data_9B9S # _entry.id 9B9S # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.402 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 9B9S pdb_00009b9s 10.2210/pdb9b9s/pdb WWPDB D_1000282917 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date _pdbx_audit_revision_history.part_number 1 'Structure model' 1 0 2024-11-20 ? 2 'Structure model' 1 1 2024-11-27 ? 3 'Structure model' 1 2 2025-03-19 ? # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 3 'Structure model' citation # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.pdbx_database_id_PubMed' 2 2 'Structure model' '_citation.title' 3 3 'Structure model' '_citation.journal_volume' 4 3 'Structure model' '_citation.page_first' 5 3 'Structure model' '_citation.page_last' 6 3 'Structure model' '_citation.year' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 9B9S _pdbx_database_status.recvd_initial_deposition_date 2024-04-03 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_contact_author.id 2 _pdbx_contact_author.email claudia.studdert@santafe-conicet.gov.ar _pdbx_contact_author.name_first Claudia _pdbx_contact_author.name_last Studdert _pdbx_contact_author.name_mi A. _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-3884-6306 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Ramos Ricciuti, F.E.' 1 ? 'Herrera Seitz, M.K.' 2 ? 'Gasperotti, A.F.' 3 ? 'Boyko, A.' 4 ? 'Jung, K.' 5 ? 'Bellinzoni, M.' 6 ? 'Lisa, M.N.' 7 0000-0001-9630-8090 'Studdert, C.A.' 8 0000-0002-3884-6306 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Febs J.' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 1742-464X _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 292 _citation.language ? _citation.page_first 1034 _citation.page_last 1051 _citation.title ;The chemoreceptor controlling the Wsp-like transduction pathway in Halomonas titanicae KHS3 binds and responds to purine derivatives. ; _citation.year 2025 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1111/febs.17320 _citation.pdbx_database_id_PubMed 39529381 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Ramos Ricciuti, F.E.' 1 ? primary 'Soldano, A.' 2 ? primary 'Herrera Seitz, M.K.' 3 ? primary 'Gasperotti, A.F.' 4 ? primary 'Boyko, A.' 5 ? primary 'Jung, K.' 6 ? primary 'Bellinzoni, M.' 7 ? primary 'Lisa, M.N.' 8 ? primary 'Studdert, C.A.' 9 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Chemotaxis protein' 32618.377 1 ? ? 'ligand binding domain' ? 2 non-polymer syn GUANINE 151.126 1 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name Htc10 # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;(MSE)GLQARSHSQARLDNLLNQELPAQVKGLAAHINLSLSQDLAISESLANSYFIEQWVREGLPEERQNDIAAYLARL (MSE)EQLDTELLFIAAQHQGRGYYFQLRNGEFLQRIIQPPGSEDDWYYHFTDSDNAYELNLDSDTFSPDDAFVYVNYRS TVNAANGRPLVVAGAGLDLSQ(MSE)ASLIDDFRLGGSGHASLLSAEGELLVRSGEAKRSDESAPTVATATEALPEQASQ RLLQNEQLQVHEATRDGQEVLVSTIWLPELQRYL(MSE)VEVDKKAYLASTHERFLELEHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MGLQARSHSQARLDNLLNQELPAQVKGLAAHINLSLSQDLAISESLANSYFIEQWVREGLPEERQNDIAAYLARLMEQLD TELLFIAAQHQGRGYYFQLRNGEFLQRIIQPPGSEDDWYYHFTDSDNAYELNLDSDTFSPDDAFVYVNYRSTVNAANGRP LVVAGAGLDLSQMASLIDDFRLGGSGHASLLSAEGELLVRSGEAKRSDESAPTVATATEALPEQASQRLLQNEQLQVHEA TRDGQEVLVSTIWLPELQRYLMVEVDKKAYLASTHERFLELEHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name GUANINE _pdbx_entity_nonpoly.comp_id GUN # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MSE n 1 2 GLY n 1 3 LEU n 1 4 GLN n 1 5 ALA n 1 6 ARG n 1 7 SER n 1 8 HIS n 1 9 SER n 1 10 GLN n 1 11 ALA n 1 12 ARG n 1 13 LEU n 1 14 ASP n 1 15 ASN n 1 16 LEU n 1 17 LEU n 1 18 ASN n 1 19 GLN n 1 20 GLU n 1 21 LEU n 1 22 PRO n 1 23 ALA n 1 24 GLN n 1 25 VAL n 1 26 LYS n 1 27 GLY n 1 28 LEU n 1 29 ALA n 1 30 ALA n 1 31 HIS n 1 32 ILE n 1 33 ASN n 1 34 LEU n 1 35 SER n 1 36 LEU n 1 37 SER n 1 38 GLN n 1 39 ASP n 1 40 LEU n 1 41 ALA n 1 42 ILE n 1 43 SER n 1 44 GLU n 1 45 SER n 1 46 LEU n 1 47 ALA n 1 48 ASN n 1 49 SER n 1 50 TYR n 1 51 PHE n 1 52 ILE n 1 53 GLU n 1 54 GLN n 1 55 TRP n 1 56 VAL n 1 57 ARG n 1 58 GLU n 1 59 GLY n 1 60 LEU n 1 61 PRO n 1 62 GLU n 1 63 GLU n 1 64 ARG n 1 65 GLN n 1 66 ASN n 1 67 ASP n 1 68 ILE n 1 69 ALA n 1 70 ALA n 1 71 TYR n 1 72 LEU n 1 73 ALA n 1 74 ARG n 1 75 LEU n 1 76 MSE n 1 77 GLU n 1 78 GLN n 1 79 LEU n 1 80 ASP n 1 81 THR n 1 82 GLU n 1 83 LEU n 1 84 LEU n 1 85 PHE n 1 86 ILE n 1 87 ALA n 1 88 ALA n 1 89 GLN n 1 90 HIS n 1 91 GLN n 1 92 GLY n 1 93 ARG n 1 94 GLY n 1 95 TYR n 1 96 TYR n 1 97 PHE n 1 98 GLN n 1 99 LEU n 1 100 ARG n 1 101 ASN n 1 102 GLY n 1 103 GLU n 1 104 PHE n 1 105 LEU n 1 106 GLN n 1 107 ARG n 1 108 ILE n 1 109 ILE n 1 110 GLN n 1 111 PRO n 1 112 PRO n 1 113 GLY n 1 114 SER n 1 115 GLU n 1 116 ASP n 1 117 ASP n 1 118 TRP n 1 119 TYR n 1 120 TYR n 1 121 HIS n 1 122 PHE n 1 123 THR n 1 124 ASP n 1 125 SER n 1 126 ASP n 1 127 ASN n 1 128 ALA n 1 129 TYR n 1 130 GLU n 1 131 LEU n 1 132 ASN n 1 133 LEU n 1 134 ASP n 1 135 SER n 1 136 ASP n 1 137 THR n 1 138 PHE n 1 139 SER n 1 140 PRO n 1 141 ASP n 1 142 ASP n 1 143 ALA n 1 144 PHE n 1 145 VAL n 1 146 TYR n 1 147 VAL n 1 148 ASN n 1 149 TYR n 1 150 ARG n 1 151 SER n 1 152 THR n 1 153 VAL n 1 154 ASN n 1 155 ALA n 1 156 ALA n 1 157 ASN n 1 158 GLY n 1 159 ARG n 1 160 PRO n 1 161 LEU n 1 162 VAL n 1 163 VAL n 1 164 ALA n 1 165 GLY n 1 166 ALA n 1 167 GLY n 1 168 LEU n 1 169 ASP n 1 170 LEU n 1 171 SER n 1 172 GLN n 1 173 MSE n 1 174 ALA n 1 175 SER n 1 176 LEU n 1 177 ILE n 1 178 ASP n 1 179 ASP n 1 180 PHE n 1 181 ARG n 1 182 LEU n 1 183 GLY n 1 184 GLY n 1 185 SER n 1 186 GLY n 1 187 HIS n 1 188 ALA n 1 189 SER n 1 190 LEU n 1 191 LEU n 1 192 SER n 1 193 ALA n 1 194 GLU n 1 195 GLY n 1 196 GLU n 1 197 LEU n 1 198 LEU n 1 199 VAL n 1 200 ARG n 1 201 SER n 1 202 GLY n 1 203 GLU n 1 204 ALA n 1 205 LYS n 1 206 ARG n 1 207 SER n 1 208 ASP n 1 209 GLU n 1 210 SER n 1 211 ALA n 1 212 PRO n 1 213 THR n 1 214 VAL n 1 215 ALA n 1 216 THR n 1 217 ALA n 1 218 THR n 1 219 GLU n 1 220 ALA n 1 221 LEU n 1 222 PRO n 1 223 GLU n 1 224 GLN n 1 225 ALA n 1 226 SER n 1 227 GLN n 1 228 ARG n 1 229 LEU n 1 230 LEU n 1 231 GLN n 1 232 ASN n 1 233 GLU n 1 234 GLN n 1 235 LEU n 1 236 GLN n 1 237 VAL n 1 238 HIS n 1 239 GLU n 1 240 ALA n 1 241 THR n 1 242 ARG n 1 243 ASP n 1 244 GLY n 1 245 GLN n 1 246 GLU n 1 247 VAL n 1 248 LEU n 1 249 VAL n 1 250 SER n 1 251 THR n 1 252 ILE n 1 253 TRP n 1 254 LEU n 1 255 PRO n 1 256 GLU n 1 257 LEU n 1 258 GLN n 1 259 ARG n 1 260 TYR n 1 261 LEU n 1 262 MSE n 1 263 VAL n 1 264 GLU n 1 265 VAL n 1 266 ASP n 1 267 LYS n 1 268 LYS n 1 269 ALA n 1 270 TYR n 1 271 LEU n 1 272 ALA n 1 273 SER n 1 274 THR n 1 275 HIS n 1 276 GLU n 1 277 ARG n 1 278 PHE n 1 279 LEU n 1 280 GLU n 1 281 LEU n 1 282 GLU n 1 283 HIS n 1 284 HIS n 1 285 HIS n 1 286 HIS n 1 287 HIS n 1 288 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 288 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene RO22_21155 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Halomonas titanicae' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 664683 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 GUN non-polymer . GUANINE ? 'C5 H5 N5 O' 151.126 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MSE 'L-peptide linking' n SELENOMETHIONINE ? 'C5 H11 N O2 Se' 196.106 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MSE 1 30 ? ? ? A . n A 1 2 GLY 2 31 ? ? ? A . n A 1 3 LEU 3 32 ? ? ? A . n A 1 4 GLN 4 33 ? ? ? A . n A 1 5 ALA 5 34 ? ? ? A . n A 1 6 ARG 6 35 ? ? ? A . n A 1 7 SER 7 36 ? ? ? A . n A 1 8 HIS 8 37 ? ? ? A . n A 1 9 SER 9 38 ? ? ? A . n A 1 10 GLN 10 39 ? ? ? A . n A 1 11 ALA 11 40 ? ? ? A . n A 1 12 ARG 12 41 ? ? ? A . n A 1 13 LEU 13 42 ? ? ? A . n A 1 14 ASP 14 43 ? ? ? A . n A 1 15 ASN 15 44 ? ? ? A . n A 1 16 LEU 16 45 ? ? ? A . n A 1 17 LEU 17 46 ? ? ? A . n A 1 18 ASN 18 47 ? ? ? A . n A 1 19 GLN 19 48 48 GLN GLN A . n A 1 20 GLU 20 49 49 GLU GLU A . n A 1 21 LEU 21 50 50 LEU LEU A . n A 1 22 PRO 22 51 51 PRO PRO A . n A 1 23 ALA 23 52 52 ALA ALA A . n A 1 24 GLN 24 53 53 GLN GLN A . n A 1 25 VAL 25 54 54 VAL VAL A . n A 1 26 LYS 26 55 55 LYS LYS A . n A 1 27 GLY 27 56 56 GLY GLY A . n A 1 28 LEU 28 57 57 LEU LEU A . n A 1 29 ALA 29 58 58 ALA ALA A . n A 1 30 ALA 30 59 59 ALA ALA A . n A 1 31 HIS 31 60 60 HIS HIS A . n A 1 32 ILE 32 61 61 ILE ILE A . n A 1 33 ASN 33 62 62 ASN ASN A . n A 1 34 LEU 34 63 63 LEU LEU A . n A 1 35 SER 35 64 64 SER SER A . n A 1 36 LEU 36 65 65 LEU LEU A . n A 1 37 SER 37 66 66 SER SER A . n A 1 38 GLN 38 67 67 GLN GLN A . n A 1 39 ASP 39 68 68 ASP ASP A . n A 1 40 LEU 40 69 69 LEU LEU A . n A 1 41 ALA 41 70 70 ALA ALA A . n A 1 42 ILE 42 71 71 ILE ILE A . n A 1 43 SER 43 72 72 SER SER A . n A 1 44 GLU 44 73 73 GLU GLU A . n A 1 45 SER 45 74 74 SER SER A . n A 1 46 LEU 46 75 75 LEU LEU A . n A 1 47 ALA 47 76 76 ALA ALA A . n A 1 48 ASN 48 77 77 ASN ASN A . n A 1 49 SER 49 78 78 SER SER A . n A 1 50 TYR 50 79 79 TYR TYR A . n A 1 51 PHE 51 80 80 PHE PHE A . n A 1 52 ILE 52 81 81 ILE ILE A . n A 1 53 GLU 53 82 82 GLU GLU A . n A 1 54 GLN 54 83 83 GLN GLN A . n A 1 55 TRP 55 84 84 TRP TRP A . n A 1 56 VAL 56 85 85 VAL VAL A . n A 1 57 ARG 57 86 86 ARG ARG A . n A 1 58 GLU 58 87 87 GLU GLU A . n A 1 59 GLY 59 88 88 GLY GLY A . n A 1 60 LEU 60 89 89 LEU LEU A . n A 1 61 PRO 61 90 90 PRO PRO A . n A 1 62 GLU 62 91 91 GLU GLU A . n A 1 63 GLU 63 92 92 GLU GLU A . n A 1 64 ARG 64 93 93 ARG ARG A . n A 1 65 GLN 65 94 94 GLN GLN A . n A 1 66 ASN 66 95 95 ASN ASN A . n A 1 67 ASP 67 96 96 ASP ASP A . n A 1 68 ILE 68 97 97 ILE ILE A . n A 1 69 ALA 69 98 98 ALA ALA A . n A 1 70 ALA 70 99 99 ALA ALA A . n A 1 71 TYR 71 100 100 TYR TYR A . n A 1 72 LEU 72 101 101 LEU LEU A . n A 1 73 ALA 73 102 102 ALA ALA A . n A 1 74 ARG 74 103 103 ARG ARG A . n A 1 75 LEU 75 104 104 LEU LEU A . n A 1 76 MSE 76 105 105 MSE MSE A . n A 1 77 GLU 77 106 106 GLU GLU A . n A 1 78 GLN 78 107 107 GLN GLN A . n A 1 79 LEU 79 108 108 LEU LEU A . n A 1 80 ASP 80 109 109 ASP ASP A . n A 1 81 THR 81 110 110 THR THR A . n A 1 82 GLU 82 111 111 GLU GLU A . n A 1 83 LEU 83 112 112 LEU LEU A . n A 1 84 LEU 84 113 113 LEU LEU A . n A 1 85 PHE 85 114 114 PHE PHE A . n A 1 86 ILE 86 115 115 ILE ILE A . n A 1 87 ALA 87 116 116 ALA ALA A . n A 1 88 ALA 88 117 117 ALA ALA A . n A 1 89 GLN 89 118 118 GLN GLN A . n A 1 90 HIS 90 119 119 HIS HIS A . n A 1 91 GLN 91 120 120 GLN GLN A . n A 1 92 GLY 92 121 121 GLY GLY A . n A 1 93 ARG 93 122 122 ARG ARG A . n A 1 94 GLY 94 123 123 GLY GLY A . n A 1 95 TYR 95 124 124 TYR TYR A . n A 1 96 TYR 96 125 125 TYR TYR A . n A 1 97 PHE 97 126 126 PHE PHE A . n A 1 98 GLN 98 127 127 GLN GLN A . n A 1 99 LEU 99 128 128 LEU LEU A . n A 1 100 ARG 100 129 129 ARG ARG A . n A 1 101 ASN 101 130 130 ASN ASN A . n A 1 102 GLY 102 131 131 GLY GLY A . n A 1 103 GLU 103 132 132 GLU GLU A . n A 1 104 PHE 104 133 133 PHE PHE A . n A 1 105 LEU 105 134 134 LEU LEU A . n A 1 106 GLN 106 135 135 GLN GLN A . n A 1 107 ARG 107 136 136 ARG ARG A . n A 1 108 ILE 108 137 137 ILE ILE A . n A 1 109 ILE 109 138 138 ILE ILE A . n A 1 110 GLN 110 139 139 GLN GLN A . n A 1 111 PRO 111 140 140 PRO PRO A . n A 1 112 PRO 112 141 141 PRO PRO A . n A 1 113 GLY 113 142 142 GLY GLY A . n A 1 114 SER 114 143 143 SER SER A . n A 1 115 GLU 115 144 144 GLU GLU A . n A 1 116 ASP 116 145 145 ASP ASP A . n A 1 117 ASP 117 146 146 ASP ASP A . n A 1 118 TRP 118 147 147 TRP TRP A . n A 1 119 TYR 119 148 148 TYR TYR A . n A 1 120 TYR 120 149 149 TYR TYR A . n A 1 121 HIS 121 150 150 HIS HIS A . n A 1 122 PHE 122 151 151 PHE PHE A . n A 1 123 THR 123 152 152 THR THR A . n A 1 124 ASP 124 153 153 ASP ASP A . n A 1 125 SER 125 154 154 SER SER A . n A 1 126 ASP 126 155 155 ASP ASP A . n A 1 127 ASN 127 156 156 ASN ASN A . n A 1 128 ALA 128 157 157 ALA ALA A . n A 1 129 TYR 129 158 158 TYR TYR A . n A 1 130 GLU 130 159 159 GLU GLU A . n A 1 131 LEU 131 160 160 LEU LEU A . n A 1 132 ASN 132 161 161 ASN ASN A . n A 1 133 LEU 133 162 162 LEU LEU A . n A 1 134 ASP 134 163 163 ASP ASP A . n A 1 135 SER 135 164 164 SER SER A . n A 1 136 ASP 136 165 165 ASP ASP A . n A 1 137 THR 137 166 166 THR THR A . n A 1 138 PHE 138 167 167 PHE PHE A . n A 1 139 SER 139 168 168 SER SER A . n A 1 140 PRO 140 169 169 PRO PRO A . n A 1 141 ASP 141 170 170 ASP ASP A . n A 1 142 ASP 142 171 171 ASP ASP A . n A 1 143 ALA 143 172 172 ALA ALA A . n A 1 144 PHE 144 173 173 PHE PHE A . n A 1 145 VAL 145 174 174 VAL VAL A . n A 1 146 TYR 146 175 175 TYR TYR A . n A 1 147 VAL 147 176 176 VAL VAL A . n A 1 148 ASN 148 177 177 ASN ASN A . n A 1 149 TYR 149 178 178 TYR TYR A . n A 1 150 ARG 150 179 179 ARG ARG A . n A 1 151 SER 151 180 180 SER SER A . n A 1 152 THR 152 181 181 THR THR A . n A 1 153 VAL 153 182 182 VAL VAL A . n A 1 154 ASN 154 183 183 ASN ASN A . n A 1 155 ALA 155 184 184 ALA ALA A . n A 1 156 ALA 156 185 185 ALA ALA A . n A 1 157 ASN 157 186 186 ASN ASN A . n A 1 158 GLY 158 187 187 GLY GLY A . n A 1 159 ARG 159 188 188 ARG ARG A . n A 1 160 PRO 160 189 189 PRO PRO A . n A 1 161 LEU 161 190 190 LEU LEU A . n A 1 162 VAL 162 191 191 VAL VAL A . n A 1 163 VAL 163 192 192 VAL VAL A . n A 1 164 ALA 164 193 193 ALA ALA A . n A 1 165 GLY 165 194 194 GLY GLY A . n A 1 166 ALA 166 195 195 ALA ALA A . n A 1 167 GLY 167 196 196 GLY GLY A . n A 1 168 LEU 168 197 197 LEU LEU A . n A 1 169 ASP 169 198 198 ASP ASP A . n A 1 170 LEU 170 199 199 LEU LEU A . n A 1 171 SER 171 200 200 SER SER A . n A 1 172 GLN 172 201 201 GLN GLN A . n A 1 173 MSE 173 202 202 MSE MSE A . n A 1 174 ALA 174 203 203 ALA ALA A . n A 1 175 SER 175 204 204 SER SER A . n A 1 176 LEU 176 205 205 LEU LEU A . n A 1 177 ILE 177 206 206 ILE ILE A . n A 1 178 ASP 178 207 207 ASP ASP A . n A 1 179 ASP 179 208 208 ASP ASP A . n A 1 180 PHE 180 209 209 PHE PHE A . n A 1 181 ARG 181 210 210 ARG ARG A . n A 1 182 LEU 182 211 211 LEU LEU A . n A 1 183 GLY 183 212 212 GLY GLY A . n A 1 184 GLY 184 213 213 GLY GLY A . n A 1 185 SER 185 214 214 SER SER A . n A 1 186 GLY 186 215 215 GLY GLY A . n A 1 187 HIS 187 216 216 HIS HIS A . n A 1 188 ALA 188 217 217 ALA ALA A . n A 1 189 SER 189 218 218 SER SER A . n A 1 190 LEU 190 219 219 LEU LEU A . n A 1 191 LEU 191 220 220 LEU LEU A . n A 1 192 SER 192 221 221 SER SER A . n A 1 193 ALA 193 222 222 ALA ALA A . n A 1 194 GLU 194 223 223 GLU GLU A . n A 1 195 GLY 195 224 224 GLY GLY A . n A 1 196 GLU 196 225 225 GLU GLU A . n A 1 197 LEU 197 226 226 LEU LEU A . n A 1 198 LEU 198 227 227 LEU LEU A . n A 1 199 VAL 199 228 228 VAL VAL A . n A 1 200 ARG 200 229 229 ARG ARG A . n A 1 201 SER 201 230 230 SER SER A . n A 1 202 GLY 202 231 ? ? ? A . n A 1 203 GLU 203 232 ? ? ? A . n A 1 204 ALA 204 233 ? ? ? A . n A 1 205 LYS 205 234 ? ? ? A . n A 1 206 ARG 206 235 ? ? ? A . n A 1 207 SER 207 236 ? ? ? A . n A 1 208 ASP 208 237 ? ? ? A . n A 1 209 GLU 209 238 ? ? ? A . n A 1 210 SER 210 239 ? ? ? A . n A 1 211 ALA 211 240 ? ? ? A . n A 1 212 PRO 212 241 ? ? ? A . n A 1 213 THR 213 242 ? ? ? A . n A 1 214 VAL 214 243 ? ? ? A . n A 1 215 ALA 215 244 ? ? ? A . n A 1 216 THR 216 245 ? ? ? A . n A 1 217 ALA 217 246 ? ? ? A . n A 1 218 THR 218 247 ? ? ? A . n A 1 219 GLU 219 248 ? ? ? A . n A 1 220 ALA 220 249 ? ? ? A . n A 1 221 LEU 221 250 ? ? ? A . n A 1 222 PRO 222 251 ? ? ? A . n A 1 223 GLU 223 252 ? ? ? A . n A 1 224 GLN 224 253 ? ? ? A . n A 1 225 ALA 225 254 ? ? ? A . n A 1 226 SER 226 255 ? ? ? A . n A 1 227 GLN 227 256 ? ? ? A . n A 1 228 ARG 228 257 ? ? ? A . n A 1 229 LEU 229 258 ? ? ? A . n A 1 230 LEU 230 259 ? ? ? A . n A 1 231 GLN 231 260 ? ? ? A . n A 1 232 ASN 232 261 ? ? ? A . n A 1 233 GLU 233 262 ? ? ? A . n A 1 234 GLN 234 263 ? ? ? A . n A 1 235 LEU 235 264 264 LEU LEU A . n A 1 236 GLN 236 265 265 GLN GLN A . n A 1 237 VAL 237 266 266 VAL VAL A . n A 1 238 HIS 238 267 267 HIS HIS A . n A 1 239 GLU 239 268 268 GLU GLU A . n A 1 240 ALA 240 269 269 ALA ALA A . n A 1 241 THR 241 270 270 THR THR A . n A 1 242 ARG 242 271 271 ARG ARG A . n A 1 243 ASP 243 272 272 ASP ASP A . n A 1 244 GLY 244 273 273 GLY GLY A . n A 1 245 GLN 245 274 274 GLN GLN A . n A 1 246 GLU 246 275 275 GLU GLU A . n A 1 247 VAL 247 276 276 VAL VAL A . n A 1 248 LEU 248 277 277 LEU LEU A . n A 1 249 VAL 249 278 278 VAL VAL A . n A 1 250 SER 250 279 279 SER SER A . n A 1 251 THR 251 280 280 THR THR A . n A 1 252 ILE 252 281 281 ILE ILE A . n A 1 253 TRP 253 282 282 TRP TRP A . n A 1 254 LEU 254 283 283 LEU LEU A . n A 1 255 PRO 255 284 284 PRO PRO A . n A 1 256 GLU 256 285 285 GLU GLU A . n A 1 257 LEU 257 286 286 LEU LEU A . n A 1 258 GLN 258 287 287 GLN GLN A . n A 1 259 ARG 259 288 288 ARG ARG A . n A 1 260 TYR 260 289 289 TYR TYR A . n A 1 261 LEU 261 290 290 LEU LEU A . n A 1 262 MSE 262 291 291 MSE MSE A . n A 1 263 VAL 263 292 292 VAL VAL A . n A 1 264 GLU 264 293 293 GLU GLU A . n A 1 265 VAL 265 294 294 VAL VAL A . n A 1 266 ASP 266 295 295 ASP ASP A . n A 1 267 LYS 267 296 296 LYS LYS A . n A 1 268 LYS 268 297 ? ? ? A . n A 1 269 ALA 269 298 ? ? ? A . n A 1 270 TYR 270 299 ? ? ? A . n A 1 271 LEU 271 300 ? ? ? A . n A 1 272 ALA 272 301 ? ? ? A . n A 1 273 SER 273 302 ? ? ? A . n A 1 274 THR 274 303 ? ? ? A . n A 1 275 HIS 275 304 ? ? ? A . n A 1 276 GLU 276 305 ? ? ? A . n A 1 277 ARG 277 306 ? ? ? A . n A 1 278 PHE 278 307 ? ? ? A . n A 1 279 LEU 279 308 ? ? ? A . n A 1 280 GLU 280 309 ? ? ? A . n A 1 281 LEU 281 310 ? ? ? A . n A 1 282 GLU 282 311 ? ? ? A . n A 1 283 HIS 283 312 ? ? ? A . n A 1 284 HIS 284 313 ? ? ? A . n A 1 285 HIS 285 314 ? ? ? A . n A 1 286 HIS 286 315 ? ? ? A . n A 1 287 HIS 287 316 ? ? ? A . n A 1 288 HIS 288 317 ? ? ? A . n # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id GUN _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id GUN _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # _pdbx_nonpoly_scheme.asym_id B _pdbx_nonpoly_scheme.entity_id 2 _pdbx_nonpoly_scheme.mon_id GUN _pdbx_nonpoly_scheme.ndb_seq_num 1 _pdbx_nonpoly_scheme.pdb_seq_num 401 _pdbx_nonpoly_scheme.auth_seq_num 5 _pdbx_nonpoly_scheme.pdb_mon_id GUN _pdbx_nonpoly_scheme.auth_mon_id GUN _pdbx_nonpoly_scheme.pdb_strand_id A _pdbx_nonpoly_scheme.pdb_ins_code . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.19.2_4158 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? CRANK ? ? ? . 4 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 120.000 _cell.angle_gamma_esd ? _cell.entry_id 9B9S _cell.details ? _cell.formula_units_Z ? _cell.length_a 178.537 _cell.length_a_esd ? _cell.length_b 178.537 _cell.length_b_esd ? _cell.length_c 89.380 _cell.length_c_esd ? _cell.volume 2467331.185 _cell.volume_esd ? _cell.Z_PDB 18 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 9B9S _symmetry.cell_setting ? _symmetry.Int_Tables_number 155 _symmetry.space_group_name_Hall ;R 3 2" ; _symmetry.space_group_name_H-M 'H 3 2' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 9B9S _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 4.23 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 70.90 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details 'sodium acetate pH 4.6, 2 M sodium formate' _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 291 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER X 4M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2021-01-31 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.967697 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'ESRF BEAMLINE MASSIF-3' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.967697 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline MASSIF-3 _diffrn_source.pdbx_synchrotron_site ESRF # _reflns.B_iso_Wilson_estimate 124.54 _reflns.entry_id 9B9S _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 3.60 _reflns.d_resolution_low 77.38 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 6446 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 100.0 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 8.1 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 8.2 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.132 _reflns.pdbx_Rpim_I_all 0.046 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.998 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs 0.124 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 3.60 _reflns_shell.d_res_low 3.94 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 1.6 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 1530 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 8.4 _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all 0.893 _reflns_shell.pdbx_Rpim_I_all 0.307 _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.828 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.percent_possible_all 100.0 _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.836 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 115.04 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 9B9S _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 3.60 _refine.ls_d_res_low 51.54 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 6437 _refine.ls_number_reflns_R_free 346 _refine.ls_number_reflns_R_work 6091 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.89 _refine.ls_percent_reflns_R_free 5.38 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2544 _refine.ls_R_factor_R_free 0.2862 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2525 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.34 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct SAD _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values 'GeoStd + Monomer Library + CDL v1.2' _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 31.7895 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.2576 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 3.60 _refine_hist.d_res_low 51.54 _refine_hist.number_atoms_solvent 0 _refine_hist.number_atoms_total 1725 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 1714 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 11 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.0025 ? 1760 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.5622 ? 2391 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.0395 ? 260 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.0036 ? 318 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 11.2265 ? 644 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free _refine_ls_shell.R_factor_R_free 'X-RAY DIFFRACTION' 3.60 4.54 . . 165 3021 100.00 . . . . 0.2961 . . . . . . . . . . . 0.2948 'X-RAY DIFFRACTION' 4.54 51.54 . . 181 3070 99.79 . . . . 0.2335 . . . . . . . . . . . 0.2824 # _struct.entry_id 9B9S _struct.title 'Crystal structure of the ligand binding domain of the Halomonas titanicae chemoreceptor Htc10 in complex with guanine' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 9B9S _struct_keywords.text 'Halomonas titanicae, chemoreceptor, guanine, SIGNALING PROTEIN' _struct_keywords.pdbx_keywords 'SIGNALING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code A0A0C3EFW7_9GAMM _struct_ref.pdbx_db_accession A0A0C3EFW7 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;LQARSHSQARLDNLLNQELPAQVKGLAAHINLSLSQDLAISESLANSYFIEQWVREGLPEERQNDIAAYLARLMEQLDTE LLFIAAQHQGRGYYFQLRNGEFLQRIIQPPGSEDDWYYHFTDSDNAYELNLDSDTFSPDDAFVYVNYRSTVNAANGRPLV VAGAGLDLSQMASLIDDFRLGGSGHASLLSAEGELLVRSGEAKRSDESAPTVATATEALPEQASQRLLQNEQLQVHEATR DGQEVLVSTIWLPELQRYLMVEVDKKAYLASTHERFLE ; _struct_ref.pdbx_align_begin 32 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 9B9S _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 3 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 280 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession A0A0C3EFW7 _struct_ref_seq.db_align_beg 32 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 309 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 32 _struct_ref_seq.pdbx_auth_seq_align_end 309 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 9B9S MSE A 1 ? UNP A0A0C3EFW7 ? ? 'initiating methionine' 30 1 1 9B9S GLY A 2 ? UNP A0A0C3EFW7 ? ? 'expression tag' 31 2 1 9B9S LEU A 281 ? UNP A0A0C3EFW7 ? ? 'expression tag' 310 3 1 9B9S GLU A 282 ? UNP A0A0C3EFW7 ? ? 'expression tag' 311 4 1 9B9S HIS A 283 ? UNP A0A0C3EFW7 ? ? 'expression tag' 312 5 1 9B9S HIS A 284 ? UNP A0A0C3EFW7 ? ? 'expression tag' 313 6 1 9B9S HIS A 285 ? UNP A0A0C3EFW7 ? ? 'expression tag' 314 7 1 9B9S HIS A 286 ? UNP A0A0C3EFW7 ? ? 'expression tag' 315 8 1 9B9S HIS A 287 ? UNP A0A0C3EFW7 ? ? 'expression tag' 316 9 1 9B9S HIS A 288 ? UNP A0A0C3EFW7 ? ? 'expression tag' 317 10 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 2600 ? 1 MORE -2 ? 1 'SSA (A^2)' 20930 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 17_555 x-y+1/3,-y+2/3,-z+2/3 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 103.0783850103 0.0000000000 0.0000000000 -1.0000000000 59.5866666667 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 GLN A 19 ? ASN A 48 ? GLN A 48 ASN A 77 1 ? 30 HELX_P HELX_P2 AA2 SER A 49 ? GLU A 58 ? SER A 78 GLU A 87 1 ? 10 HELX_P HELX_P3 AA3 PRO A 61 ? GLU A 63 ? PRO A 90 GLU A 92 5 ? 3 HELX_P HELX_P4 AA4 ARG A 64 ? ASP A 80 ? ARG A 93 ASP A 109 1 ? 17 HELX_P HELX_P5 AA5 ASP A 116 ? SER A 125 ? ASP A 145 SER A 154 1 ? 10 HELX_P HELX_P6 AA6 LEU A 170 ? ASP A 178 ? LEU A 199 ASP A 207 1 ? 9 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? A LEU 75 C ? ? ? 1_555 A MSE 76 N ? ? A LEU 104 A MSE 105 1_555 ? ? ? ? ? ? ? 1.330 ? ? covale2 covale both ? A MSE 76 C ? ? ? 1_555 A GLU 77 N ? ? A MSE 105 A GLU 106 1_555 ? ? ? ? ? ? ? 1.337 ? ? covale3 covale both ? A GLN 172 C ? ? ? 1_555 A MSE 173 N ? ? A GLN 201 A MSE 202 1_555 ? ? ? ? ? ? ? 1.332 ? ? covale4 covale both ? A MSE 173 C ? ? ? 1_555 A ALA 174 N ? ? A MSE 202 A ALA 203 1_555 ? ? ? ? ? ? ? 1.335 ? ? covale5 covale both ? A LEU 261 C ? ? ? 1_555 A MSE 262 N ? ? A LEU 290 A MSE 291 1_555 ? ? ? ? ? ? ? 1.331 ? ? covale6 covale both ? A MSE 262 C ? ? ? 1_555 A VAL 263 N ? ? A MSE 291 A VAL 292 1_555 ? ? ? ? ? ? ? 1.330 ? ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 MSE A 76 ? . . . . MSE A 105 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' 2 MSE A 173 ? . . . . MSE A 202 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' 3 MSE A 262 ? . . . . MSE A 291 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 6 ? AA2 ? 5 ? AA3 ? 4 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA1 5 6 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel AA2 4 5 ? anti-parallel AA3 1 2 ? anti-parallel AA3 2 3 ? anti-parallel AA3 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 GLU A 103 ? ILE A 108 ? GLU A 132 ILE A 137 AA1 2 ARG A 93 ? ARG A 100 ? ARG A 122 ARG A 129 AA1 3 LEU A 83 ? HIS A 90 ? LEU A 112 HIS A 119 AA1 4 VAL A 162 ? ASP A 169 ? VAL A 191 ASP A 198 AA1 5 ALA A 143 ? ARG A 150 ? ALA A 172 ARG A 179 AA1 6 TYR A 129 ? SER A 135 ? TYR A 158 SER A 164 AA2 1 LEU A 197 ? ARG A 200 ? LEU A 226 ARG A 229 AA2 2 ALA A 188 ? LEU A 191 ? ALA A 217 LEU A 220 AA2 3 ARG A 259 ? VAL A 265 ? ARG A 288 VAL A 294 AA2 4 GLU A 246 ? SER A 250 ? GLU A 275 SER A 279 AA2 5 VAL A 237 ? THR A 241 ? VAL A 266 THR A 270 AA3 1 LEU A 197 ? ARG A 200 ? LEU A 226 ARG A 229 AA3 2 ALA A 188 ? LEU A 191 ? ALA A 217 LEU A 220 AA3 3 ARG A 259 ? VAL A 265 ? ARG A 288 VAL A 294 AA3 4 ILE A 252 ? LEU A 254 ? ILE A 281 LEU A 283 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O LEU A 105 ? O LEU A 134 N GLN A 98 ? N GLN A 127 AA1 2 3 O PHE A 97 ? O PHE A 126 N ILE A 86 ? N ILE A 115 AA1 3 4 N PHE A 85 ? N PHE A 114 O GLY A 165 ? O GLY A 194 AA1 4 5 O LEU A 168 ? O LEU A 197 N VAL A 145 ? N VAL A 174 AA1 5 6 O PHE A 144 ? O PHE A 173 N ASP A 134 ? N ASP A 163 AA2 1 2 O LEU A 198 ? O LEU A 227 N LEU A 190 ? N LEU A 219 AA2 2 3 N SER A 189 ? N SER A 218 O MSE A 262 ? O MSE A 291 AA2 3 4 O VAL A 265 ? O VAL A 294 N LEU A 248 ? N LEU A 277 AA2 4 5 O VAL A 249 ? O VAL A 278 N HIS A 238 ? N HIS A 267 AA3 1 2 O LEU A 198 ? O LEU A 227 N LEU A 190 ? N LEU A 219 AA3 2 3 N SER A 189 ? N SER A 218 O MSE A 262 ? O MSE A 291 AA3 3 4 O ARG A 259 ? O ARG A 288 N LEU A 254 ? N LEU A 283 # _pdbx_entry_details.entry_id 9B9S _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_protein_modification Y # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id SER _pdbx_validate_torsion.auth_asym_id A _pdbx_validate_torsion.auth_seq_id 143 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi -111.89 _pdbx_validate_torsion.psi -163.21 # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A MSE 76 A MSE 105 ? MET 'modified residue' 2 A MSE 173 A MSE 202 ? MET 'modified residue' 3 A MSE 262 A MSE 291 ? MET 'modified residue' # loop_ _space_group_symop.id _space_group_symop.operation_xyz 1 x,y,z 2 -y,x-y,z 3 -x+y,-x,z 4 x-y,-y,-z 5 -x,-x+y,-z 6 y,x,-z 7 x+1/3,y+2/3,z+2/3 8 -y+1/3,x-y+2/3,z+2/3 9 -x+y+1/3,-x+2/3,z+2/3 10 x-y+1/3,-y+2/3,-z+2/3 11 -x+1/3,-x+y+2/3,-z+2/3 12 y+1/3,x+2/3,-z+2/3 13 x+2/3,y+1/3,z+1/3 14 -y+2/3,x-y+1/3,z+1/3 15 -x+y+2/3,-x+1/3,z+1/3 16 x-y+2/3,-y+1/3,-z+1/3 17 -x+2/3,-x+y+1/3,-z+1/3 18 y+2/3,x+1/3,-z+1/3 # _pdbx_refine_tls.id 1 _pdbx_refine_tls.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls.details ? _pdbx_refine_tls.method refined _pdbx_refine_tls.origin_x 1.81247454188 _pdbx_refine_tls.origin_y 40.1951123091 _pdbx_refine_tls.origin_z 37.9664421052 _pdbx_refine_tls.T[1][1] 0.656866943793 _pdbx_refine_tls.T[1][1]_esd ? _pdbx_refine_tls.T[1][2] -0.0229479410741 _pdbx_refine_tls.T[1][2]_esd ? _pdbx_refine_tls.T[1][3] -0.0215665554207 _pdbx_refine_tls.T[1][3]_esd ? _pdbx_refine_tls.T[2][2] 0.697818098973 _pdbx_refine_tls.T[2][2]_esd ? _pdbx_refine_tls.T[2][3] 0.231669097366 _pdbx_refine_tls.T[2][3]_esd ? _pdbx_refine_tls.T[3][3] 0.825694103881 _pdbx_refine_tls.T[3][3]_esd ? _pdbx_refine_tls.L[1][1] 3.30943191973 _pdbx_refine_tls.L[1][1]_esd ? _pdbx_refine_tls.L[1][2] 0.284572690966 _pdbx_refine_tls.L[1][2]_esd ? _pdbx_refine_tls.L[1][3] 0.480084564809 _pdbx_refine_tls.L[1][3]_esd ? _pdbx_refine_tls.L[2][2] 0.743160966929 _pdbx_refine_tls.L[2][2]_esd ? _pdbx_refine_tls.L[2][3] 0.24530112839 _pdbx_refine_tls.L[2][3]_esd ? _pdbx_refine_tls.L[3][3] 0.972408294458 _pdbx_refine_tls.L[3][3]_esd ? _pdbx_refine_tls.S[1][1] 0.140345824682 _pdbx_refine_tls.S[1][1]_esd ? _pdbx_refine_tls.S[1][2] 0.186383291746 _pdbx_refine_tls.S[1][2]_esd ? _pdbx_refine_tls.S[1][3] -0.416736186286 _pdbx_refine_tls.S[1][3]_esd ? _pdbx_refine_tls.S[2][1] 0.0451325590881 _pdbx_refine_tls.S[2][1]_esd ? _pdbx_refine_tls.S[2][2] -0.24080340363 _pdbx_refine_tls.S[2][2]_esd ? _pdbx_refine_tls.S[2][3] -0.466714707195 _pdbx_refine_tls.S[2][3]_esd ? _pdbx_refine_tls.S[3][1] 0.329407418796 _pdbx_refine_tls.S[3][1]_esd ? _pdbx_refine_tls.S[3][2] 0.23510626784 _pdbx_refine_tls.S[3][2]_esd ? _pdbx_refine_tls.S[3][3] 0.0740216460558 _pdbx_refine_tls.S[3][3]_esd ? # _pdbx_refine_tls_group.id 1 _pdbx_refine_tls_group.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls_group.refine_tls_id 1 _pdbx_refine_tls_group.beg_label_asym_id A _pdbx_refine_tls_group.beg_label_seq_id 1 _pdbx_refine_tls_group.beg_auth_asym_id A _pdbx_refine_tls_group.beg_auth_seq_id 48 _pdbx_refine_tls_group.beg_PDB_ins_code ? _pdbx_refine_tls_group.end_label_asym_id B _pdbx_refine_tls_group.end_label_seq_id ? _pdbx_refine_tls_group.end_auth_asym_id B _pdbx_refine_tls_group.end_auth_seq_id 5 _pdbx_refine_tls_group.end_PDB_ins_code ? _pdbx_refine_tls_group.selection ? _pdbx_refine_tls_group.selection_details all # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MSE 30 ? A MSE 1 2 1 Y 1 A GLY 31 ? A GLY 2 3 1 Y 1 A LEU 32 ? A LEU 3 4 1 Y 1 A GLN 33 ? A GLN 4 5 1 Y 1 A ALA 34 ? A ALA 5 6 1 Y 1 A ARG 35 ? A ARG 6 7 1 Y 1 A SER 36 ? A SER 7 8 1 Y 1 A HIS 37 ? A HIS 8 9 1 Y 1 A SER 38 ? A SER 9 10 1 Y 1 A GLN 39 ? A GLN 10 11 1 Y 1 A ALA 40 ? A ALA 11 12 1 Y 1 A ARG 41 ? A ARG 12 13 1 Y 1 A LEU 42 ? A LEU 13 14 1 Y 1 A ASP 43 ? A ASP 14 15 1 Y 1 A ASN 44 ? A ASN 15 16 1 Y 1 A LEU 45 ? A LEU 16 17 1 Y 1 A LEU 46 ? A LEU 17 18 1 Y 1 A ASN 47 ? A ASN 18 19 1 Y 1 A GLY 231 ? A GLY 202 20 1 Y 1 A GLU 232 ? A GLU 203 21 1 Y 1 A ALA 233 ? A ALA 204 22 1 Y 1 A LYS 234 ? A LYS 205 23 1 Y 1 A ARG 235 ? A ARG 206 24 1 Y 1 A SER 236 ? A SER 207 25 1 Y 1 A ASP 237 ? A ASP 208 26 1 Y 1 A GLU 238 ? A GLU 209 27 1 Y 1 A SER 239 ? A SER 210 28 1 Y 1 A ALA 240 ? A ALA 211 29 1 Y 1 A PRO 241 ? A PRO 212 30 1 Y 1 A THR 242 ? A THR 213 31 1 Y 1 A VAL 243 ? A VAL 214 32 1 Y 1 A ALA 244 ? A ALA 215 33 1 Y 1 A THR 245 ? A THR 216 34 1 Y 1 A ALA 246 ? A ALA 217 35 1 Y 1 A THR 247 ? A THR 218 36 1 Y 1 A GLU 248 ? A GLU 219 37 1 Y 1 A ALA 249 ? A ALA 220 38 1 Y 1 A LEU 250 ? A LEU 221 39 1 Y 1 A PRO 251 ? A PRO 222 40 1 Y 1 A GLU 252 ? A GLU 223 41 1 Y 1 A GLN 253 ? A GLN 224 42 1 Y 1 A ALA 254 ? A ALA 225 43 1 Y 1 A SER 255 ? A SER 226 44 1 Y 1 A GLN 256 ? A GLN 227 45 1 Y 1 A ARG 257 ? A ARG 228 46 1 Y 1 A LEU 258 ? A LEU 229 47 1 Y 1 A LEU 259 ? A LEU 230 48 1 Y 1 A GLN 260 ? A GLN 231 49 1 Y 1 A ASN 261 ? A ASN 232 50 1 Y 1 A GLU 262 ? A GLU 233 51 1 Y 1 A GLN 263 ? A GLN 234 52 1 Y 1 A LYS 297 ? A LYS 268 53 1 Y 1 A ALA 298 ? A ALA 269 54 1 Y 1 A TYR 299 ? A TYR 270 55 1 Y 1 A LEU 300 ? A LEU 271 56 1 Y 1 A ALA 301 ? A ALA 272 57 1 Y 1 A SER 302 ? A SER 273 58 1 Y 1 A THR 303 ? A THR 274 59 1 Y 1 A HIS 304 ? A HIS 275 60 1 Y 1 A GLU 305 ? A GLU 276 61 1 Y 1 A ARG 306 ? A ARG 277 62 1 Y 1 A PHE 307 ? A PHE 278 63 1 Y 1 A LEU 308 ? A LEU 279 64 1 Y 1 A GLU 309 ? A GLU 280 65 1 Y 1 A LEU 310 ? A LEU 281 66 1 Y 1 A GLU 311 ? A GLU 282 67 1 Y 1 A HIS 312 ? A HIS 283 68 1 Y 1 A HIS 313 ? A HIS 284 69 1 Y 1 A HIS 314 ? A HIS 285 70 1 Y 1 A HIS 315 ? A HIS 286 71 1 Y 1 A HIS 316 ? A HIS 287 72 1 Y 1 A HIS 317 ? A HIS 288 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 GLU N N N N 94 GLU CA C N S 95 GLU C C N N 96 GLU O O N N 97 GLU CB C N N 98 GLU CG C N N 99 GLU CD C N N 100 GLU OE1 O N N 101 GLU OE2 O N N 102 GLU OXT O N N 103 GLU H H N N 104 GLU H2 H N N 105 GLU HA H N N 106 GLU HB2 H N N 107 GLU HB3 H N N 108 GLU HG2 H N N 109 GLU HG3 H N N 110 GLU HE2 H N N 111 GLU HXT H N N 112 GLY N N N N 113 GLY CA C N N 114 GLY C C N N 115 GLY O O N N 116 GLY OXT O N N 117 GLY H H N N 118 GLY H2 H N N 119 GLY HA2 H N N 120 GLY HA3 H N N 121 GLY HXT H N N 122 GUN N9 N Y N 123 GUN C8 C Y N 124 GUN N7 N Y N 125 GUN C5 C Y N 126 GUN C6 C N N 127 GUN O6 O N N 128 GUN N1 N N N 129 GUN C2 C N N 130 GUN N2 N N N 131 GUN N3 N N N 132 GUN C4 C Y N 133 GUN HN9 H N N 134 GUN H8 H N N 135 GUN HN1 H N N 136 GUN HN21 H N N 137 GUN HN22 H N N 138 HIS N N N N 139 HIS CA C N S 140 HIS C C N N 141 HIS O O N N 142 HIS CB C N N 143 HIS CG C Y N 144 HIS ND1 N Y N 145 HIS CD2 C Y N 146 HIS CE1 C Y N 147 HIS NE2 N Y N 148 HIS OXT O N N 149 HIS H H N N 150 HIS H2 H N N 151 HIS HA H N N 152 HIS HB2 H N N 153 HIS HB3 H N N 154 HIS HD1 H N N 155 HIS HD2 H N N 156 HIS HE1 H N N 157 HIS HE2 H N N 158 HIS HXT H N N 159 ILE N N N N 160 ILE CA C N S 161 ILE C C N N 162 ILE O O N N 163 ILE CB C N S 164 ILE CG1 C N N 165 ILE CG2 C N N 166 ILE CD1 C N N 167 ILE OXT O N N 168 ILE H H N N 169 ILE H2 H N N 170 ILE HA H N N 171 ILE HB H N N 172 ILE HG12 H N N 173 ILE HG13 H N N 174 ILE HG21 H N N 175 ILE HG22 H N N 176 ILE HG23 H N N 177 ILE HD11 H N N 178 ILE HD12 H N N 179 ILE HD13 H N N 180 ILE HXT H N N 181 LEU N N N N 182 LEU CA C N S 183 LEU C C N N 184 LEU O O N N 185 LEU CB C N N 186 LEU CG C N N 187 LEU CD1 C N N 188 LEU CD2 C N N 189 LEU OXT O N N 190 LEU H H N N 191 LEU H2 H N N 192 LEU HA H N N 193 LEU HB2 H N N 194 LEU HB3 H N N 195 LEU HG H N N 196 LEU HD11 H N N 197 LEU HD12 H N N 198 LEU HD13 H N N 199 LEU HD21 H N N 200 LEU HD22 H N N 201 LEU HD23 H N N 202 LEU HXT H N N 203 LYS N N N N 204 LYS CA C N S 205 LYS C C N N 206 LYS O O N N 207 LYS CB C N N 208 LYS CG C N N 209 LYS CD C N N 210 LYS CE C N N 211 LYS NZ N N N 212 LYS OXT O N N 213 LYS H H N N 214 LYS H2 H N N 215 LYS HA H N N 216 LYS HB2 H N N 217 LYS HB3 H N N 218 LYS HG2 H N N 219 LYS HG3 H N N 220 LYS HD2 H N N 221 LYS HD3 H N N 222 LYS HE2 H N N 223 LYS HE3 H N N 224 LYS HZ1 H N N 225 LYS HZ2 H N N 226 LYS HZ3 H N N 227 LYS HXT H N N 228 MSE N N N N 229 MSE CA C N S 230 MSE C C N N 231 MSE O O N N 232 MSE OXT O N N 233 MSE CB C N N 234 MSE CG C N N 235 MSE SE SE N N 236 MSE CE C N N 237 MSE H H N N 238 MSE H2 H N N 239 MSE HA H N N 240 MSE HXT H N N 241 MSE HB2 H N N 242 MSE HB3 H N N 243 MSE HG2 H N N 244 MSE HG3 H N N 245 MSE HE1 H N N 246 MSE HE2 H N N 247 MSE HE3 H N N 248 PHE N N N N 249 PHE CA C N S 250 PHE C C N N 251 PHE O O N N 252 PHE CB C N N 253 PHE CG C Y N 254 PHE CD1 C Y N 255 PHE CD2 C Y N 256 PHE CE1 C Y N 257 PHE CE2 C Y N 258 PHE CZ C Y N 259 PHE OXT O N N 260 PHE H H N N 261 PHE H2 H N N 262 PHE HA H N N 263 PHE HB2 H N N 264 PHE HB3 H N N 265 PHE HD1 H N N 266 PHE HD2 H N N 267 PHE HE1 H N N 268 PHE HE2 H N N 269 PHE HZ H N N 270 PHE HXT H N N 271 PRO N N N N 272 PRO CA C N S 273 PRO C C N N 274 PRO O O N N 275 PRO CB C N N 276 PRO CG C N N 277 PRO CD C N N 278 PRO OXT O N N 279 PRO H H N N 280 PRO HA H N N 281 PRO HB2 H N N 282 PRO HB3 H N N 283 PRO HG2 H N N 284 PRO HG3 H N N 285 PRO HD2 H N N 286 PRO HD3 H N N 287 PRO HXT H N N 288 SER N N N N 289 SER CA C N S 290 SER C C N N 291 SER O O N N 292 SER CB C N N 293 SER OG O N N 294 SER OXT O N N 295 SER H H N N 296 SER H2 H N N 297 SER HA H N N 298 SER HB2 H N N 299 SER HB3 H N N 300 SER HG H N N 301 SER HXT H N N 302 THR N N N N 303 THR CA C N S 304 THR C C N N 305 THR O O N N 306 THR CB C N R 307 THR OG1 O N N 308 THR CG2 C N N 309 THR OXT O N N 310 THR H H N N 311 THR H2 H N N 312 THR HA H N N 313 THR HB H N N 314 THR HG1 H N N 315 THR HG21 H N N 316 THR HG22 H N N 317 THR HG23 H N N 318 THR HXT H N N 319 TRP N N N N 320 TRP CA C N S 321 TRP C C N N 322 TRP O O N N 323 TRP CB C N N 324 TRP CG C Y N 325 TRP CD1 C Y N 326 TRP CD2 C Y N 327 TRP NE1 N Y N 328 TRP CE2 C Y N 329 TRP CE3 C Y N 330 TRP CZ2 C Y N 331 TRP CZ3 C Y N 332 TRP CH2 C Y N 333 TRP OXT O N N 334 TRP H H N N 335 TRP H2 H N N 336 TRP HA H N N 337 TRP HB2 H N N 338 TRP HB3 H N N 339 TRP HD1 H N N 340 TRP HE1 H N N 341 TRP HE3 H N N 342 TRP HZ2 H N N 343 TRP HZ3 H N N 344 TRP HH2 H N N 345 TRP HXT H N N 346 TYR N N N N 347 TYR CA C N S 348 TYR C C N N 349 TYR O O N N 350 TYR CB C N N 351 TYR CG C Y N 352 TYR CD1 C Y N 353 TYR CD2 C Y N 354 TYR CE1 C Y N 355 TYR CE2 C Y N 356 TYR CZ C Y N 357 TYR OH O N N 358 TYR OXT O N N 359 TYR H H N N 360 TYR H2 H N N 361 TYR HA H N N 362 TYR HB2 H N N 363 TYR HB3 H N N 364 TYR HD1 H N N 365 TYR HD2 H N N 366 TYR HE1 H N N 367 TYR HE2 H N N 368 TYR HH H N N 369 TYR HXT H N N 370 VAL N N N N 371 VAL CA C N S 372 VAL C C N N 373 VAL O O N N 374 VAL CB C N N 375 VAL CG1 C N N 376 VAL CG2 C N N 377 VAL OXT O N N 378 VAL H H N N 379 VAL H2 H N N 380 VAL HA H N N 381 VAL HB H N N 382 VAL HG11 H N N 383 VAL HG12 H N N 384 VAL HG13 H N N 385 VAL HG21 H N N 386 VAL HG22 H N N 387 VAL HG23 H N N 388 VAL HXT H N N 389 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 GUN N9 C8 sing Y N 116 GUN N9 C4 sing Y N 117 GUN N9 HN9 sing N N 118 GUN C8 N7 doub Y N 119 GUN C8 H8 sing N N 120 GUN N7 C5 sing Y N 121 GUN C5 C6 sing N N 122 GUN C5 C4 doub Y N 123 GUN C6 O6 doub N N 124 GUN C6 N1 sing N N 125 GUN N1 C2 sing N N 126 GUN N1 HN1 sing N N 127 GUN C2 N2 sing N N 128 GUN C2 N3 doub N N 129 GUN N2 HN21 sing N N 130 GUN N2 HN22 sing N N 131 GUN N3 C4 sing N N 132 HIS N CA sing N N 133 HIS N H sing N N 134 HIS N H2 sing N N 135 HIS CA C sing N N 136 HIS CA CB sing N N 137 HIS CA HA sing N N 138 HIS C O doub N N 139 HIS C OXT sing N N 140 HIS CB CG sing N N 141 HIS CB HB2 sing N N 142 HIS CB HB3 sing N N 143 HIS CG ND1 sing Y N 144 HIS CG CD2 doub Y N 145 HIS ND1 CE1 doub Y N 146 HIS ND1 HD1 sing N N 147 HIS CD2 NE2 sing Y N 148 HIS CD2 HD2 sing N N 149 HIS CE1 NE2 sing Y N 150 HIS CE1 HE1 sing N N 151 HIS NE2 HE2 sing N N 152 HIS OXT HXT sing N N 153 ILE N CA sing N N 154 ILE N H sing N N 155 ILE N H2 sing N N 156 ILE CA C sing N N 157 ILE CA CB sing N N 158 ILE CA HA sing N N 159 ILE C O doub N N 160 ILE C OXT sing N N 161 ILE CB CG1 sing N N 162 ILE CB CG2 sing N N 163 ILE CB HB sing N N 164 ILE CG1 CD1 sing N N 165 ILE CG1 HG12 sing N N 166 ILE CG1 HG13 sing N N 167 ILE CG2 HG21 sing N N 168 ILE CG2 HG22 sing N N 169 ILE CG2 HG23 sing N N 170 ILE CD1 HD11 sing N N 171 ILE CD1 HD12 sing N N 172 ILE CD1 HD13 sing N N 173 ILE OXT HXT sing N N 174 LEU N CA sing N N 175 LEU N H sing N N 176 LEU N H2 sing N N 177 LEU CA C sing N N 178 LEU CA CB sing N N 179 LEU CA HA sing N N 180 LEU C O doub N N 181 LEU C OXT sing N N 182 LEU CB CG sing N N 183 LEU CB HB2 sing N N 184 LEU CB HB3 sing N N 185 LEU CG CD1 sing N N 186 LEU CG CD2 sing N N 187 LEU CG HG sing N N 188 LEU CD1 HD11 sing N N 189 LEU CD1 HD12 sing N N 190 LEU CD1 HD13 sing N N 191 LEU CD2 HD21 sing N N 192 LEU CD2 HD22 sing N N 193 LEU CD2 HD23 sing N N 194 LEU OXT HXT sing N N 195 LYS N CA sing N N 196 LYS N H sing N N 197 LYS N H2 sing N N 198 LYS CA C sing N N 199 LYS CA CB sing N N 200 LYS CA HA sing N N 201 LYS C O doub N N 202 LYS C OXT sing N N 203 LYS CB CG sing N N 204 LYS CB HB2 sing N N 205 LYS CB HB3 sing N N 206 LYS CG CD sing N N 207 LYS CG HG2 sing N N 208 LYS CG HG3 sing N N 209 LYS CD CE sing N N 210 LYS CD HD2 sing N N 211 LYS CD HD3 sing N N 212 LYS CE NZ sing N N 213 LYS CE HE2 sing N N 214 LYS CE HE3 sing N N 215 LYS NZ HZ1 sing N N 216 LYS NZ HZ2 sing N N 217 LYS NZ HZ3 sing N N 218 LYS OXT HXT sing N N 219 MSE N CA sing N N 220 MSE N H sing N N 221 MSE N H2 sing N N 222 MSE CA C sing N N 223 MSE CA CB sing N N 224 MSE CA HA sing N N 225 MSE C O doub N N 226 MSE C OXT sing N N 227 MSE OXT HXT sing N N 228 MSE CB CG sing N N 229 MSE CB HB2 sing N N 230 MSE CB HB3 sing N N 231 MSE CG SE sing N N 232 MSE CG HG2 sing N N 233 MSE CG HG3 sing N N 234 MSE SE CE sing N N 235 MSE CE HE1 sing N N 236 MSE CE HE2 sing N N 237 MSE CE HE3 sing N N 238 PHE N CA sing N N 239 PHE N H sing N N 240 PHE N H2 sing N N 241 PHE CA C sing N N 242 PHE CA CB sing N N 243 PHE CA HA sing N N 244 PHE C O doub N N 245 PHE C OXT sing N N 246 PHE CB CG sing N N 247 PHE CB HB2 sing N N 248 PHE CB HB3 sing N N 249 PHE CG CD1 doub Y N 250 PHE CG CD2 sing Y N 251 PHE CD1 CE1 sing Y N 252 PHE CD1 HD1 sing N N 253 PHE CD2 CE2 doub Y N 254 PHE CD2 HD2 sing N N 255 PHE CE1 CZ doub Y N 256 PHE CE1 HE1 sing N N 257 PHE CE2 CZ sing Y N 258 PHE CE2 HE2 sing N N 259 PHE CZ HZ sing N N 260 PHE OXT HXT sing N N 261 PRO N CA sing N N 262 PRO N CD sing N N 263 PRO N H sing N N 264 PRO CA C sing N N 265 PRO CA CB sing N N 266 PRO CA HA sing N N 267 PRO C O doub N N 268 PRO C OXT sing N N 269 PRO CB CG sing N N 270 PRO CB HB2 sing N N 271 PRO CB HB3 sing N N 272 PRO CG CD sing N N 273 PRO CG HG2 sing N N 274 PRO CG HG3 sing N N 275 PRO CD HD2 sing N N 276 PRO CD HD3 sing N N 277 PRO OXT HXT sing N N 278 SER N CA sing N N 279 SER N H sing N N 280 SER N H2 sing N N 281 SER CA C sing N N 282 SER CA CB sing N N 283 SER CA HA sing N N 284 SER C O doub N N 285 SER C OXT sing N N 286 SER CB OG sing N N 287 SER CB HB2 sing N N 288 SER CB HB3 sing N N 289 SER OG HG sing N N 290 SER OXT HXT sing N N 291 THR N CA sing N N 292 THR N H sing N N 293 THR N H2 sing N N 294 THR CA C sing N N 295 THR CA CB sing N N 296 THR CA HA sing N N 297 THR C O doub N N 298 THR C OXT sing N N 299 THR CB OG1 sing N N 300 THR CB CG2 sing N N 301 THR CB HB sing N N 302 THR OG1 HG1 sing N N 303 THR CG2 HG21 sing N N 304 THR CG2 HG22 sing N N 305 THR CG2 HG23 sing N N 306 THR OXT HXT sing N N 307 TRP N CA sing N N 308 TRP N H sing N N 309 TRP N H2 sing N N 310 TRP CA C sing N N 311 TRP CA CB sing N N 312 TRP CA HA sing N N 313 TRP C O doub N N 314 TRP C OXT sing N N 315 TRP CB CG sing N N 316 TRP CB HB2 sing N N 317 TRP CB HB3 sing N N 318 TRP CG CD1 doub Y N 319 TRP CG CD2 sing Y N 320 TRP CD1 NE1 sing Y N 321 TRP CD1 HD1 sing N N 322 TRP CD2 CE2 doub Y N 323 TRP CD2 CE3 sing Y N 324 TRP NE1 CE2 sing Y N 325 TRP NE1 HE1 sing N N 326 TRP CE2 CZ2 sing Y N 327 TRP CE3 CZ3 doub Y N 328 TRP CE3 HE3 sing N N 329 TRP CZ2 CH2 doub Y N 330 TRP CZ2 HZ2 sing N N 331 TRP CZ3 CH2 sing Y N 332 TRP CZ3 HZ3 sing N N 333 TRP CH2 HH2 sing N N 334 TRP OXT HXT sing N N 335 TYR N CA sing N N 336 TYR N H sing N N 337 TYR N H2 sing N N 338 TYR CA C sing N N 339 TYR CA CB sing N N 340 TYR CA HA sing N N 341 TYR C O doub N N 342 TYR C OXT sing N N 343 TYR CB CG sing N N 344 TYR CB HB2 sing N N 345 TYR CB HB3 sing N N 346 TYR CG CD1 doub Y N 347 TYR CG CD2 sing Y N 348 TYR CD1 CE1 sing Y N 349 TYR CD1 HD1 sing N N 350 TYR CD2 CE2 doub Y N 351 TYR CD2 HD2 sing N N 352 TYR CE1 CZ doub Y N 353 TYR CE1 HE1 sing N N 354 TYR CE2 CZ sing Y N 355 TYR CE2 HE2 sing N N 356 TYR CZ OH sing N N 357 TYR OH HH sing N N 358 TYR OXT HXT sing N N 359 VAL N CA sing N N 360 VAL N H sing N N 361 VAL N H2 sing N N 362 VAL CA C sing N N 363 VAL CA CB sing N N 364 VAL CA HA sing N N 365 VAL C O doub N N 366 VAL C OXT sing N N 367 VAL CB CG1 sing N N 368 VAL CB CG2 sing N N 369 VAL CB HB sing N N 370 VAL CG1 HG11 sing N N 371 VAL CG1 HG12 sing N N 372 VAL CG1 HG13 sing N N 373 VAL CG2 HG21 sing N N 374 VAL CG2 HG22 sing N N 375 VAL CG2 HG23 sing N N 376 VAL OXT HXT sing N N 377 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'Agencia Nacional de Promocion Cientifica y Tecnologica (FONCYT)' Argentina PICT2016-1629 1 'Agencia Nacional de Promocion Cientifica y Tecnologica (FONCYT)' Argentina PICT2020-3814 2 # _space_group.name_H-M_alt 'R 3 2 :H' _space_group.name_Hall ;R 3 2" ; _space_group.IT_number 155 _space_group.crystal_system trigonal _space_group.id 1 # _atom_sites.entry_id 9B9S _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 0.005601 _atom_sites.fract_transf_matrix[1][2] 0.003234 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.006468 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.011188 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.scat_dispersion_real _atom_type.scat_dispersion_imag _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c _atom_type.scat_source _atom_type.scat_dispersion_source C ? ? 5.96793 ? ? ? 14.89577 ? ? ? 0.0 ;1-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? N ? ? 6.96715 ? ? ? 11.43723 ? ? ? 0.0 ;1-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O ? ? 7.96527 ? ? ? 9.05267 ? ? ? 0.0 ;1-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O1- ? ? 8.95260 ? ? ? 12.67477 ? ? ? 0.0 ;1-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? SE ? ? 33.79294 ? ? ? 6.51140 ? ? ? 0.0 ;1-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? # loop_ # loop_ #