data_9BAR # _entry.id 9BAR # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.403 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 9BAR pdb_00009bar 10.2210/pdb9bar/pdb WWPDB D_1000282982 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date _pdbx_audit_revision_history.part_number 1 'Structure model' 1 0 2024-12-04 ? 2 'Structure model' 1 1 2025-05-21 ? # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_audit_revision_group.ordinal 1 _pdbx_audit_revision_group.revision_ordinal 2 _pdbx_audit_revision_group.data_content_type 'Structure model' _pdbx_audit_revision_group.group 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 9BAR _pdbx_database_status.recvd_initial_deposition_date 2024-04-04 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_contact_author.id 2 _pdbx_contact_author.email chruszcz@msu.edu _pdbx_contact_author.name_first Maksymilian _pdbx_contact_author.name_last Chruszcz _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0001-7521-5485 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID ;O'Malley, A. ; 1 ? 'Kapingidza, A.B.' 2 ? 'Ruethers, T.' 3 ? 'Lopata, A.L.' 4 ? 'Chruszcz, M.' 5 ? # loop_ _citation.abstract _citation.abstract_id_CAS _citation.book_id_ISBN _citation.book_publisher _citation.book_publisher_city _citation.book_title _citation.coordinate_linkage _citation.country _citation.database_id_Medline _citation.details _citation.id _citation.journal_abbrev _citation.journal_id_ASTM _citation.journal_id_CSD _citation.journal_id_ISSN _citation.journal_full _citation.journal_issue _citation.journal_volume _citation.language _citation.page_first _citation.page_last _citation.title _citation.year _citation.database_id_CSD _citation.pdbx_database_id_DOI _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_patent _citation.unpublished_flag ? ? ? ? ? ? ? US ? ? primary 'Protein Sci.' PRCIEI 0795 1469-896X ? ? 33 ? e5226 e5226 'Comparative studies of seafood and reptile alpha- and beta-parvalbumins.' 2024 ? 10.1002/pro.5226 39584689 ? ? ? ? ? ? ? ? ? US ? ? 1 'Protein Sci.' PRCIEI 0795 1469-896X ? ? ? ? ? ? 'Crystal structure of the alpha parvalbumin from thornback ray' 2024 ? 10.1002/pro.522614 ? ? ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary ;O'Malley, A. ; 1 ? primary 'Ray, J.M.' 2 ? primary 'Kitlas, P.' 3 ? primary 'Ruethers, T.' 4 ? primary 'Kapingidza, A.B.' 5 ? primary 'Cierpicki, T.' 6 ? primary 'Lopata, A.' 7 0000-0002-2940-9235 primary 'Kowal, K.' 8 ? primary 'Chruszcz, M.' 9 0000-0001-7521-5485 1 ;O'Malley, A. ; 10 ? 1 'Kapingidza, A.B.' 11 ? 1 'Ruethers, T.' 12 ? 1 'Lopata, A.L.' 13 ? 1 'Chruszcz, M.' 14 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Parvalbumin alpha' 13663.187 1 ? ? ? ? 2 non-polymer syn 'CALCIUM ION' 40.078 2 ? ? ? ? 3 non-polymer syn 'SULFATE ION' 96.063 2 ? ? ? ? 4 water nat water 18.015 118 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MGHHHHHHENLYFQGSSKITSILNPADITKALEQCAAGFHHTAFFKASGLSKKSDAELAEIFNVLDGDQSGYIEVEELKN FLKCFSDGARVLNDKETSNFLAAGDSDGDHKIGVDEFKSMAKMT ; _entity_poly.pdbx_seq_one_letter_code_can ;MGHHHHHHENLYFQGSSKITSILNPADITKALEQCAAGFHHTAFFKASGLSKKSDAELAEIFNVLDGDQSGYIEVEELKN FLKCFSDGARVLNDKETSNFLAAGDSDGDHKIGVDEFKSMAKMT ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'CALCIUM ION' CA 3 'SULFATE ION' SO4 4 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLY n 1 3 HIS n 1 4 HIS n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 HIS n 1 9 GLU n 1 10 ASN n 1 11 LEU n 1 12 TYR n 1 13 PHE n 1 14 GLN n 1 15 GLY n 1 16 SER n 1 17 SER n 1 18 LYS n 1 19 ILE n 1 20 THR n 1 21 SER n 1 22 ILE n 1 23 LEU n 1 24 ASN n 1 25 PRO n 1 26 ALA n 1 27 ASP n 1 28 ILE n 1 29 THR n 1 30 LYS n 1 31 ALA n 1 32 LEU n 1 33 GLU n 1 34 GLN n 1 35 CYS n 1 36 ALA n 1 37 ALA n 1 38 GLY n 1 39 PHE n 1 40 HIS n 1 41 HIS n 1 42 THR n 1 43 ALA n 1 44 PHE n 1 45 PHE n 1 46 LYS n 1 47 ALA n 1 48 SER n 1 49 GLY n 1 50 LEU n 1 51 SER n 1 52 LYS n 1 53 LYS n 1 54 SER n 1 55 ASP n 1 56 ALA n 1 57 GLU n 1 58 LEU n 1 59 ALA n 1 60 GLU n 1 61 ILE n 1 62 PHE n 1 63 ASN n 1 64 VAL n 1 65 LEU n 1 66 ASP n 1 67 GLY n 1 68 ASP n 1 69 GLN n 1 70 SER n 1 71 GLY n 1 72 TYR n 1 73 ILE n 1 74 GLU n 1 75 VAL n 1 76 GLU n 1 77 GLU n 1 78 LEU n 1 79 LYS n 1 80 ASN n 1 81 PHE n 1 82 LEU n 1 83 LYS n 1 84 CYS n 1 85 PHE n 1 86 SER n 1 87 ASP n 1 88 GLY n 1 89 ALA n 1 90 ARG n 1 91 VAL n 1 92 LEU n 1 93 ASN n 1 94 ASP n 1 95 LYS n 1 96 GLU n 1 97 THR n 1 98 SER n 1 99 ASN n 1 100 PHE n 1 101 LEU n 1 102 ALA n 1 103 ALA n 1 104 GLY n 1 105 ASP n 1 106 SER n 1 107 ASP n 1 108 GLY n 1 109 ASP n 1 110 HIS n 1 111 LYS n 1 112 ILE n 1 113 GLY n 1 114 VAL n 1 115 ASP n 1 116 GLU n 1 117 PHE n 1 118 LYS n 1 119 SER n 1 120 MET n 1 121 ALA n 1 122 LYS n 1 123 MET n 1 124 THR n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 124 _entity_src_gen.gene_src_common_name 'thornback ray' _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Raja clavata' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 7781 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CA non-polymer . 'CALCIUM ION' ? 'Ca 2' 40.078 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SO4 non-polymer . 'SULFATE ION' ? 'O4 S -2' 96.063 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 -14 ? ? ? A . n A 1 2 GLY 2 -13 ? ? ? A . n A 1 3 HIS 3 -12 ? ? ? A . n A 1 4 HIS 4 -11 ? ? ? A . n A 1 5 HIS 5 -10 ? ? ? A . n A 1 6 HIS 6 -9 ? ? ? A . n A 1 7 HIS 7 -8 ? ? ? A . n A 1 8 HIS 8 -7 ? ? ? A . n A 1 9 GLU 9 -6 ? ? ? A . n A 1 10 ASN 10 -5 ? ? ? A . n A 1 11 LEU 11 -4 ? ? ? A . n A 1 12 TYR 12 -3 ? ? ? A . n A 1 13 PHE 13 -2 ? ? ? A . n A 1 14 GLN 14 -1 ? ? ? A . n A 1 15 GLY 15 0 ? ? ? A . n A 1 16 SER 16 1 ? ? ? A . n A 1 17 SER 17 2 2 SER SER A . n A 1 18 LYS 18 3 3 LYS LYS A . n A 1 19 ILE 19 4 4 ILE ILE A . n A 1 20 THR 20 5 5 THR THR A . n A 1 21 SER 21 6 6 SER SER A . n A 1 22 ILE 22 7 7 ILE ILE A . n A 1 23 LEU 23 8 8 LEU LEU A . n A 1 24 ASN 24 9 9 ASN ASN A . n A 1 25 PRO 25 10 10 PRO PRO A . n A 1 26 ALA 26 11 11 ALA ALA A . n A 1 27 ASP 27 12 12 ASP ASP A . n A 1 28 ILE 28 13 13 ILE ILE A . n A 1 29 THR 29 14 14 THR THR A . n A 1 30 LYS 30 15 15 LYS LYS A . n A 1 31 ALA 31 16 16 ALA ALA A . n A 1 32 LEU 32 17 17 LEU LEU A . n A 1 33 GLU 33 18 18 GLU GLU A . n A 1 34 GLN 34 19 19 GLN GLN A . n A 1 35 CYS 35 20 20 CYS CYS A . n A 1 36 ALA 36 21 21 ALA ALA A . n A 1 37 ALA 37 22 22 ALA ALA A . n A 1 38 GLY 38 23 23 GLY GLY A . n A 1 39 PHE 39 24 24 PHE PHE A . n A 1 40 HIS 40 25 25 HIS HIS A . n A 1 41 HIS 41 26 26 HIS HIS A . n A 1 42 THR 42 27 27 THR THR A . n A 1 43 ALA 43 28 28 ALA ALA A . n A 1 44 PHE 44 29 29 PHE PHE A . n A 1 45 PHE 45 30 30 PHE PHE A . n A 1 46 LYS 46 31 31 LYS LYS A . n A 1 47 ALA 47 32 32 ALA ALA A . n A 1 48 SER 48 33 33 SER SER A . n A 1 49 GLY 49 34 34 GLY GLY A . n A 1 50 LEU 50 35 35 LEU LEU A . n A 1 51 SER 51 36 36 SER SER A . n A 1 52 LYS 52 37 37 LYS LYS A . n A 1 53 LYS 53 38 38 LYS LYS A . n A 1 54 SER 54 39 39 SER SER A . n A 1 55 ASP 55 40 40 ASP ASP A . n A 1 56 ALA 56 41 41 ALA ALA A . n A 1 57 GLU 57 42 42 GLU GLU A . n A 1 58 LEU 58 43 43 LEU LEU A . n A 1 59 ALA 59 44 44 ALA ALA A . n A 1 60 GLU 60 45 45 GLU GLU A . n A 1 61 ILE 61 46 46 ILE ILE A . n A 1 62 PHE 62 47 47 PHE PHE A . n A 1 63 ASN 63 48 48 ASN ASN A . n A 1 64 VAL 64 49 49 VAL VAL A . n A 1 65 LEU 65 50 50 LEU LEU A . n A 1 66 ASP 66 51 51 ASP ASP A . n A 1 67 GLY 67 52 52 GLY GLY A . n A 1 68 ASP 68 53 53 ASP ASP A . n A 1 69 GLN 69 54 54 GLN GLN A . n A 1 70 SER 70 55 55 SER SER A . n A 1 71 GLY 71 56 56 GLY GLY A . n A 1 72 TYR 72 57 57 TYR TYR A . n A 1 73 ILE 73 58 58 ILE ILE A . n A 1 74 GLU 74 59 59 GLU GLU A . n A 1 75 VAL 75 60 60 VAL VAL A . n A 1 76 GLU 76 61 61 GLU GLU A . n A 1 77 GLU 77 62 62 GLU GLU A . n A 1 78 LEU 78 63 63 LEU LEU A . n A 1 79 LYS 79 64 64 LYS LYS A . n A 1 80 ASN 80 65 65 ASN ASN A . n A 1 81 PHE 81 66 66 PHE PHE A . n A 1 82 LEU 82 67 67 LEU LEU A . n A 1 83 LYS 83 68 68 LYS LYS A . n A 1 84 CYS 84 69 69 CYS CYS A . n A 1 85 PHE 85 70 70 PHE PHE A . n A 1 86 SER 86 71 71 SER SER A . n A 1 87 ASP 87 72 72 ASP ASP A . n A 1 88 GLY 88 73 73 GLY GLY A . n A 1 89 ALA 89 74 74 ALA ALA A . n A 1 90 ARG 90 75 75 ARG ARG A . n A 1 91 VAL 91 76 76 VAL VAL A . n A 1 92 LEU 92 77 77 LEU LEU A . n A 1 93 ASN 93 78 78 ASN ASN A . n A 1 94 ASP 94 79 79 ASP ASP A . n A 1 95 LYS 95 80 80 LYS LYS A . n A 1 96 GLU 96 81 81 GLU GLU A . n A 1 97 THR 97 82 82 THR THR A . n A 1 98 SER 98 83 83 SER SER A . n A 1 99 ASN 99 84 84 ASN ASN A . n A 1 100 PHE 100 85 85 PHE PHE A . n A 1 101 LEU 101 86 86 LEU LEU A . n A 1 102 ALA 102 87 87 ALA ALA A . n A 1 103 ALA 103 88 88 ALA ALA A . n A 1 104 GLY 104 89 89 GLY GLY A . n A 1 105 ASP 105 90 90 ASP ASP A . n A 1 106 SER 106 91 91 SER SER A . n A 1 107 ASP 107 92 92 ASP ASP A . n A 1 108 GLY 108 93 93 GLY GLY A . n A 1 109 ASP 109 94 94 ASP ASP A . n A 1 110 HIS 110 95 95 HIS HIS A . n A 1 111 LYS 111 96 96 LYS LYS A . n A 1 112 ILE 112 97 97 ILE ILE A . n A 1 113 GLY 113 98 98 GLY GLY A . n A 1 114 VAL 114 99 99 VAL VAL A . n A 1 115 ASP 115 100 100 ASP ASP A . n A 1 116 GLU 116 101 101 GLU GLU A . n A 1 117 PHE 117 102 102 PHE PHE A . n A 1 118 LYS 118 103 103 LYS LYS A . n A 1 119 SER 119 104 104 SER SER A . n A 1 120 MET 120 105 105 MET MET A . n A 1 121 ALA 121 106 106 ALA ALA A . n A 1 122 LYS 122 107 107 LYS LYS A . n A 1 123 MET 123 108 108 MET MET A . n A 1 124 THR 124 109 109 THR THR A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 CA 1 201 1 CA CA A . C 2 CA 1 202 2 CA CA A . D 3 SO4 1 203 1 SO4 SO4 A . E 3 SO4 1 204 3 SO4 SO4 A . F 4 HOH 1 301 167 HOH HOH A . F 4 HOH 2 302 153 HOH HOH A . F 4 HOH 3 303 48 HOH HOH A . F 4 HOH 4 304 14 HOH HOH A . F 4 HOH 5 305 58 HOH HOH A . F 4 HOH 6 306 24 HOH HOH A . F 4 HOH 7 307 141 HOH HOH A . F 4 HOH 8 308 67 HOH HOH A . F 4 HOH 9 309 259 HOH HOH A . F 4 HOH 10 310 104 HOH HOH A . F 4 HOH 11 311 161 HOH HOH A . F 4 HOH 12 312 235 HOH HOH A . F 4 HOH 13 313 91 HOH HOH A . F 4 HOH 14 314 88 HOH HOH A . F 4 HOH 15 315 216 HOH HOH A . F 4 HOH 16 316 181 HOH HOH A . F 4 HOH 17 317 225 HOH HOH A . F 4 HOH 18 318 283 HOH HOH A . F 4 HOH 19 319 17 HOH HOH A . F 4 HOH 20 320 156 HOH HOH A . F 4 HOH 21 321 233 HOH HOH A . F 4 HOH 22 322 149 HOH HOH A . F 4 HOH 23 323 121 HOH HOH A . F 4 HOH 24 324 19 HOH HOH A . F 4 HOH 25 325 85 HOH HOH A . F 4 HOH 26 326 4 HOH HOH A . F 4 HOH 27 327 10 HOH HOH A . F 4 HOH 28 328 168 HOH HOH A . F 4 HOH 29 329 47 HOH HOH A . F 4 HOH 30 330 103 HOH HOH A . F 4 HOH 31 331 36 HOH HOH A . F 4 HOH 32 332 61 HOH HOH A . F 4 HOH 33 333 133 HOH HOH A . F 4 HOH 34 334 92 HOH HOH A . F 4 HOH 35 335 35 HOH HOH A . F 4 HOH 36 336 281 HOH HOH A . F 4 HOH 37 337 39 HOH HOH A . F 4 HOH 38 338 18 HOH HOH A . F 4 HOH 39 339 279 HOH HOH A . F 4 HOH 40 340 89 HOH HOH A . F 4 HOH 41 341 118 HOH HOH A . F 4 HOH 42 342 192 HOH HOH A . F 4 HOH 43 343 1 HOH HOH A . F 4 HOH 44 344 11 HOH HOH A . F 4 HOH 45 345 82 HOH HOH A . F 4 HOH 46 346 94 HOH HOH A . F 4 HOH 47 347 34 HOH HOH A . F 4 HOH 48 348 50 HOH HOH A . F 4 HOH 49 349 7 HOH HOH A . F 4 HOH 50 350 128 HOH HOH A . F 4 HOH 51 351 268 HOH HOH A . F 4 HOH 52 352 29 HOH HOH A . F 4 HOH 53 353 201 HOH HOH A . F 4 HOH 54 354 15 HOH HOH A . F 4 HOH 55 355 27 HOH HOH A . F 4 HOH 56 356 155 HOH HOH A . F 4 HOH 57 357 59 HOH HOH A . F 4 HOH 58 358 217 HOH HOH A . F 4 HOH 59 359 62 HOH HOH A . F 4 HOH 60 360 262 HOH HOH A . F 4 HOH 61 361 84 HOH HOH A . F 4 HOH 62 362 229 HOH HOH A . F 4 HOH 63 363 42 HOH HOH A . F 4 HOH 64 364 8 HOH HOH A . F 4 HOH 65 365 38 HOH HOH A . F 4 HOH 66 366 2 HOH HOH A . F 4 HOH 67 367 93 HOH HOH A . F 4 HOH 68 368 105 HOH HOH A . F 4 HOH 69 369 162 HOH HOH A . F 4 HOH 70 370 68 HOH HOH A . F 4 HOH 71 371 79 HOH HOH A . F 4 HOH 72 372 5 HOH HOH A . F 4 HOH 73 373 12 HOH HOH A . F 4 HOH 74 374 46 HOH HOH A . F 4 HOH 75 375 260 HOH HOH A . F 4 HOH 76 376 37 HOH HOH A . F 4 HOH 77 377 223 HOH HOH A . F 4 HOH 78 378 25 HOH HOH A . F 4 HOH 79 379 165 HOH HOH A . F 4 HOH 80 380 6 HOH HOH A . F 4 HOH 81 381 45 HOH HOH A . F 4 HOH 82 382 83 HOH HOH A . F 4 HOH 83 383 234 HOH HOH A . F 4 HOH 84 384 52 HOH HOH A . F 4 HOH 85 385 56 HOH HOH A . F 4 HOH 86 386 16 HOH HOH A . F 4 HOH 87 387 266 HOH HOH A . F 4 HOH 88 388 236 HOH HOH A . F 4 HOH 89 389 252 HOH HOH A . F 4 HOH 90 390 258 HOH HOH A . F 4 HOH 91 391 202 HOH HOH A . F 4 HOH 92 392 13 HOH HOH A . F 4 HOH 93 393 51 HOH HOH A . F 4 HOH 94 394 72 HOH HOH A . F 4 HOH 95 395 65 HOH HOH A . F 4 HOH 96 396 74 HOH HOH A . F 4 HOH 97 397 63 HOH HOH A . F 4 HOH 98 398 131 HOH HOH A . F 4 HOH 99 399 60 HOH HOH A . F 4 HOH 100 400 112 HOH HOH A . F 4 HOH 101 401 282 HOH HOH A . F 4 HOH 102 402 107 HOH HOH A . F 4 HOH 103 403 55 HOH HOH A . F 4 HOH 104 404 70 HOH HOH A . F 4 HOH 105 405 163 HOH HOH A . F 4 HOH 106 406 215 HOH HOH A . F 4 HOH 107 407 251 HOH HOH A . F 4 HOH 108 408 139 HOH HOH A . F 4 HOH 109 409 284 HOH HOH A . F 4 HOH 110 410 230 HOH HOH A . F 4 HOH 111 411 189 HOH HOH A . F 4 HOH 112 412 154 HOH HOH A . F 4 HOH 113 413 122 HOH HOH A . F 4 HOH 114 414 54 HOH HOH A . F 4 HOH 115 415 151 HOH HOH A . F 4 HOH 116 416 109 HOH HOH A . F 4 HOH 117 417 53 HOH HOH A . F 4 HOH 118 418 157 HOH HOH A . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0425 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-3000 ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? MOLREP ? ? ? . 4 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 95.369 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 9BAR _cell.details ? _cell.formula_units_Z ? _cell.length_a 32.199 _cell.length_a_esd ? _cell.length_b 37.725 _cell.length_b_esd ? _cell.length_c 38.809 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 2 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 9BAR _symmetry.cell_setting ? _symmetry.Int_Tables_number 4 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 1 21 1' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 9BAR _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 1.72 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 28.39 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '2.5 M ammonium sulfate, 0.1 M sodium acetate trihydrate, pH 4.6' _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 298 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'RAYONIX MX300-HS' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2021-12-09 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.0000 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'APS BEAMLINE 22-BM' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.0000 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 22-BM _diffrn_source.pdbx_synchrotron_site APS # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 9BAR _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.75 _reflns.d_resolution_low 40.00 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 9078 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 95 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 3.4 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 18.7 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.108 _reflns.pdbx_Rpim_I_all 0.058 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.999 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs 0.091 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value 0.091 _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 1.75 _reflns_shell.d_res_low 1.78 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 2.2 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 462 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all 0.478 _reflns_shell.pdbx_Rpim_I_all 0.259 _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.850 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.percent_possible_all ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.392 _reflns_shell.pdbx_Rsym_value 0.392 _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] -1.577 _refine.aniso_B[1][2] -0.000 _refine.aniso_B[1][3] -0.356 _refine.aniso_B[2][2] 0.642 _refine.aniso_B[2][3] 0.000 _refine.aniso_B[3][3] 0.985 _refine.B_iso_max ? _refine.B_iso_mean 17.190 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc 0.951 _refine.correlation_coeff_Fo_to_Fc_free 0.929 _refine.details 'Hydrogens have been added in their riding positions' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 9BAR _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.750 _refine.ls_d_res_low 32.078 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 9019 _refine.ls_number_reflns_R_free 415 _refine.ls_number_reflns_R_work 8604 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 95.037 _refine.ls_percent_reflns_R_free 4.601 _refine.ls_R_factor_all 0.184 _refine.ls_R_factor_obs ? _refine.ls_R_factor_R_free 0.2228 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1824 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'MASK BULK SOLVENT' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 'PDB entry 5ZH6' _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.153 _refine.pdbx_overall_ESU_R_Free 0.137 _refine.pdbx_solvent_vdw_probe_radii 1.200 _refine.pdbx_solvent_ion_probe_radii 0.800 _refine.pdbx_solvent_shrinkage_radii 0.800 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 5.781 _refine.overall_SU_ML 0.097 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 821 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 12 _refine_hist.number_atoms_solvent 118 _refine_hist.number_atoms_total 951 _refine_hist.d_res_high 1.750 _refine_hist.d_res_low 32.078 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.004 0.012 891 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 0.001 0.016 841 ? r_bond_other_d ? ? 'X-RAY DIFFRACTION' ? 1.264 1.807 1209 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 0.491 1.786 1963 ? r_angle_other_deg ? ? 'X-RAY DIFFRACTION' ? 5.672 5.000 123 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 7.820 5.000 1 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 11.034 10.000 166 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 16.319 10.000 39 ? r_dihedral_angle_6_deg ? ? 'X-RAY DIFFRACTION' ? 0.066 0.200 137 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.005 0.020 1037 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 0.002 0.020 187 ? r_gen_planes_other ? ? 'X-RAY DIFFRACTION' ? 0.227 0.200 229 ? r_nbd_refined ? ? 'X-RAY DIFFRACTION' ? 0.203 0.200 678 ? r_symmetry_nbd_other ? ? 'X-RAY DIFFRACTION' ? 0.180 0.200 446 ? r_nbtor_refined ? ? 'X-RAY DIFFRACTION' ? 0.074 0.200 395 ? r_symmetry_nbtor_other ? ? 'X-RAY DIFFRACTION' ? 0.162 0.200 75 ? r_xyhbond_nbd_refined ? ? 'X-RAY DIFFRACTION' ? 0.133 0.200 8 ? r_metal_ion_refined ? ? 'X-RAY DIFFRACTION' ? 0.227 0.200 7 ? r_symmetry_nbd_refined ? ? 'X-RAY DIFFRACTION' ? 0.218 0.200 46 ? r_nbd_other ? ? 'X-RAY DIFFRACTION' ? 0.232 0.200 20 ? r_symmetry_xyhbond_nbd_refined ? ? 'X-RAY DIFFRACTION' ? 0.949 1.397 453 ? r_mcbond_it ? ? 'X-RAY DIFFRACTION' ? 0.948 1.397 453 ? r_mcbond_other ? ? 'X-RAY DIFFRACTION' ? 1.570 2.499 571 ? r_mcangle_it ? ? 'X-RAY DIFFRACTION' ? 1.569 2.501 572 ? r_mcangle_other ? ? 'X-RAY DIFFRACTION' ? 1.385 1.644 438 ? r_scbond_it ? ? 'X-RAY DIFFRACTION' ? 1.379 1.579 431 ? r_scbond_other ? ? 'X-RAY DIFFRACTION' ? 2.353 2.934 632 ? r_scangle_it ? ? 'X-RAY DIFFRACTION' ? 2.355 2.812 621 ? r_scangle_other ? ? 'X-RAY DIFFRACTION' ? 5.081 18.672 1117 ? r_lrange_it ? ? 'X-RAY DIFFRACTION' ? 4.619 15.331 1075 ? r_lrange_other ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free _refine_ls_shell.R_factor_R_free 'X-RAY DIFFRACTION' 1.750 1.795 702 . 29 642 95.5840 . 0.283 . . 0.279 . . . . . 0.254 . 20 . 0.951 0.933 0.373 'X-RAY DIFFRACTION' 1.795 1.844 670 . 21 626 96.5672 . 0.228 . . 0.229 . . . . . 0.207 . 20 . 0.967 0.965 0.180 'X-RAY DIFFRACTION' 1.844 1.898 660 . 32 624 99.3939 . 0.218 . . 0.212 . . . . . 0.186 . 20 . 0.971 0.936 0.318 'X-RAY DIFFRACTION' 1.898 1.956 625 . 35 585 99.2000 . 0.212 . . 0.209 . . . . . 0.182 . 20 . 0.967 0.954 0.262 'X-RAY DIFFRACTION' 1.956 2.020 630 . 32 595 99.5238 . 0.170 . . 0.170 . . . . . 0.155 . 20 . 0.980 0.980 0.185 'X-RAY DIFFRACTION' 2.020 2.090 594 . 36 546 97.9798 . 0.186 . . 0.181 . . . . . 0.160 . 20 . 0.980 0.961 0.260 'X-RAY DIFFRACTION' 2.090 2.169 585 . 23 554 98.6325 . 0.166 . . 0.164 . . . . . 0.151 . 20 . 0.984 0.970 0.197 'X-RAY DIFFRACTION' 2.169 2.257 567 . 31 524 97.8836 . 0.167 . . 0.163 . . . . . 0.149 . 20 . 0.982 0.966 0.225 'X-RAY DIFFRACTION' 2.257 2.357 531 . 24 492 97.1751 . 0.175 . . 0.170 . . . . . 0.156 . 20 . 0.982 0.955 0.283 'X-RAY DIFFRACTION' 2.357 2.471 513 . 27 455 93.9571 . 0.161 . . 0.162 . . . . . 0.154 . 20 . 0.984 0.981 0.154 'X-RAY DIFFRACTION' 2.471 2.604 479 . 17 421 91.4405 . 0.180 . . 0.177 . . . . . 0.172 . 20 . 0.980 0.961 0.260 'X-RAY DIFFRACTION' 2.604 2.761 464 . 18 428 96.1207 . 0.182 . . 0.181 . . . . . 0.174 . 20 . 0.980 0.975 0.192 'X-RAY DIFFRACTION' 2.761 2.950 436 . 24 384 93.5780 . 0.181 . . 0.179 . . . . . 0.175 . 20 . 0.979 0.979 0.205 'X-RAY DIFFRACTION' 2.950 3.184 416 . 18 364 91.8269 . 0.171 . . 0.169 . . . . . 0.170 . 20 . 0.982 0.968 0.215 'X-RAY DIFFRACTION' 3.184 3.484 368 . 13 310 87.7717 . 0.192 . . 0.186 . . . . . 0.195 . 20 . 0.979 0.925 0.341 'X-RAY DIFFRACTION' 3.484 3.890 347 . 9 280 83.2853 . 0.163 . . 0.164 . . . . . 0.180 . 20 . 0.982 0.990 0.139 'X-RAY DIFFRACTION' 3.890 4.481 307 . 5 242 80.4560 . 0.161 . . 0.159 . . . . . 0.189 . 20 . 0.984 0.967 0.256 'X-RAY DIFFRACTION' 4.481 5.461 262 . 6 222 87.0229 . 0.187 . . 0.191 . . . . . 0.219 . 20 . 0.980 0.996 0.070 'X-RAY DIFFRACTION' 5.461 7.614 203 . 9 190 98.0296 . 0.233 . . 0.231 . . . . . 0.252 . 20 . 0.970 0.961 0.270 'X-RAY DIFFRACTION' 7.614 32.078 127 . 6 118 97.6378 . 0.178 . . 0.179 . . . . . 0.210 . 20 . 0.979 0.985 0.174 # _struct.entry_id 9BAR _struct.title 'Crystal structure of the alpha parvalbumin from thornback ray' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 9BAR _struct_keywords.text 'parvalbumin, thornback ray, allergy, ALLERGEN' _struct_keywords.pdbx_keywords ALLERGEN # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 3 ? E N N 3 ? F N N 4 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code PRVA_RAJCL _struct_ref.pdbx_db_accession P02630 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;SSKITSILNPADITKALEQCAAGFHHTAFFKASGLSKKSDAELAEIFNVLDGDQSGYIEVEELKNFLKCFSDGARVLNDK ETSNFLAAGDSDGDHKIGVDEFKSMAKMT ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 9BAR _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 16 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 124 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P02630 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 109 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 109 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 9BAR MET A 1 ? UNP P02630 ? ? 'expression tag' -14 1 1 9BAR GLY A 2 ? UNP P02630 ? ? 'expression tag' -13 2 1 9BAR HIS A 3 ? UNP P02630 ? ? 'expression tag' -12 3 1 9BAR HIS A 4 ? UNP P02630 ? ? 'expression tag' -11 4 1 9BAR HIS A 5 ? UNP P02630 ? ? 'expression tag' -10 5 1 9BAR HIS A 6 ? UNP P02630 ? ? 'expression tag' -9 6 1 9BAR HIS A 7 ? UNP P02630 ? ? 'expression tag' -8 7 1 9BAR HIS A 8 ? UNP P02630 ? ? 'expression tag' -7 8 1 9BAR GLU A 9 ? UNP P02630 ? ? 'expression tag' -6 9 1 9BAR ASN A 10 ? UNP P02630 ? ? 'expression tag' -5 10 1 9BAR LEU A 11 ? UNP P02630 ? ? 'expression tag' -4 11 1 9BAR TYR A 12 ? UNP P02630 ? ? 'expression tag' -3 12 1 9BAR PHE A 13 ? UNP P02630 ? ? 'expression tag' -2 13 1 9BAR GLN A 14 ? UNP P02630 ? ? 'expression tag' -1 14 1 9BAR GLY A 15 ? UNP P02630 ? ? 'expression tag' 0 15 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 320 ? 1 MORE -27 ? 1 'SSA (A^2)' 5880 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 SER A 17 ? LEU A 23 ? SER A 2 LEU A 8 1 ? 7 HELX_P HELX_P2 AA2 ASN A 24 ? GLN A 34 ? ASN A 9 GLN A 19 1 ? 11 HELX_P HELX_P3 AA3 HIS A 40 ? GLY A 49 ? HIS A 25 GLY A 34 1 ? 10 HELX_P HELX_P4 AA4 LEU A 50 ? LYS A 53 ? LEU A 35 LYS A 38 5 ? 4 HELX_P HELX_P5 AA5 SER A 54 ? ASP A 66 ? SER A 39 ASP A 51 1 ? 13 HELX_P HELX_P6 AA6 GLU A 74 ? LYS A 79 ? GLU A 59 LYS A 64 1 ? 6 HELX_P HELX_P7 AA7 ASN A 80 ? PHE A 85 ? ASN A 65 PHE A 70 5 ? 6 HELX_P HELX_P8 AA8 ASN A 93 ? ASP A 105 ? ASN A 78 ASP A 90 1 ? 13 HELX_P HELX_P9 AA9 GLY A 113 ? THR A 124 ? GLY A 98 THR A 109 1 ? 12 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A ASP 66 OD1 ? ? ? 1_555 B CA . CA ? ? A ASP 51 A CA 201 1_555 ? ? ? ? ? ? ? 2.276 ? ? metalc2 metalc ? ? A ASP 68 OD1 ? ? ? 1_555 B CA . CA ? ? A ASP 53 A CA 201 1_555 ? ? ? ? ? ? ? 2.312 ? ? metalc3 metalc ? ? A SER 70 OG ? ? ? 1_555 B CA . CA ? ? A SER 55 A CA 201 1_555 ? ? ? ? ? ? ? 2.444 ? ? metalc4 metalc ? ? A TYR 72 O ? ? ? 1_555 B CA . CA ? ? A TYR 57 A CA 201 1_555 ? ? ? ? ? ? ? 2.317 ? ? metalc5 metalc ? ? A GLU 74 OE1 ? ? ? 1_555 B CA . CA ? ? A GLU 59 A CA 201 1_555 ? ? ? ? ? ? ? 2.308 ? ? metalc6 metalc ? ? A GLU 77 OE1 ? ? ? 1_555 B CA . CA ? ? A GLU 62 A CA 201 1_555 ? ? ? ? ? ? ? 2.435 ? ? metalc7 metalc ? ? A GLU 77 OE2 ? ? ? 1_555 B CA . CA ? ? A GLU 62 A CA 201 1_555 ? ? ? ? ? ? ? 2.564 ? ? metalc8 metalc ? ? A ASP 105 OD1 ? ? ? 1_555 C CA . CA ? ? A ASP 90 A CA 202 1_555 ? ? ? ? ? ? ? 2.301 ? ? metalc9 metalc ? ? A ASP 107 OD1 ? ? ? 1_555 C CA . CA ? ? A ASP 92 A CA 202 1_555 ? ? ? ? ? ? ? 2.303 ? ? metalc10 metalc ? ? A ASP 109 OD1 ? ? ? 1_555 C CA . CA ? ? A ASP 94 A CA 202 1_555 ? ? ? ? ? ? ? 2.183 ? ? metalc11 metalc ? ? A LYS 111 O ? ? ? 1_555 C CA . CA ? ? A LYS 96 A CA 202 1_555 ? ? ? ? ? ? ? 2.386 ? ? metalc12 metalc ? ? A GLU 116 OE1 ? ? ? 1_555 C CA . CA ? ? A GLU 101 A CA 202 1_555 ? ? ? ? ? ? ? 2.457 ? ? metalc13 metalc ? ? A GLU 116 OE2 ? ? ? 1_555 C CA . CA ? ? A GLU 101 A CA 202 1_555 ? ? ? ? ? ? ? 2.608 ? ? metalc14 metalc ? ? C CA . CA ? ? ? 1_555 F HOH . O ? ? A CA 202 A HOH 324 1_555 ? ? ? ? ? ? ? 2.542 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OD1 ? A ASP 66 ? A ASP 51 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 OD1 ? A ASP 68 ? A ASP 53 ? 1_555 81.4 ? 2 OD1 ? A ASP 66 ? A ASP 51 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 OG ? A SER 70 ? A SER 55 ? 1_555 85.5 ? 3 OD1 ? A ASP 68 ? A ASP 53 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 OG ? A SER 70 ? A SER 55 ? 1_555 83.7 ? 4 OD1 ? A ASP 66 ? A ASP 51 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 O ? A TYR 72 ? A TYR 57 ? 1_555 80.4 ? 5 OD1 ? A ASP 68 ? A ASP 53 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 O ? A TYR 72 ? A TYR 57 ? 1_555 152.7 ? 6 OG ? A SER 70 ? A SER 55 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 O ? A TYR 72 ? A TYR 57 ? 1_555 74.6 ? 7 OD1 ? A ASP 66 ? A ASP 51 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 OE1 ? A GLU 74 ? A GLU 59 ? 1_555 165.2 ? 8 OD1 ? A ASP 68 ? A ASP 53 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 OE1 ? A GLU 74 ? A GLU 59 ? 1_555 105.1 ? 9 OG ? A SER 70 ? A SER 55 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 OE1 ? A GLU 74 ? A GLU 59 ? 1_555 82.1 ? 10 O ? A TYR 72 ? A TYR 57 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 OE1 ? A GLU 74 ? A GLU 59 ? 1_555 88.5 ? 11 OD1 ? A ASP 66 ? A ASP 51 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 OE1 ? A GLU 77 ? A GLU 62 ? 1_555 111.8 ? 12 OD1 ? A ASP 68 ? A ASP 53 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 OE1 ? A GLU 77 ? A GLU 62 ? 1_555 127.2 ? 13 OG ? A SER 70 ? A SER 55 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 OE1 ? A GLU 77 ? A GLU 62 ? 1_555 145.3 ? 14 O ? A TYR 72 ? A TYR 57 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 OE1 ? A GLU 77 ? A GLU 62 ? 1_555 78.8 ? 15 OE1 ? A GLU 74 ? A GLU 59 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 OE1 ? A GLU 77 ? A GLU 62 ? 1_555 75.2 ? 16 OD1 ? A ASP 66 ? A ASP 51 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 OE2 ? A GLU 77 ? A GLU 62 ? 1_555 101.8 ? 17 OD1 ? A ASP 68 ? A ASP 53 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 OE2 ? A GLU 77 ? A GLU 62 ? 1_555 75.7 ? 18 OG ? A SER 70 ? A SER 55 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 OE2 ? A GLU 77 ? A GLU 62 ? 1_555 156.8 ? 19 O ? A TYR 72 ? A TYR 57 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 OE2 ? A GLU 77 ? A GLU 62 ? 1_555 128.1 ? 20 OE1 ? A GLU 74 ? A GLU 59 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 OE2 ? A GLU 77 ? A GLU 62 ? 1_555 92.8 ? 21 OE1 ? A GLU 77 ? A GLU 62 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 OE2 ? A GLU 77 ? A GLU 62 ? 1_555 51.8 ? 22 OD1 ? A ASP 105 ? A ASP 90 ? 1_555 CA ? C CA . ? A CA 202 ? 1_555 OD1 ? A ASP 107 ? A ASP 92 ? 1_555 84.3 ? 23 OD1 ? A ASP 105 ? A ASP 90 ? 1_555 CA ? C CA . ? A CA 202 ? 1_555 OD1 ? A ASP 109 ? A ASP 94 ? 1_555 84.1 ? 24 OD1 ? A ASP 107 ? A ASP 92 ? 1_555 CA ? C CA . ? A CA 202 ? 1_555 OD1 ? A ASP 109 ? A ASP 94 ? 1_555 78.1 ? 25 OD1 ? A ASP 105 ? A ASP 90 ? 1_555 CA ? C CA . ? A CA 202 ? 1_555 O ? A LYS 111 ? A LYS 96 ? 1_555 86.1 ? 26 OD1 ? A ASP 107 ? A ASP 92 ? 1_555 CA ? C CA . ? A CA 202 ? 1_555 O ? A LYS 111 ? A LYS 96 ? 1_555 161.2 ? 27 OD1 ? A ASP 109 ? A ASP 94 ? 1_555 CA ? C CA . ? A CA 202 ? 1_555 O ? A LYS 111 ? A LYS 96 ? 1_555 84.9 ? 28 OD1 ? A ASP 105 ? A ASP 90 ? 1_555 CA ? C CA . ? A CA 202 ? 1_555 OE1 ? A GLU 116 ? A GLU 101 ? 1_555 113.7 ? 29 OD1 ? A ASP 107 ? A ASP 92 ? 1_555 CA ? C CA . ? A CA 202 ? 1_555 OE1 ? A GLU 116 ? A GLU 101 ? 1_555 116.7 ? 30 OD1 ? A ASP 109 ? A ASP 94 ? 1_555 CA ? C CA . ? A CA 202 ? 1_555 OE1 ? A GLU 116 ? A GLU 101 ? 1_555 156.9 ? 31 O ? A LYS 111 ? A LYS 96 ? 1_555 CA ? C CA . ? A CA 202 ? 1_555 OE1 ? A GLU 116 ? A GLU 101 ? 1_555 82.0 ? 32 OD1 ? A ASP 105 ? A ASP 90 ? 1_555 CA ? C CA . ? A CA 202 ? 1_555 OE2 ? A GLU 116 ? A GLU 101 ? 1_555 83.4 ? 33 OD1 ? A ASP 107 ? A ASP 92 ? 1_555 CA ? C CA . ? A CA 202 ? 1_555 OE2 ? A GLU 116 ? A GLU 101 ? 1_555 73.5 ? 34 OD1 ? A ASP 109 ? A ASP 94 ? 1_555 CA ? C CA . ? A CA 202 ? 1_555 OE2 ? A GLU 116 ? A GLU 101 ? 1_555 149.9 ? 35 O ? A LYS 111 ? A LYS 96 ? 1_555 CA ? C CA . ? A CA 202 ? 1_555 OE2 ? A GLU 116 ? A GLU 101 ? 1_555 121.4 ? 36 OE1 ? A GLU 116 ? A GLU 101 ? 1_555 CA ? C CA . ? A CA 202 ? 1_555 OE2 ? A GLU 116 ? A GLU 101 ? 1_555 51.5 ? 37 OD1 ? A ASP 105 ? A ASP 90 ? 1_555 CA ? C CA . ? A CA 202 ? 1_555 O ? F HOH . ? A HOH 324 ? 1_555 158.8 ? 38 OD1 ? A ASP 107 ? A ASP 92 ? 1_555 CA ? C CA . ? A CA 202 ? 1_555 O ? F HOH . ? A HOH 324 ? 1_555 96.7 ? 39 OD1 ? A ASP 109 ? A ASP 94 ? 1_555 CA ? C CA . ? A CA 202 ? 1_555 O ? F HOH . ? A HOH 324 ? 1_555 75.4 ? 40 O ? A LYS 111 ? A LYS 96 ? 1_555 CA ? C CA . ? A CA 202 ? 1_555 O ? F HOH . ? A HOH 324 ? 1_555 86.5 ? 41 OE1 ? A GLU 116 ? A GLU 101 ? 1_555 CA ? C CA . ? A CA 202 ? 1_555 O ? F HOH . ? A HOH 324 ? 1_555 84.9 ? 42 OE2 ? A GLU 116 ? A GLU 101 ? 1_555 CA ? C CA . ? A CA 202 ? 1_555 O ? F HOH . ? A HOH 324 ? 1_555 117.3 ? # _pdbx_entry_details.entry_id 9BAR _pdbx_entry_details.has_ligand_of_interest N _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_protein_modification N # _pdbx_refine_tls.id 1 _pdbx_refine_tls.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls.details ? _pdbx_refine_tls.method refined _pdbx_refine_tls.origin_x 0.4646 _pdbx_refine_tls.origin_y -0.6658 _pdbx_refine_tls.origin_z 10.4889 _pdbx_refine_tls.T[1][1] 0.0186 _pdbx_refine_tls.T[1][1]_esd ? _pdbx_refine_tls.T[1][2] 0.0105 _pdbx_refine_tls.T[1][2]_esd ? _pdbx_refine_tls.T[1][3] 0.0077 _pdbx_refine_tls.T[1][3]_esd ? _pdbx_refine_tls.T[2][2] 0.0137 _pdbx_refine_tls.T[2][2]_esd ? _pdbx_refine_tls.T[2][3] -0.0030 _pdbx_refine_tls.T[2][3]_esd ? _pdbx_refine_tls.T[3][3] 0.0140 _pdbx_refine_tls.T[3][3]_esd ? _pdbx_refine_tls.L[1][1] 0.6280 _pdbx_refine_tls.L[1][1]_esd ? _pdbx_refine_tls.L[1][2] 0.2149 _pdbx_refine_tls.L[1][2]_esd ? _pdbx_refine_tls.L[1][3] 0.1971 _pdbx_refine_tls.L[1][3]_esd ? _pdbx_refine_tls.L[2][2] 0.9503 _pdbx_refine_tls.L[2][2]_esd ? _pdbx_refine_tls.L[2][3] -0.7127 _pdbx_refine_tls.L[2][3]_esd ? _pdbx_refine_tls.L[3][3] 1.0689 _pdbx_refine_tls.L[3][3]_esd ? _pdbx_refine_tls.S[1][1] 0.0230 _pdbx_refine_tls.S[1][1]_esd ? _pdbx_refine_tls.S[1][2] 0.0726 _pdbx_refine_tls.S[1][2]_esd ? _pdbx_refine_tls.S[1][3] -0.0417 _pdbx_refine_tls.S[1][3]_esd ? _pdbx_refine_tls.S[2][1] 0.0111 _pdbx_refine_tls.S[2][1]_esd ? _pdbx_refine_tls.S[2][2] -0.0122 _pdbx_refine_tls.S[2][2]_esd ? _pdbx_refine_tls.S[2][3] 0.0282 _pdbx_refine_tls.S[2][3]_esd ? _pdbx_refine_tls.S[3][1] 0.0084 _pdbx_refine_tls.S[3][1]_esd ? _pdbx_refine_tls.S[3][2] 0.0536 _pdbx_refine_tls.S[3][2]_esd ? _pdbx_refine_tls.S[3][3] -0.0108 _pdbx_refine_tls.S[3][3]_esd ? # _pdbx_refine_tls_group.id 1 _pdbx_refine_tls_group.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls_group.refine_tls_id 1 _pdbx_refine_tls_group.beg_label_asym_id ? _pdbx_refine_tls_group.beg_label_seq_id ? _pdbx_refine_tls_group.beg_auth_asym_id A _pdbx_refine_tls_group.beg_auth_seq_id 2 _pdbx_refine_tls_group.beg_PDB_ins_code ? _pdbx_refine_tls_group.end_label_asym_id ? _pdbx_refine_tls_group.end_label_seq_id ? _pdbx_refine_tls_group.end_auth_asym_id A _pdbx_refine_tls_group.end_auth_seq_id 109 _pdbx_refine_tls_group.end_PDB_ins_code ? _pdbx_refine_tls_group.selection ALL _pdbx_refine_tls_group.selection_details ? # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET -14 ? A MET 1 2 1 Y 1 A GLY -13 ? A GLY 2 3 1 Y 1 A HIS -12 ? A HIS 3 4 1 Y 1 A HIS -11 ? A HIS 4 5 1 Y 1 A HIS -10 ? A HIS 5 6 1 Y 1 A HIS -9 ? A HIS 6 7 1 Y 1 A HIS -8 ? A HIS 7 8 1 Y 1 A HIS -7 ? A HIS 8 9 1 Y 1 A GLU -6 ? A GLU 9 10 1 Y 1 A ASN -5 ? A ASN 10 11 1 Y 1 A LEU -4 ? A LEU 11 12 1 Y 1 A TYR -3 ? A TYR 12 13 1 Y 1 A PHE -2 ? A PHE 13 14 1 Y 1 A GLN -1 ? A GLN 14 15 1 Y 1 A GLY 0 ? A GLY 15 16 1 Y 1 A SER 1 ? A SER 16 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CA CA CA N N 74 CYS N N N N 75 CYS CA C N R 76 CYS C C N N 77 CYS O O N N 78 CYS CB C N N 79 CYS SG S N N 80 CYS OXT O N N 81 CYS H H N N 82 CYS H2 H N N 83 CYS HA H N N 84 CYS HB2 H N N 85 CYS HB3 H N N 86 CYS HG H N N 87 CYS HXT H N N 88 GLN N N N N 89 GLN CA C N S 90 GLN C C N N 91 GLN O O N N 92 GLN CB C N N 93 GLN CG C N N 94 GLN CD C N N 95 GLN OE1 O N N 96 GLN NE2 N N N 97 GLN OXT O N N 98 GLN H H N N 99 GLN H2 H N N 100 GLN HA H N N 101 GLN HB2 H N N 102 GLN HB3 H N N 103 GLN HG2 H N N 104 GLN HG3 H N N 105 GLN HE21 H N N 106 GLN HE22 H N N 107 GLN HXT H N N 108 GLU N N N N 109 GLU CA C N S 110 GLU C C N N 111 GLU O O N N 112 GLU CB C N N 113 GLU CG C N N 114 GLU CD C N N 115 GLU OE1 O N N 116 GLU OE2 O N N 117 GLU OXT O N N 118 GLU H H N N 119 GLU H2 H N N 120 GLU HA H N N 121 GLU HB2 H N N 122 GLU HB3 H N N 123 GLU HG2 H N N 124 GLU HG3 H N N 125 GLU HE2 H N N 126 GLU HXT H N N 127 GLY N N N N 128 GLY CA C N N 129 GLY C C N N 130 GLY O O N N 131 GLY OXT O N N 132 GLY H H N N 133 GLY H2 H N N 134 GLY HA2 H N N 135 GLY HA3 H N N 136 GLY HXT H N N 137 HIS N N N N 138 HIS CA C N S 139 HIS C C N N 140 HIS O O N N 141 HIS CB C N N 142 HIS CG C Y N 143 HIS ND1 N Y N 144 HIS CD2 C Y N 145 HIS CE1 C Y N 146 HIS NE2 N Y N 147 HIS OXT O N N 148 HIS H H N N 149 HIS H2 H N N 150 HIS HA H N N 151 HIS HB2 H N N 152 HIS HB3 H N N 153 HIS HD1 H N N 154 HIS HD2 H N N 155 HIS HE1 H N N 156 HIS HE2 H N N 157 HIS HXT H N N 158 HOH O O N N 159 HOH H1 H N N 160 HOH H2 H N N 161 ILE N N N N 162 ILE CA C N S 163 ILE C C N N 164 ILE O O N N 165 ILE CB C N S 166 ILE CG1 C N N 167 ILE CG2 C N N 168 ILE CD1 C N N 169 ILE OXT O N N 170 ILE H H N N 171 ILE H2 H N N 172 ILE HA H N N 173 ILE HB H N N 174 ILE HG12 H N N 175 ILE HG13 H N N 176 ILE HG21 H N N 177 ILE HG22 H N N 178 ILE HG23 H N N 179 ILE HD11 H N N 180 ILE HD12 H N N 181 ILE HD13 H N N 182 ILE HXT H N N 183 LEU N N N N 184 LEU CA C N S 185 LEU C C N N 186 LEU O O N N 187 LEU CB C N N 188 LEU CG C N N 189 LEU CD1 C N N 190 LEU CD2 C N N 191 LEU OXT O N N 192 LEU H H N N 193 LEU H2 H N N 194 LEU HA H N N 195 LEU HB2 H N N 196 LEU HB3 H N N 197 LEU HG H N N 198 LEU HD11 H N N 199 LEU HD12 H N N 200 LEU HD13 H N N 201 LEU HD21 H N N 202 LEU HD22 H N N 203 LEU HD23 H N N 204 LEU HXT H N N 205 LYS N N N N 206 LYS CA C N S 207 LYS C C N N 208 LYS O O N N 209 LYS CB C N N 210 LYS CG C N N 211 LYS CD C N N 212 LYS CE C N N 213 LYS NZ N N N 214 LYS OXT O N N 215 LYS H H N N 216 LYS H2 H N N 217 LYS HA H N N 218 LYS HB2 H N N 219 LYS HB3 H N N 220 LYS HG2 H N N 221 LYS HG3 H N N 222 LYS HD2 H N N 223 LYS HD3 H N N 224 LYS HE2 H N N 225 LYS HE3 H N N 226 LYS HZ1 H N N 227 LYS HZ2 H N N 228 LYS HZ3 H N N 229 LYS HXT H N N 230 MET N N N N 231 MET CA C N S 232 MET C C N N 233 MET O O N N 234 MET CB C N N 235 MET CG C N N 236 MET SD S N N 237 MET CE C N N 238 MET OXT O N N 239 MET H H N N 240 MET H2 H N N 241 MET HA H N N 242 MET HB2 H N N 243 MET HB3 H N N 244 MET HG2 H N N 245 MET HG3 H N N 246 MET HE1 H N N 247 MET HE2 H N N 248 MET HE3 H N N 249 MET HXT H N N 250 PHE N N N N 251 PHE CA C N S 252 PHE C C N N 253 PHE O O N N 254 PHE CB C N N 255 PHE CG C Y N 256 PHE CD1 C Y N 257 PHE CD2 C Y N 258 PHE CE1 C Y N 259 PHE CE2 C Y N 260 PHE CZ C Y N 261 PHE OXT O N N 262 PHE H H N N 263 PHE H2 H N N 264 PHE HA H N N 265 PHE HB2 H N N 266 PHE HB3 H N N 267 PHE HD1 H N N 268 PHE HD2 H N N 269 PHE HE1 H N N 270 PHE HE2 H N N 271 PHE HZ H N N 272 PHE HXT H N N 273 PRO N N N N 274 PRO CA C N S 275 PRO C C N N 276 PRO O O N N 277 PRO CB C N N 278 PRO CG C N N 279 PRO CD C N N 280 PRO OXT O N N 281 PRO H H N N 282 PRO HA H N N 283 PRO HB2 H N N 284 PRO HB3 H N N 285 PRO HG2 H N N 286 PRO HG3 H N N 287 PRO HD2 H N N 288 PRO HD3 H N N 289 PRO HXT H N N 290 SER N N N N 291 SER CA C N S 292 SER C C N N 293 SER O O N N 294 SER CB C N N 295 SER OG O N N 296 SER OXT O N N 297 SER H H N N 298 SER H2 H N N 299 SER HA H N N 300 SER HB2 H N N 301 SER HB3 H N N 302 SER HG H N N 303 SER HXT H N N 304 SO4 S S N N 305 SO4 O1 O N N 306 SO4 O2 O N N 307 SO4 O3 O N N 308 SO4 O4 O N N 309 THR N N N N 310 THR CA C N S 311 THR C C N N 312 THR O O N N 313 THR CB C N R 314 THR OG1 O N N 315 THR CG2 C N N 316 THR OXT O N N 317 THR H H N N 318 THR H2 H N N 319 THR HA H N N 320 THR HB H N N 321 THR HG1 H N N 322 THR HG21 H N N 323 THR HG22 H N N 324 THR HG23 H N N 325 THR HXT H N N 326 TYR N N N N 327 TYR CA C N S 328 TYR C C N N 329 TYR O O N N 330 TYR CB C N N 331 TYR CG C Y N 332 TYR CD1 C Y N 333 TYR CD2 C Y N 334 TYR CE1 C Y N 335 TYR CE2 C Y N 336 TYR CZ C Y N 337 TYR OH O N N 338 TYR OXT O N N 339 TYR H H N N 340 TYR H2 H N N 341 TYR HA H N N 342 TYR HB2 H N N 343 TYR HB3 H N N 344 TYR HD1 H N N 345 TYR HD2 H N N 346 TYR HE1 H N N 347 TYR HE2 H N N 348 TYR HH H N N 349 TYR HXT H N N 350 VAL N N N N 351 VAL CA C N S 352 VAL C C N N 353 VAL O O N N 354 VAL CB C N N 355 VAL CG1 C N N 356 VAL CG2 C N N 357 VAL OXT O N N 358 VAL H H N N 359 VAL H2 H N N 360 VAL HA H N N 361 VAL HB H N N 362 VAL HG11 H N N 363 VAL HG12 H N N 364 VAL HG13 H N N 365 VAL HG21 H N N 366 VAL HG22 H N N 367 VAL HG23 H N N 368 VAL HXT H N N 369 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MET N CA sing N N 218 MET N H sing N N 219 MET N H2 sing N N 220 MET CA C sing N N 221 MET CA CB sing N N 222 MET CA HA sing N N 223 MET C O doub N N 224 MET C OXT sing N N 225 MET CB CG sing N N 226 MET CB HB2 sing N N 227 MET CB HB3 sing N N 228 MET CG SD sing N N 229 MET CG HG2 sing N N 230 MET CG HG3 sing N N 231 MET SD CE sing N N 232 MET CE HE1 sing N N 233 MET CE HE2 sing N N 234 MET CE HE3 sing N N 235 MET OXT HXT sing N N 236 PHE N CA sing N N 237 PHE N H sing N N 238 PHE N H2 sing N N 239 PHE CA C sing N N 240 PHE CA CB sing N N 241 PHE CA HA sing N N 242 PHE C O doub N N 243 PHE C OXT sing N N 244 PHE CB CG sing N N 245 PHE CB HB2 sing N N 246 PHE CB HB3 sing N N 247 PHE CG CD1 doub Y N 248 PHE CG CD2 sing Y N 249 PHE CD1 CE1 sing Y N 250 PHE CD1 HD1 sing N N 251 PHE CD2 CE2 doub Y N 252 PHE CD2 HD2 sing N N 253 PHE CE1 CZ doub Y N 254 PHE CE1 HE1 sing N N 255 PHE CE2 CZ sing Y N 256 PHE CE2 HE2 sing N N 257 PHE CZ HZ sing N N 258 PHE OXT HXT sing N N 259 PRO N CA sing N N 260 PRO N CD sing N N 261 PRO N H sing N N 262 PRO CA C sing N N 263 PRO CA CB sing N N 264 PRO CA HA sing N N 265 PRO C O doub N N 266 PRO C OXT sing N N 267 PRO CB CG sing N N 268 PRO CB HB2 sing N N 269 PRO CB HB3 sing N N 270 PRO CG CD sing N N 271 PRO CG HG2 sing N N 272 PRO CG HG3 sing N N 273 PRO CD HD2 sing N N 274 PRO CD HD3 sing N N 275 PRO OXT HXT sing N N 276 SER N CA sing N N 277 SER N H sing N N 278 SER N H2 sing N N 279 SER CA C sing N N 280 SER CA CB sing N N 281 SER CA HA sing N N 282 SER C O doub N N 283 SER C OXT sing N N 284 SER CB OG sing N N 285 SER CB HB2 sing N N 286 SER CB HB3 sing N N 287 SER OG HG sing N N 288 SER OXT HXT sing N N 289 SO4 S O1 doub N N 290 SO4 S O2 doub N N 291 SO4 S O3 sing N N 292 SO4 S O4 sing N N 293 THR N CA sing N N 294 THR N H sing N N 295 THR N H2 sing N N 296 THR CA C sing N N 297 THR CA CB sing N N 298 THR CA HA sing N N 299 THR C O doub N N 300 THR C OXT sing N N 301 THR CB OG1 sing N N 302 THR CB CG2 sing N N 303 THR CB HB sing N N 304 THR OG1 HG1 sing N N 305 THR CG2 HG21 sing N N 306 THR CG2 HG22 sing N N 307 THR CG2 HG23 sing N N 308 THR OXT HXT sing N N 309 TYR N CA sing N N 310 TYR N H sing N N 311 TYR N H2 sing N N 312 TYR CA C sing N N 313 TYR CA CB sing N N 314 TYR CA HA sing N N 315 TYR C O doub N N 316 TYR C OXT sing N N 317 TYR CB CG sing N N 318 TYR CB HB2 sing N N 319 TYR CB HB3 sing N N 320 TYR CG CD1 doub Y N 321 TYR CG CD2 sing Y N 322 TYR CD1 CE1 sing Y N 323 TYR CD1 HD1 sing N N 324 TYR CD2 CE2 doub Y N 325 TYR CD2 HD2 sing N N 326 TYR CE1 CZ doub Y N 327 TYR CE1 HE1 sing N N 328 TYR CE2 CZ sing Y N 329 TYR CE2 HE2 sing N N 330 TYR CZ OH sing N N 331 TYR OH HH sing N N 332 TYR OXT HXT sing N N 333 VAL N CA sing N N 334 VAL N H sing N N 335 VAL N H2 sing N N 336 VAL CA C sing N N 337 VAL CA CB sing N N 338 VAL CA HA sing N N 339 VAL C O doub N N 340 VAL C OXT sing N N 341 VAL CB CG1 sing N N 342 VAL CB CG2 sing N N 343 VAL CB HB sing N N 344 VAL CG1 HG11 sing N N 345 VAL CG1 HG12 sing N N 346 VAL CG1 HG13 sing N N 347 VAL CG2 HG21 sing N N 348 VAL CG2 HG22 sing N N 349 VAL CG2 HG23 sing N N 350 VAL OXT HXT sing N N 351 # _pdbx_audit_support.funding_organization 'Not funded' _pdbx_audit_support.country ? _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 5ZH6 _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 9BAR _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 0.031057 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.002919 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.026508 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.025881 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.pdbx_scat_Z _atom_type.pdbx_N_electrons _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c C 6 6 2.3103 20.8439 1.0201 10.2075 1.5888 0.5687 0.8651 51.6512 0.2156 CA 20 20 8.6266 10.4421 7.3873 0.6599 1.5899 85.7484 1.0211 178.4370 1.3751 H 1 1 0.4930 10.5109 0.3229 26.1257 0.1402 3.1424 0.0408 57.7997 0.0030 N 7 7 12.2220 0.0057 3.1346 9.8933 2.0141 28.9975 1.1672 0.5826 -11.5379 O 8 8 3.0487 13.2771 2.2870 5.7011 1.5464 0.3239 0.8671 32.9089 0.2508 S 16 16 6.9054 1.4679 5.2035 22.2151 1.4379 0.2536 1.5863 56.1720 0.8669 # loop_ # loop_ #