62 ARG HH11 H N N 63 ARG HH12 H N N 64 ARG HH21 H N N 65 ARG HH22 H N N 66 ARG HXT H N N 67 ASN N N N N 68 ASN CA C N S 69 ASN C C N N 70 ASN O O N N 71 ASN CB C N N 72 ASN CG C N N 73 ASN OD1 O N N 74 ASN ND2 N N N 75 ASN OXT O N N 76 ASN H H N N 77 ASN H2 H N N 78 ASN HA H N N 79 ASN HB2 H N N 80 ASN HB3 H N N 81 ASN HD21 H N N 82 ASN HD22 H N N 83 ASN HXT H N N 84 ASP N N N N 85 ASP CA C N S 86 ASP C C N N 87 ASP O O N N 88 ASP CB C N N 89 ASP CG C N N 90 ASP OD1 O N N 91 ASP OD2 O N N 92 ASP OXT O N N 93 ASP H H N N 94 ASP H2 H N N 95 ASP HA H N N 96 ASP HB2 H N N 97 ASP HB3 H N N 98 ASP HD2 H N N 99 ASP HXT H N N 100 GLN N N N N 101 GLN CA C N S 102 GLN C C N N 103 GLN O O N N 104 GLN CB C N N 105 GLN CG C N N 106 GLN CD C N N 107 GLN OE1 O N N 108 GLN NE2 N N N 109 GLN OXT O N N 110 GLN H H N N 111 GLN H2 H N N 112 GLN HA H N N 113 GLN HB2 H N N 114 GLN HB3 H N N 115 GLN HG2 H N N 116 GLN HG3 H N N 117 GLN HE21 H N N 118 GLN HE22 H N N 119 GLN HXT H N N 120 GLU N N N N 121 GLU CA C N S 122 GLU C C N N 123 GLU O O N N 124 GLU CB C N N 125 GLU CG C N N 126 GLU CD C N N 127 GLU OE1 O N N 128 GLU OE2 O N N 129 GLU OXT O N N 130 GLU H H N N 131 GLU H2 H N N 132 GLU HA H N N 133 GLU HB2 H N N 134 GLU HB3 H N N 135 GLU HG2 H N N 136 GLU HG3 H N N 137 GLU HE2 H N N 138 GLU HXT H N N 139 GLY N N N N 140 GLY CA C N N 141 GLY C C N N 142 GLY O O N N 143 GLY OXT O N N 144 GLY H H N N 145 GLY H2 H N N 146 GLY HA2 H N N 147 GLY HA3 H N N 148 GLY HXT H N N 149 HIS N N N N 150 HIS CA C N S 151 HIS C C N N 152 HIS O O N N 153 HIS CB C N N 154 HIS CG C Y N 155 HIS ND1 N Y N 156 HIS CD2 C Y N 157 HIS CE1 C Y N 158 HIS NE2 N Y N 159 HIS OXT O N N 160 HIS H H N N 161 HIS H2 H N N 162 HIS HA H N N 163 HIS HB2 H N N 164 HIS HB3 H N N 165 HIS HD1 H N N 166 HIS HD2 H N N 167 HIS HE1 H N N 168 HIS HE2 H N N 169 HIS HXT H N N 170 ILE N N N N 171 ILE CA C N S 172 ILE C C N N 173 ILE O O N N 174 ILE CB C N S 175 ILE CG1 C N N 176 ILE CG2 C N N 177 ILE CD1 C N N 178 ILE OXT O N N 179 ILE H H N N 180 ILE H2 H N N 181 ILE HA H N N 182 ILE HB H N N 183 ILE HG12 H N N 184 ILE HG13 H N N 185 ILE HG21 H N N 186 ILE HG22 H N N 187 ILE HG23 H N N 188 ILE HD11 H N N 189 ILE HD12 H N N 190 ILE HD13 H N N 191 ILE HXT H N N 192 LEU N N N N 193 LEU CA C N S 194 LEU C C N N 195 LEU O O N N 196 LEU CB C N N 197 LEU CG C N N 198 LEU CD1 C N N 199 LEU CD2 C N N 200 LEU OXT O N N 201 LEU H H N N 202 LEU H2 H N N 203 LEU HA H N N 204 LEU HB2 H N N 205 LEU HB3 H N N 206 LEU HG H N N 207 LEU HD11 H N N 208 LEU HD12 H N N 209 LEU HD13 H N N 210 LEU HD21 H N N 211 LEU HD22 H N N 212 LEU HD23 H N N 213 LEU HXT H N N 214 LYS N N N N 215 LYS CA C N S 216 LYS C C N N 217 LYS O O N N 218 LYS CB C N N 219 LYS CG C N N 220 LYS CD C N N 221 LYS CE C N N 222 LYS NZ N N N 223 LYS OXT O N N 224 LYS H H N N 225 LYS H2 H N N 226 LYS HA H N N 227 LYS HB2 H N N 228 LYS HB3 H N N 229 LYS HG2 H N N 230 LYS HG3 H N N 231 LYS HD2 H N N 232 LYS HD3 H N N 233 LYS HE2 H N N 234 LYS HE3 H N N 235 LYS HZ1 H N N 236 LYS HZ2 H N N 237 LYS HZ3 H N N 238 LYS HXT H N N 239 MET N N N N 240 MET CA C N S 241 MET C C N N 242 MET O O N N 243 MET CB C N N 244 MET CG C N N 245 MET SD S N N 246 MET CE C N N 247 MET OXT O N N 248 MET H H N N 249 MET H2 H N N 250 MET HA H N N 251 MET HB2 H N N 252 MET HB3 H N N 253 MET HG2 H N N 254 MET HG3 H N N 255 MET HE1 H N N 256 MET HE2 H N N 257 MET HE3 H N N 258 MET HXT H N N 259 PHE N N N N 260 PHE CA C N S 261 PHE C C N N 262 PHE O O N N 263 PHE CB C N N 264 PHE CG C Y N 265 PHE CD1 C Y N 266 PHE CD2 C Y N 267 PHE CE1 C Y N 268 PHE CE2 C Y N 269 PHE CZ C Y N 270 PHE OXT O N N 271 PHE H H N N 272 PHE H2 H N N 273 PHE HA H N N 274 PHE HB2 H N N 275 PHE HB3 H N N 276 PHE HD1 H N N 277 PHE HD2 H N N 278 PHE HE1 H N N 279 PHE HE2 H N N 280 PHE HZ H N N 281 PHE HXT H N N 282 PRO N N N N 283 PRO CA C N S 284 PRO C C N N 285 PRO O O N N 286 PRO CB C N N 287 PRO CG C N N 288 PRO CD C N N 289 PRO OXT O N N 290 PRO H H N N 291 PRO HA H N N 292 PRO HB2 H N N 293 PRO HB3 H N N 294 PRO HG2 H N N 295 PRO HG3 H N N 296 PRO HD2 H N N 297 PRO HD3 H N N 298 PRO HXT H N N 299 SER N N N N 300 SER CA C N S 301 SER C C N N 302 SER O O N N 303 SER CB C N N 304 SER OG O N N 305 SER OXT O N N 306 SER H H N N 307 SER H2 H N N 308 SER HA H N N 309 SER HB2 H N N 310 SER HB3 H N N 311 SER HG H N N 312 SER HXT H N N 313 THR N N N N 314 THR CA C N S 315 THR C C N N 316 THR O O N N 317 THR CB C N R 318 THR OG1 O N N 319 THR CG2 C N N 320 THR OXT O N N 321 THR H H N N 322 THR H2 H N N 323 THR HA H N N 324 THR HB H N N 325 THR HG1 H N N 326 THR HG21 H N N 327 THR HG22 H N N 328 THR HG23 H N N 329 THR HXT H N N 330 TYR N N N N 331 TYR CA C N S 332 TYR C C N N 333 TYR O O N N 334 TYR CB C N N 335 TYR CG C Y N 336 TYR CD1 C Y N 337 TYR CD2 C Y N 338 TYR CE1 C Y N 339 TYR CE2 C Y N 340 TYR CZ C Y N 341 TYR OH O N N 342 TYR OXT O N N 343 TYR H H N N 344 TYR H2 H N N 345 TYR HA H N N 346 TYR HB2 H N N 347 TYR HB3 H N N 348 TYR HD1 H N N 349 TYR HD2 H N N 350 TYR HE1 H N N 351 TYR HE2 H N N 352 TYR HH H N N 353 TYR HXT H N N 354 VAL N N N N 355 VAL CA C N S 356 VAL C C N N 357 VAL O O N N 358 VAL CB C N N 359 VAL CG1 C N N 360 VAL CG2 C N N 361 VAL OXT O N N 362 VAL H H N N 363 VAL H2 H N N 364 VAL HA H N N 365 VAL HB H N N 366 VAL HG11 H N N 367 VAL HG12 H N N 368 VAL HG13 H N N 369 VAL HG21 H N N 370 VAL HG22 H N N 371 VAL HG23 H N N 372 VAL HXT H N N 373 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal 4FW N CA sing N N 1 4FW N H sing N N 2 4FW N H2 sing N N 3 4FW CA CB sing N N 4 4FW CA C sing N N 5 4FW CA HA sing N N 6 4FW CB CG sing N N 7 4FW CB HB2 sing N N 8 4FW CB HB3 sing N N 9 4FW CG CD2 sing Y N 10 4FW CG CD1 doub Y N 11 4FW CD2 CE2 doub Y N 12 4FW CD2 CE3 sing Y N 13 4FW CE2 NE1 sing Y N 14 4FW CE2 CZ2 sing Y N 15 4FW CE3 CZ3 doub Y N 16 4FW CE3 F sing N N 17 4FW CD1 NE1 sing Y N 18 4FW CD1 HD1 sing N N 19 4FW NE1 HE1 sing N N 20 4FW CZ2 CH2 doub Y N 21 4FW CZ2 HZ2 sing N N 22 4FW CZ3 CH2 sing Y N 23 4FW CZ3 HZ3 sing N N 24 4FW CH2 HH2 sing N N 25 4FW C O doub N N 26 4FW C OXT sing N N 27 4FW OXT HXT sing N N 28 ALA N CA sing N N 29 ALA N H sing N N 30 ALA N H2 sing N N 31 ALA CA C sing N N 32 ALA CA CB sing N N 33 ALA CA HA sing N N 34 ALA C O doub N N 35 ALA C OXT sing N N 36 ALA CB HB1 sing N N 37 ALA CB HB2 sing N N 38 ALA CB HB3 sing N N 39 ALA OXT HXT sing N N 40 ARG N CA sing N N 41 ARG N H sing N N 42 ARG N H2 sing N N 43 ARG CA C sing N N 44 ARG CA CB sing N N 45 ARG CA HA sing N N 46 ARG C O doub N N 47 ARG C OXT sing N N 48 ARG CB CG sing N N 49 ARG CB HB2 sing N N 50 ARG CB HB3 sing N N 51 ARG CG CD sing N N 52 ARG CG HG2 sing N N 53 ARG CG HG3 sing N N 54 ARG CD NE sing N N 55 ARG CD HD2 sing N N 56 ARG CD HD3 sing N N 57 ARG NE CZ sing N N 58 ARG NE HE sing N N 59 ARG CZ NH1 sing N N 60 ARG CZ NH2 doub N N 61 ARG NH1 HH11 sing N N 62 ARG NH1 HH12 sing N N 63 ARG NH2 HH21 sing N N 64 ARG NH2 HH22 sing N N 65 ARG OXT HXT sing N N 66 ASN N CA sing N N 67 ASN N H sing N N 68 ASN N H2 sing N N 69 ASN CA C sing N N 70 ASN CA CB sing N N 71 ASN CA HA sing N N 72 ASN C O doub N N 73 ASN C OXT sing N N 74 ASN CB CG sing N N 75 ASN CB HB2 sing N N 76 ASN CB HB3 sing N N 77 ASN CG OD1 doub N N 78 ASN CG ND2 sing N N 79 ASN ND2 HD21 sing N N 80 ASN ND2 HD22 sing N N 81 ASN OXT HXT sing N N 82 ASP N CA sing N N 83 ASP N H sing N N 84 ASP N H2 sing N N 85 ASP CA C sing N N 86 ASP CA CB sing N N 87 ASP CA HA sing N N 88 ASP C O doub N N 89 ASP C OXT sing N N 90 ASP CB CG sing N N 91 ASP CB HB2 sing N N 92 ASP CB HB3 sing N N 93 ASP CG OD1 doub N N 94 ASP CG OD2 sing N N 95 ASP OD2 HD2 sing N N 96 ASP OXT HXT sing N N 97 GLN N CA sing N N 98 GLN N H sing N N 99 GLN N H2 sing N N 100 GLN CA C sing N N 101 GLN CA CB sing N N 102 GLN CA HA sing N N 103 GLN C O doub N N 104 GLN C OXT sing N N 105 GLN CB CG sing N N 106 GLN CB HB2 sing N N 107 GLN CB HB3 sing N N 108 GLN CG CD sing N N 109 GLN CG HG2 sing N N 110 GLN CG HG3 sing N N 111 GLN CD OE1 doub N N 112 GLN CD NE2 sing N N 113 GLN NE2 HE21 sing N N 114 GLN NE2 HE22 sing N N 115 GLN OXT HXT sing N N 116 GLU N CA sing N N 117 GLU N H sing N N 118 GLU N H2 sing N N 119 GLU CA C sing N N 120 GLU CA CB sing N N 121 GLU CA HA sing N N 122 GLU C O doub N N 123 GLU C OXT sing N N 124 GLU CB CG sing N N 125 GLU CB HB2 sing N N 126 GLU CB HB3 sing N N 127 GLU CG CD sing N N 128 GLU CG HG2 sing N N 129 GLU CG HG3 sing N N 130 GLU CD OE1 doub N N 131 GLU CD OE2 sing N N 132 GLU OE2 HE2 sing N N 133 GLU OXT HXT sing N N 134 GLY N CA sing N N 135 GLY N H sing N N 136 GLY N H2 sing N N 137 GLY CA C sing N N 138 GLY CA HA2 sing N N 139 GLY CA HA3 sing N N 140 GLY C O doub N N 141 GLY C OXT sing N N 142 GLY OXT HXT sing N N 143 HIS N CA sing N N 144 HIS N H sing N N 145 HIS N H2 sing N N 146 HIS CA C sing N N 147 HIS CA CB sing N N 148 HIS CA HA sing N N 149 HIS C O doub N N 150 HIS C OXT sing N N 151 HIS CB CG sing N N 152 HIS CB HB2 sing N N 153 HIS CB HB3 sing N N 154 HIS CG ND1 sing Y N 155 HIS CG CD2 doub Y N 156 HIS ND1 CE1 doub Y N 157 HIS ND1 HD1 sing N N 158 HIS CD2 NE2 sing Y N 159 HIS CD2 HD2 sing N N 160 HIS CE1 NE2 sing Y N 161 HIS CE1 HE1 sing N N 162 HIS NE2 HE2 sing N N 163 HIS OXT HXT sing N N 164 ILE N CA sing N N 165 ILE N H sing N N 166 ILE N H2 sing N N 167 ILE CA C sing N N 168 ILE CA CB sing N N 169 ILE CA HA sing N N 170 ILE C O doub N N 171 ILE C OXT sing N N 172 ILE CB CG1 sing N N 173 ILE CB CG2 sing N N 174 ILE CB HB sing N N 175 ILE CG1 CD1 sing N N 176 ILE CG1 HG12 sing N N 177 ILE CG1 HG13 sing N N 178 ILE CG2 HG21 sing N N 179 ILE CG2 HG22 sing N N 180 ILE CG2 HG23 sing N N 181 ILE CD1 HD11 sing N N 182 ILE CD1 HD12 sing N N 183 ILE CD1 HD13 sing N N 184 ILE OXT HXT sing N N 185 LEU N CA sing N N 186 LEU N H sing N N 187 LEU N H2 sing N N 188 LEU CA C sing N N 189 LEU CA CB sing N N 190 LEU CA HA sing N N 191 LEU C O doub N N 192 LEU C OXT sing N N 193 LEU CB CG sing N N 194 LEU CB HB2 sing N N 195 LEU CB HB3 sing N N 196 LEU CG CD1 sing N N 197 LEU CG CD2 sing N N 198 LEU CG HG sing N N 199 LEU CD1 HD11 sing N N 200 LEU CD1 HD12 sing N N 201 LEU CD1 HD13 sing N N 202 LEU CD2 HD21 sing N N 203 LEU CD2 HD22 sing N N 204 LEU CD2 HD23 sing N N 205 LEU OXT HXT sing N N 206 LYS N CA sing N N 207 LYS N H sing N N 208 LYS N H2 sing N N 209 LYS CA C sing N N 210 LYS CA CB sing N N 211 LYS CA HA sing N N 212 LYS C O doub N N 213 LYS C OXT sing N N 214 LYS CB CG sing N N 215 LYS CB HB2 sing N N 216 LYS CB HB3 sing N N 217 LYS CG CD sing N N 218 LYS CG HG2 sing N N 219 LYS CG HG3 sing N N 220 LYS CD CE sing N N 221 LYS CD HD2 sing N N 222 LYS CD HD3 sing N N 223 LYS CE NZ sing N N 224 LYS CE HE2 sing N N 225 LYS CE HE3 sing N N 226 LYS NZ HZ1 sing N N 227 LYS NZ HZ2 sing N N 228 LYS NZ HZ3 sing N N 229 LYS OXT HXT sing N N 230 MET N CA sing N N 231 MET N H sing N N 232 MET N H2 sing N N 233 MET CA C sing N N 234 MET CA CB sing N N 235 MET CA HA sing N N 236 MET C O doub N N 237 MET C OXT sing N N 238 MET CB CG sing N N 239 MET CB HB2 sing N N 240 MET CB HB3 sing N N 241 MET CG SD sing N N 242 MET CG HG2 sing N N 243 MET CG HG3 sing N N 244 MET SD CE sing N N 245 MET CE HE1 sing N N 246 MET CE HE2 sing N N 247 MET CE HE3 sing N N 248 MET OXT HXT sing N N 249 PHE N CA sing N N 250 PHE N H sing N N 251 PHE N H2 sing N N 252 PHE CA C sing N N 253 PHE CA CB sing N N 254 PHE CA HA sing N N 255 PHE C O doub N N 256 PHE C OXT sing N N 257 PHE CB CG sing N N 258 PHE CB HB2 sing N N 259 PHE CB HB3 sing N N 260 PHE CG CD1 doub Y N 261 PHE CG CD2 sing Y N 262 PHE CD1 CE1 sing Y N 263 PHE CD1 HD1 sing N N 264 PHE CD2 CE2 doub Y N 265 PHE CD2 HD2 sing N N 266 PHE CE1 CZ doub Y N 267 PHE CE1 HE1 sing N N 268 PHE CE2 CZ sing Y N 269 PHE CE2 HE2 sing N N 270 PHE CZ HZ sing N N 271 PHE OXT HXT sing N N 272 PRO N CA sing N N 273 PRO N CD sing N N 274 PRO N H sing N N 275 PRO CA C sing N N 276 PRO CA CB sing N N 277 PRO CA HA sing N N 278 PRO C O doub N N 279 PRO C OXT sing N N 280 PRO CB CG sing N N 281 PRO CB HB2 sing N N 282 PRO CB HB3 sing N N 283 PRO CG CD sing N N 284 PRO CG HG2 sing N N 285 PRO CG HG3 sing N N 286 PRO CD HD2 sing N N 287 PRO CD HD3 sing N N 288 PRO OXT HXT sing N N 289 SER N CA sing N N 290 SER N H sing N N 291 SER N H2 sing N N 292 SER CA C sing N N 293 SER CA CB sing N N 294 SER CA HA sing N N 295 SER C O doub N N 296 SER C OXT sing N N 297 SER CB OG sing N N 298 SER CB HB2 sing N N 299 SER CB HB3 sing N N 300 SER OG HG sing N N 301 SER OXT HXT sing N N 302 THR N CA sing N N 303 THR N H sing N N 304 THR N H2 sing N N 305 THR CA C sing N N 306 THR CA CB sing N N 307 THR CA HA sing N N 308 THR C O doub N N 309 THR C OXT sing N N 310 THR CB OG1 sing N N 311 THR CB CG2 sing N N 312 THR CB HB sing N N 313 THR OG1 HG1 sing N N 314 THR CG2 HG21 sing N N 315 THR CG2 HG22 sing N N 316 THR CG2 HG23 sing N N 317 THR OXT HXT sing N N 318 TYR N CA sing N N 319 TYR N H sing N N 320 TYR N H2 sing N N 321 TYR CA C sing N N 322 TYR CA CB sing N N 323 TYR CA HA sing N N 324 TYR C O doub N N 325 TYR C OXT sing N N 326 TYR CB CG sing N N 327 TYR CB HB2 sing N N 328 TYR CB HB3 sing N N 329 TYR CG CD1 doub Y N 330 TYR CG CD2 sing Y N 331 TYR CD1 CE1 sing Y N 332 TYR CD1 HD1 sing N N 333 TYR CD2 CE2 doub Y N 334 TYR CD2 HD2 sing N N 335 TYR CE1 CZ doub Y N 336 TYR CE1 HE1 sing N N 337 TYR CE2 CZ sing Y N 338 TYR CE2 HE2 sing N N 339 TYR CZ OH sing N N 340 TYR OH HH sing N N 341 TYR OXT HXT sing N N 342 VAL N CA sing N N 343 VAL N H sing N N 344 VAL N H2 sing N N 345 VAL CA C sing N N 346 VAL CA CB sing N N 347 VAL CA HA sing N N 348 VAL C O doub N N 349 VAL C OXT sing N N 350 VAL CB CG1 sing N N 351 VAL CB CG2 sing N N 352 VAL CB HB sing N N 353 VAL CG1 HG11 sing N N 354 VAL CG1 HG12 sing N N 355 VAL CG1 HG13 sing N N 356 VAL CG2 HG21 sing N N 357 VAL CG2 HG22 sing N N 358 VAL CG2 HG23 sing N N 359 VAL OXT HXT sing N N 360 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'National Science Foundation (NSF, United States)' 'United States' 'CHE 1708773' 1 'National Science Foundation (NSF, United States)' 'United States' 'CHE 0959496' 2 'National Institutes of Health/National Institute Of Allergy and Infectious Diseases (NIH/NIAID)' 'United States' U54AI170791 3 # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.type _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.details 1 'AVANCE III' ? Bruker 850 ? 2 'AVANCE III HD' ? Bruker 600 ? 3 'AVANCE III' ? Bruker 500 ? # _atom_sites.entry_id 9B4W _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C F H N O S # loop_