data_9BB8 # _entry.id 9BB8 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.403 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 9BB8 pdb_00009bb8 10.2210/pdb9bb8/pdb WWPDB D_1000283031 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date _pdbx_audit_revision_history.part_number 1 'Structure model' 1 0 2024-12-04 ? 2 'Structure model' 1 1 2025-05-21 ? # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_audit_revision_group.ordinal 1 _pdbx_audit_revision_group.revision_ordinal 2 _pdbx_audit_revision_group.data_content_type 'Structure model' _pdbx_audit_revision_group.group 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 9BB8 _pdbx_database_status.recvd_initial_deposition_date 2024-04-05 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_contact_author.id 2 _pdbx_contact_author.email chruszcz@msu.edu _pdbx_contact_author.name_first Maksymilian _pdbx_contact_author.name_last Chruszcz _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0001-7521-5485 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID ;O'Malley, A. ; 1 ? 'Chruszcz, M.' 2 ? # loop_ _citation.abstract _citation.abstract_id_CAS _citation.book_id_ISBN _citation.book_publisher _citation.book_publisher_city _citation.book_title _citation.coordinate_linkage _citation.country _citation.database_id_Medline _citation.details _citation.id _citation.journal_abbrev _citation.journal_id_ASTM _citation.journal_id_CSD _citation.journal_id_ISSN _citation.journal_full _citation.journal_issue _citation.journal_volume _citation.language _citation.page_first _citation.page_last _citation.title _citation.year _citation.database_id_CSD _citation.pdbx_database_id_DOI _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_patent _citation.unpublished_flag ? ? ? ? ? ? ? US ? ? primary 'Protein Sci.' PRCIEI 0795 1469-896X ? ? 33 ? e5226 e5226 'Comparative studies of seafood and reptile alpha- and beta-parvalbumins.' 2024 ? 10.1002/pro.5226 39584689 ? ? ? ? ? ? ? ? ? US ? ? 1 'Protein Sci.' PRCIEI 0795 1469-896X ? ? ? ? ? ? 'Crystal structure of the alpha parvalbumin from thornback ray' 2024 ? 10.1002/pro.522614 ? ? ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary ;O'Malley, A. ; 1 ? primary 'Ray, J.M.' 2 ? primary 'Kitlas, P.' 3 ? primary 'Ruethers, T.' 4 ? primary 'Kapingidza, A.B.' 5 ? primary 'Cierpicki, T.' 6 ? primary 'Lopata, A.' 7 0000-0002-2940-9235 primary 'Kowal, K.' 8 ? primary 'Chruszcz, M.' 9 0000-0001-7521-5485 1 ;O'Malley, A. ; 10 ? 1 'Kapingidza, A.B.' 11 ? 1 'Ruethers, T.' 12 ? 1 'Lopata, A.L.' 13 ? 1 'Chruszcz, M.' 14 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Parvalbumin alpha' 13815.606 1 ? ? ? ? 2 non-polymer syn 'CALCIUM ION' 40.078 2 ? ? ? ? 3 water nat water 18.015 18 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MGHHHHHHENLYFQGSMTDLLNAEDIKKAVGAFSATDSFDHKKFFQMVGLKKKSADDVKKVFHMLDKDKSGFIEEDELGF ILKGFSPDARDLSAKETKMLMAAGDKDGDGKIGVDEFSTLVAES ; _entity_poly.pdbx_seq_one_letter_code_can ;MGHHHHHHENLYFQGSMTDLLNAEDIKKAVGAFSATDSFDHKKFFQMVGLKKKSADDVKKVFHMLDKDKSGFIEEDELGF ILKGFSPDARDLSAKETKMLMAAGDKDGDGKIGVDEFSTLVAES ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'CALCIUM ION' CA 3 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLY n 1 3 HIS n 1 4 HIS n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 HIS n 1 9 GLU n 1 10 ASN n 1 11 LEU n 1 12 TYR n 1 13 PHE n 1 14 GLN n 1 15 GLY n 1 16 SER n 1 17 MET n 1 18 THR n 1 19 ASP n 1 20 LEU n 1 21 LEU n 1 22 ASN n 1 23 ALA n 1 24 GLU n 1 25 ASP n 1 26 ILE n 1 27 LYS n 1 28 LYS n 1 29 ALA n 1 30 VAL n 1 31 GLY n 1 32 ALA n 1 33 PHE n 1 34 SER n 1 35 ALA n 1 36 THR n 1 37 ASP n 1 38 SER n 1 39 PHE n 1 40 ASP n 1 41 HIS n 1 42 LYS n 1 43 LYS n 1 44 PHE n 1 45 PHE n 1 46 GLN n 1 47 MET n 1 48 VAL n 1 49 GLY n 1 50 LEU n 1 51 LYS n 1 52 LYS n 1 53 LYS n 1 54 SER n 1 55 ALA n 1 56 ASP n 1 57 ASP n 1 58 VAL n 1 59 LYS n 1 60 LYS n 1 61 VAL n 1 62 PHE n 1 63 HIS n 1 64 MET n 1 65 LEU n 1 66 ASP n 1 67 LYS n 1 68 ASP n 1 69 LYS n 1 70 SER n 1 71 GLY n 1 72 PHE n 1 73 ILE n 1 74 GLU n 1 75 GLU n 1 76 ASP n 1 77 GLU n 1 78 LEU n 1 79 GLY n 1 80 PHE n 1 81 ILE n 1 82 LEU n 1 83 LYS n 1 84 GLY n 1 85 PHE n 1 86 SER n 1 87 PRO n 1 88 ASP n 1 89 ALA n 1 90 ARG n 1 91 ASP n 1 92 LEU n 1 93 SER n 1 94 ALA n 1 95 LYS n 1 96 GLU n 1 97 THR n 1 98 LYS n 1 99 MET n 1 100 LEU n 1 101 MET n 1 102 ALA n 1 103 ALA n 1 104 GLY n 1 105 ASP n 1 106 LYS n 1 107 ASP n 1 108 GLY n 1 109 ASP n 1 110 GLY n 1 111 LYS n 1 112 ILE n 1 113 GLY n 1 114 VAL n 1 115 ASP n 1 116 GLU n 1 117 PHE n 1 118 SER n 1 119 THR n 1 120 LEU n 1 121 VAL n 1 122 ALA n 1 123 GLU n 1 124 SER n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 124 _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene PVALB _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CA non-polymer . 'CALCIUM ION' ? 'Ca 2' 40.078 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 -13 ? ? ? A . n A 1 2 GLY 2 -12 ? ? ? A . n A 1 3 HIS 3 -11 ? ? ? A . n A 1 4 HIS 4 -10 ? ? ? A . n A 1 5 HIS 5 -9 ? ? ? A . n A 1 6 HIS 6 -8 ? ? ? A . n A 1 7 HIS 7 -7 ? ? ? A . n A 1 8 HIS 8 -6 ? ? ? A . n A 1 9 GLU 9 -5 ? ? ? A . n A 1 10 ASN 10 -4 ? ? ? A . n A 1 11 LEU 11 -3 ? ? ? A . n A 1 12 TYR 12 -2 ? ? ? A . n A 1 13 PHE 13 -1 ? ? ? A . n A 1 14 GLN 14 0 ? ? ? A . n A 1 15 GLY 15 1 1 GLY GLY A . n A 1 16 SER 16 2 2 SER SER A . n A 1 17 MET 17 3 3 MET MET A . n A 1 18 THR 18 4 4 THR THR A . n A 1 19 ASP 19 5 5 ASP ASP A . n A 1 20 LEU 20 6 6 LEU LEU A . n A 1 21 LEU 21 7 7 LEU LEU A . n A 1 22 ASN 22 8 8 ASN ASN A . n A 1 23 ALA 23 9 9 ALA ALA A . n A 1 24 GLU 24 10 10 GLU GLU A . n A 1 25 ASP 25 11 11 ASP ASP A . n A 1 26 ILE 26 12 12 ILE ILE A . n A 1 27 LYS 27 13 13 LYS LYS A . n A 1 28 LYS 28 14 14 LYS LYS A . n A 1 29 ALA 29 15 15 ALA ALA A . n A 1 30 VAL 30 16 16 VAL VAL A . n A 1 31 GLY 31 17 17 GLY GLY A . n A 1 32 ALA 32 18 18 ALA ALA A . n A 1 33 PHE 33 19 19 PHE PHE A . n A 1 34 SER 34 20 20 SER SER A . n A 1 35 ALA 35 21 21 ALA ALA A . n A 1 36 THR 36 22 22 THR THR A . n A 1 37 ASP 37 23 23 ASP ASP A . n A 1 38 SER 38 24 24 SER SER A . n A 1 39 PHE 39 25 25 PHE PHE A . n A 1 40 ASP 40 26 26 ASP ASP A . n A 1 41 HIS 41 27 27 HIS HIS A . n A 1 42 LYS 42 28 28 LYS LYS A . n A 1 43 LYS 43 29 29 LYS LYS A . n A 1 44 PHE 44 30 30 PHE PHE A . n A 1 45 PHE 45 31 31 PHE PHE A . n A 1 46 GLN 46 32 32 GLN GLN A . n A 1 47 MET 47 33 33 MET MET A . n A 1 48 VAL 48 34 34 VAL VAL A . n A 1 49 GLY 49 35 35 GLY GLY A . n A 1 50 LEU 50 36 36 LEU LEU A . n A 1 51 LYS 51 37 37 LYS LYS A . n A 1 52 LYS 52 38 38 LYS LYS A . n A 1 53 LYS 53 39 39 LYS LYS A . n A 1 54 SER 54 40 40 SER SER A . n A 1 55 ALA 55 41 41 ALA ALA A . n A 1 56 ASP 56 42 42 ASP ASP A . n A 1 57 ASP 57 43 43 ASP ASP A . n A 1 58 VAL 58 44 44 VAL VAL A . n A 1 59 LYS 59 45 45 LYS LYS A . n A 1 60 LYS 60 46 46 LYS LYS A . n A 1 61 VAL 61 47 47 VAL VAL A . n A 1 62 PHE 62 48 48 PHE PHE A . n A 1 63 HIS 63 49 49 HIS HIS A . n A 1 64 MET 64 50 50 MET MET A . n A 1 65 LEU 65 51 51 LEU LEU A . n A 1 66 ASP 66 52 52 ASP ASP A . n A 1 67 LYS 67 53 53 LYS LYS A . n A 1 68 ASP 68 54 54 ASP ASP A . n A 1 69 LYS 69 55 55 LYS LYS A . n A 1 70 SER 70 56 56 SER SER A . n A 1 71 GLY 71 57 57 GLY GLY A . n A 1 72 PHE 72 58 58 PHE PHE A . n A 1 73 ILE 73 59 59 ILE ILE A . n A 1 74 GLU 74 60 60 GLU GLU A . n A 1 75 GLU 75 61 61 GLU GLU A . n A 1 76 ASP 76 62 62 ASP ASP A . n A 1 77 GLU 77 63 63 GLU GLU A . n A 1 78 LEU 78 64 64 LEU LEU A . n A 1 79 GLY 79 65 65 GLY GLY A . n A 1 80 PHE 80 66 66 PHE PHE A . n A 1 81 ILE 81 67 67 ILE ILE A . n A 1 82 LEU 82 68 68 LEU LEU A . n A 1 83 LYS 83 69 69 LYS LYS A . n A 1 84 GLY 84 70 70 GLY GLY A . n A 1 85 PHE 85 71 71 PHE PHE A . n A 1 86 SER 86 72 72 SER SER A . n A 1 87 PRO 87 73 73 PRO PRO A . n A 1 88 ASP 88 74 74 ASP ASP A . n A 1 89 ALA 89 75 75 ALA ALA A . n A 1 90 ARG 90 76 76 ARG ARG A . n A 1 91 ASP 91 77 77 ASP ASP A . n A 1 92 LEU 92 78 78 LEU LEU A . n A 1 93 SER 93 79 79 SER SER A . n A 1 94 ALA 94 80 80 ALA ALA A . n A 1 95 LYS 95 81 81 LYS LYS A . n A 1 96 GLU 96 82 82 GLU GLU A . n A 1 97 THR 97 83 83 THR THR A . n A 1 98 LYS 98 84 84 LYS LYS A . n A 1 99 MET 99 85 85 MET MET A . n A 1 100 LEU 100 86 86 LEU LEU A . n A 1 101 MET 101 87 87 MET MET A . n A 1 102 ALA 102 88 88 ALA ALA A . n A 1 103 ALA 103 89 89 ALA ALA A . n A 1 104 GLY 104 90 90 GLY GLY A . n A 1 105 ASP 105 91 91 ASP ASP A . n A 1 106 LYS 106 92 92 LYS LYS A . n A 1 107 ASP 107 93 93 ASP ASP A . n A 1 108 GLY 108 94 94 GLY GLY A . n A 1 109 ASP 109 95 95 ASP ASP A . n A 1 110 GLY 110 96 96 GLY GLY A . n A 1 111 LYS 111 97 97 LYS LYS A . n A 1 112 ILE 112 98 98 ILE ILE A . n A 1 113 GLY 113 99 99 GLY GLY A . n A 1 114 VAL 114 100 100 VAL VAL A . n A 1 115 ASP 115 101 101 ASP ASP A . n A 1 116 GLU 116 102 102 GLU GLU A . n A 1 117 PHE 117 103 103 PHE PHE A . n A 1 118 SER 118 104 104 SER SER A . n A 1 119 THR 119 105 105 THR THR A . n A 1 120 LEU 120 106 106 LEU LEU A . n A 1 121 VAL 121 107 107 VAL VAL A . n A 1 122 ALA 122 108 108 ALA ALA A . n A 1 123 GLU 123 109 109 GLU GLU A . n A 1 124 SER 124 110 110 SER SER A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 CA 1 201 1 CA CA A . C 2 CA 1 202 2 CA CA A . D 3 HOH 1 301 3 HOH HOH A . D 3 HOH 2 302 10 HOH HOH A . D 3 HOH 3 303 39 HOH HOH A . D 3 HOH 4 304 8 HOH HOH A . D 3 HOH 5 305 12 HOH HOH A . D 3 HOH 6 306 4 HOH HOH A . D 3 HOH 7 307 2 HOH HOH A . D 3 HOH 8 308 20 HOH HOH A . D 3 HOH 9 309 14 HOH HOH A . D 3 HOH 10 310 19 HOH HOH A . D 3 HOH 11 311 6 HOH HOH A . D 3 HOH 12 312 33 HOH HOH A . D 3 HOH 13 313 11 HOH HOH A . D 3 HOH 14 314 37 HOH HOH A . D 3 HOH 15 315 38 HOH HOH A . D 3 HOH 16 316 28 HOH HOH A . D 3 HOH 17 317 27 HOH HOH A . D 3 HOH 18 318 36 HOH HOH A . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A LYS 14 ? CG ? A LYS 28 CG 2 1 Y 1 A LYS 14 ? CD ? A LYS 28 CD 3 1 Y 1 A LYS 14 ? CE ? A LYS 28 CE 4 1 Y 1 A LYS 14 ? NZ ? A LYS 28 NZ 5 1 Y 1 A LYS 92 ? CG ? A LYS 106 CG 6 1 Y 1 A LYS 92 ? CD ? A LYS 106 CD 7 1 Y 1 A LYS 92 ? CE ? A LYS 106 CE 8 1 Y 1 A LYS 92 ? NZ ? A LYS 106 NZ # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0425 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-3000 ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? MOLREP ? ? ? . 4 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 9BB8 _cell.details ? _cell.formula_units_Z ? _cell.length_a 83.112 _cell.length_a_esd ? _cell.length_b 83.112 _cell.length_b_esd ? _cell.length_c 31.192 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 9BB8 _symmetry.cell_setting ? _symmetry.Int_Tables_number 96 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 43 21 2' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 9BB8 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 1.95 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 36.91 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '3.4 M sodium malonate, pH 6.0' _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 298 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER X 16M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2023-02-17 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.000 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'APS BEAMLINE 22-ID' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.000 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 22-ID _diffrn_source.pdbx_synchrotron_site APS # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 9BB8 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.72 _reflns.d_resolution_low 37.169 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 3079 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 95.5 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 3.5 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 11.6 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.112 _reflns.pdbx_Rpim_I_all 0.055 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.991 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs 0.096 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value 0.096 _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 2.72 _reflns_shell.d_res_low 2.77 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 2.0 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 157 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all 0.546 _reflns_shell.pdbx_Rpim_I_all 0.264 _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.767 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.percent_possible_all 99.4 _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.471 _reflns_shell.pdbx_Rsym_value 0.471 _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] -0.452 _refine.aniso_B[1][2] -0.000 _refine.aniso_B[1][3] -0.000 _refine.aniso_B[2][2] -0.452 _refine.aniso_B[2][3] -0.000 _refine.aniso_B[3][3] 0.904 _refine.B_iso_max ? _refine.B_iso_mean 42.844 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc 0.940 _refine.correlation_coeff_Fo_to_Fc_free 0.900 _refine.details 'Hydrogens have been added in their riding positions' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 9BB8 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.722 _refine.ls_d_res_low 37.169 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 3070 _refine.ls_number_reflns_R_free 145 _refine.ls_number_reflns_R_work 2925 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 95.639 _refine.ls_percent_reflns_R_free 4.723 _refine.ls_R_factor_all 0.208 _refine.ls_R_factor_obs ? _refine.ls_R_factor_R_free 0.2551 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2054 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'BABINET MODEL PLUS MASK' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 'PDB entry 1RTP' _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free 0.386 _refine.pdbx_solvent_vdw_probe_radii 1.200 _refine.pdbx_solvent_ion_probe_radii 0.800 _refine.pdbx_solvent_shrinkage_radii 0.800 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 30.620 _refine.overall_SU_ML 0.309 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 831 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 2 _refine_hist.number_atoms_solvent 18 _refine_hist.number_atoms_total 851 _refine_hist.d_res_high 2.722 _refine_hist.d_res_low 37.169 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.005 0.012 842 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 0.001 0.016 801 ? r_bond_other_d ? ? 'X-RAY DIFFRACTION' ? 1.375 1.828 1122 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 0.491 1.807 1866 ? r_angle_other_deg ? ? 'X-RAY DIFFRACTION' ? 5.177 5.000 109 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 7.564 5.000 1 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 14.852 10.000 162 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 10.777 10.000 36 ? r_dihedral_angle_6_deg ? ? 'X-RAY DIFFRACTION' ? 0.061 0.200 123 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.004 0.020 950 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 0.001 0.020 166 ? r_gen_planes_other ? ? 'X-RAY DIFFRACTION' ? 0.215 0.200 208 ? r_nbd_refined ? ? 'X-RAY DIFFRACTION' ? 0.221 0.200 725 ? r_symmetry_nbd_other ? ? 'X-RAY DIFFRACTION' ? 0.174 0.200 436 ? r_nbtor_refined ? ? 'X-RAY DIFFRACTION' ? 0.076 0.200 430 ? r_symmetry_nbtor_other ? ? 'X-RAY DIFFRACTION' ? 0.137 0.200 28 ? r_xyhbond_nbd_refined ? ? 'X-RAY DIFFRACTION' ? 0.290 0.200 8 ? r_metal_ion_refined ? ? 'X-RAY DIFFRACTION' ? 0.103 0.200 1 ? r_symmetry_nbd_refined ? ? 'X-RAY DIFFRACTION' ? 0.206 0.200 13 ? r_nbd_other ? ? 'X-RAY DIFFRACTION' ? 0.152 0.200 3 ? r_symmetry_xyhbond_nbd_refined ? ? 'X-RAY DIFFRACTION' ? 1.299 3.042 439 ? r_mcbond_it ? ? 'X-RAY DIFFRACTION' ? 1.297 3.042 439 ? r_mcbond_other ? ? 'X-RAY DIFFRACTION' ? 2.105 5.472 547 ? r_mcangle_it ? ? 'X-RAY DIFFRACTION' ? 2.104 5.471 548 ? r_mcangle_other ? ? 'X-RAY DIFFRACTION' ? 1.770 3.213 403 ? r_scbond_it ? ? 'X-RAY DIFFRACTION' ? 1.768 3.214 404 ? r_scbond_other ? ? 'X-RAY DIFFRACTION' ? 2.985 5.870 575 ? r_scangle_it ? ? 'X-RAY DIFFRACTION' ? 2.982 5.869 576 ? r_scangle_other ? ? 'X-RAY DIFFRACTION' ? 5.237 36.504 3643 ? r_lrange_it ? ? 'X-RAY DIFFRACTION' ? 5.227 36.491 3639 ? r_lrange_other ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free _refine_ls_shell.R_factor_R_free 'X-RAY DIFFRACTION' 2.722 2.793 227 . 10 209 96.4758 . 0.287 . . 0.282 . . . . . 0.250 . 20 . 0.941 0.889 0.376 'X-RAY DIFFRACTION' 2.793 2.869 229 . 12 216 99.5633 . 0.264 . . 0.265 . . . . . 0.238 . 20 . 0.951 0.940 0.243 'X-RAY DIFFRACTION' 2.869 2.951 210 . 9 201 100.0000 . 0.245 . . 0.244 . . . . . 0.216 . 20 . 0.953 0.917 0.265 'X-RAY DIFFRACTION' 2.951 3.042 208 . 13 193 99.0385 . 0.241 . . 0.239 . . . . . 0.209 . 20 . 0.962 0.966 0.256 'X-RAY DIFFRACTION' 3.042 3.141 209 . 10 189 95.2153 . 0.270 . . 0.263 . . . . . 0.236 . 20 . 0.948 0.865 0.431 'X-RAY DIFFRACTION' 3.141 3.250 198 . 11 176 94.4444 . 0.245 . . 0.240 . . . . . 0.215 . 20 . 0.964 0.932 0.334 'X-RAY DIFFRACTION' 3.250 3.372 191 . 6 180 97.3822 . 0.223 . . 0.222 . . . . . 0.201 . 20 . 0.969 0.953 0.258 'X-RAY DIFFRACTION' 3.372 3.508 188 . 5 180 98.4043 . 0.214 . . 0.208 . . . . . 0.196 . 20 . 0.975 0.882 0.381 'X-RAY DIFFRACTION' 3.508 3.663 174 . 6 164 97.7011 . 0.202 . . 0.195 . . . . . 0.189 . 20 . 0.975 0.854 0.400 'X-RAY DIFFRACTION' 3.663 3.840 176 . 8 165 98.2955 . 0.194 . . 0.187 . . . . . 0.158 . 20 . 0.978 0.964 0.318 'X-RAY DIFFRACTION' 3.840 4.045 165 . 7 154 97.5758 . 0.188 . . 0.183 . . . . . 0.168 . 20 . 0.979 0.937 0.296 'X-RAY DIFFRACTION' 4.045 4.287 156 . 10 139 95.5128 . 0.176 . . 0.172 . . . . . 0.155 . 20 . 0.983 0.966 0.232 'X-RAY DIFFRACTION' 4.287 4.579 148 . 5 128 89.8649 . 0.175 . . 0.180 . . . . . 0.162 . 20 . 0.981 0.998 0.089 'X-RAY DIFFRACTION' 4.579 4.939 141 . 8 122 92.1986 . 0.139 . . 0.142 . . . . . 0.135 . 20 . 0.986 0.991 0.099 'X-RAY DIFFRACTION' 4.939 5.401 128 . 10 112 95.3125 . 0.209 . . 0.205 . . . . . 0.180 . 20 . 0.968 0.970 0.243 'X-RAY DIFFRACTION' 5.401 6.023 123 . 4 111 93.4959 . 0.241 . . 0.222 . . . . . 0.198 . 20 . 0.969 0.786 1.285 'X-RAY DIFFRACTION' 6.023 6.924 109 . 3 92 87.1560 . 0.194 . . 0.189 . . . . . 0.174 . 20 . 0.978 0.994 0.328 'X-RAY DIFFRACTION' 6.924 8.408 95 . 2 83 89.4737 . 0.188 . . 0.191 . . . . . 0.196 . 20 . 0.979 0.999 0.043 'X-RAY DIFFRACTION' 8.408 11.598 79 . 4 65 87.3418 . 0.157 . . 0.163 . . . . . 0.175 . 20 . 0.984 0.992 0.090 'X-RAY DIFFRACTION' 11.598 37.169 54 . 2 46 88.8889 . 0.214 . . 0.218 . . . . . 0.229 . 20 . 0.978 0.993 0.130 # _struct.entry_id 9BB8 _struct.title 'Crystal structure of human alpha parvalbumin' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 9BB8 _struct_keywords.text 'parvalbumin, calcium binding protein, METAL BINDING PROTEIN' _struct_keywords.pdbx_keywords 'METAL BINDING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 3 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code PRVA_HUMAN _struct_ref.pdbx_db_accession P20472 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;SMTDLLNAEDIKKAVGAFSATDSFDHKKFFQMVGLKKKSADDVKKVFHMLDKDKSGFIEEDELGFILKGFSPDARDLSAK ETKMLMAAGDKDGDGKIGVDEFSTLVAES ; _struct_ref.pdbx_align_begin 2 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 9BB8 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 16 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 124 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P20472 _struct_ref_seq.db_align_beg 2 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 110 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 2 _struct_ref_seq.pdbx_auth_seq_align_end 110 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 9BB8 MET A 1 ? UNP P20472 ? ? 'expression tag' -13 1 1 9BB8 GLY A 2 ? UNP P20472 ? ? 'expression tag' -12 2 1 9BB8 HIS A 3 ? UNP P20472 ? ? 'expression tag' -11 3 1 9BB8 HIS A 4 ? UNP P20472 ? ? 'expression tag' -10 4 1 9BB8 HIS A 5 ? UNP P20472 ? ? 'expression tag' -9 5 1 9BB8 HIS A 6 ? UNP P20472 ? ? 'expression tag' -8 6 1 9BB8 HIS A 7 ? UNP P20472 ? ? 'expression tag' -7 7 1 9BB8 HIS A 8 ? UNP P20472 ? ? 'expression tag' -6 8 1 9BB8 GLU A 9 ? UNP P20472 ? ? 'expression tag' -5 9 1 9BB8 ASN A 10 ? UNP P20472 ? ? 'expression tag' -4 10 1 9BB8 LEU A 11 ? UNP P20472 ? ? 'expression tag' -3 11 1 9BB8 TYR A 12 ? UNP P20472 ? ? 'expression tag' -2 12 1 9BB8 PHE A 13 ? UNP P20472 ? ? 'expression tag' -1 13 1 9BB8 GLN A 14 ? UNP P20472 ? ? 'expression tag' 0 14 1 9BB8 GLY A 15 ? UNP P20472 ? ? 'expression tag' 1 15 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 5860 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 SER A 16 ? LEU A 20 ? SER A 2 LEU A 6 5 ? 5 HELX_P HELX_P2 AA2 ASN A 22 ? ALA A 32 ? ASN A 8 ALA A 18 1 ? 11 HELX_P HELX_P3 AA3 ASP A 40 ? GLY A 49 ? ASP A 26 GLY A 35 1 ? 10 HELX_P HELX_P4 AA4 SER A 54 ? ASP A 66 ? SER A 40 ASP A 52 1 ? 13 HELX_P HELX_P5 AA5 GLU A 74 ? GLY A 79 ? GLU A 60 GLY A 65 1 ? 6 HELX_P HELX_P6 AA6 PHE A 80 ? SER A 86 ? PHE A 66 SER A 72 1 ? 7 HELX_P HELX_P7 AA7 SER A 93 ? ASP A 105 ? SER A 79 ASP A 91 1 ? 13 HELX_P HELX_P8 AA8 VAL A 114 ? GLU A 123 ? VAL A 100 GLU A 109 1 ? 10 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A ASP 66 OD1 ? ? ? 1_555 B CA . CA ? ? A ASP 52 A CA 201 1_555 ? ? ? ? ? ? ? 2.244 ? ? metalc2 metalc ? ? A ASP 68 OD1 ? ? ? 1_555 B CA . CA ? ? A ASP 54 A CA 201 1_555 ? ? ? ? ? ? ? 2.202 ? ? metalc3 metalc ? ? A SER 70 OG ? ? ? 1_555 B CA . CA ? ? A SER 56 A CA 201 1_555 ? ? ? ? ? ? ? 2.835 ? ? metalc4 metalc ? ? A PHE 72 O ? ? ? 1_555 B CA . CA ? ? A PHE 58 A CA 201 1_555 ? ? ? ? ? ? ? 2.180 ? ? metalc5 metalc ? ? A GLU 74 OE1 ? ? ? 1_555 B CA . CA ? ? A GLU 60 A CA 201 1_555 ? ? ? ? ? ? ? 2.963 ? ? metalc6 metalc ? ? A GLU 74 OE2 ? ? ? 1_555 B CA . CA ? ? A GLU 60 A CA 201 1_555 ? ? ? ? ? ? ? 3.100 ? ? metalc7 metalc ? ? A GLU 77 OE1 ? ? ? 1_555 B CA . CA ? ? A GLU 63 A CA 201 1_555 ? ? ? ? ? ? ? 1.895 ? ? metalc8 metalc ? ? A GLU 77 OE2 ? ? ? 1_555 B CA . CA ? ? A GLU 63 A CA 201 1_555 ? ? ? ? ? ? ? 2.978 ? ? metalc9 metalc ? ? A ASP 105 OD1 ? ? ? 1_555 C CA . CA ? ? A ASP 91 A CA 202 1_555 ? ? ? ? ? ? ? 2.786 ? ? metalc10 metalc ? ? A ASP 107 OD1 ? ? ? 1_555 C CA . CA ? ? A ASP 93 A CA 202 1_555 ? ? ? ? ? ? ? 2.065 ? ? metalc11 metalc ? ? A ASP 109 OD1 ? ? ? 1_555 C CA . CA ? ? A ASP 95 A CA 202 1_555 ? ? ? ? ? ? ? 2.142 ? ? metalc12 metalc ? ? A ASP 109 OD2 ? ? ? 1_555 C CA . CA ? ? A ASP 95 A CA 202 1_555 ? ? ? ? ? ? ? 2.787 ? ? metalc13 metalc ? ? A LYS 111 O ? ? ? 1_555 C CA . CA ? ? A LYS 97 A CA 202 1_555 ? ? ? ? ? ? ? 2.362 ? ? metalc14 metalc ? ? A GLU 116 OE1 ? ? ? 1_555 C CA . CA ? ? A GLU 102 A CA 202 1_555 ? ? ? ? ? ? ? 2.185 ? ? metalc15 metalc ? ? A GLU 116 OE2 ? ? ? 1_555 C CA . CA ? ? A GLU 102 A CA 202 1_555 ? ? ? ? ? ? ? 2.733 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OD1 ? A ASP 66 ? A ASP 52 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 OD1 ? A ASP 68 ? A ASP 54 ? 1_555 76.5 ? 2 OD1 ? A ASP 66 ? A ASP 52 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 OG ? A SER 70 ? A SER 56 ? 1_555 86.9 ? 3 OD1 ? A ASP 68 ? A ASP 54 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 OG ? A SER 70 ? A SER 56 ? 1_555 69.3 ? 4 OD1 ? A ASP 66 ? A ASP 52 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 O ? A PHE 72 ? A PHE 58 ? 1_555 77.6 ? 5 OD1 ? A ASP 68 ? A ASP 54 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 O ? A PHE 72 ? A PHE 58 ? 1_555 138.6 ? 6 OG ? A SER 70 ? A SER 56 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 O ? A PHE 72 ? A PHE 58 ? 1_555 77.7 ? 7 OD1 ? A ASP 66 ? A ASP 52 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 OE1 ? A GLU 74 ? A GLU 60 ? 1_555 165.7 ? 8 OD1 ? A ASP 68 ? A ASP 54 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 OE1 ? A GLU 74 ? A GLU 60 ? 1_555 90.3 ? 9 OG ? A SER 70 ? A SER 56 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 OE1 ? A GLU 74 ? A GLU 60 ? 1_555 83.4 ? 10 O ? A PHE 72 ? A PHE 58 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 OE1 ? A GLU 74 ? A GLU 60 ? 1_555 110.3 ? 11 OD1 ? A ASP 66 ? A ASP 52 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 OE2 ? A GLU 74 ? A GLU 60 ? 1_555 137.0 ? 12 OD1 ? A ASP 68 ? A ASP 54 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 OE2 ? A GLU 74 ? A GLU 60 ? 1_555 108.0 ? 13 OG ? A SER 70 ? A SER 56 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 OE2 ? A GLU 74 ? A GLU 60 ? 1_555 57.7 ? 14 O ? A PHE 72 ? A PHE 58 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 OE2 ? A GLU 74 ? A GLU 60 ? 1_555 71.9 ? 15 OE1 ? A GLU 74 ? A GLU 60 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 OE2 ? A GLU 74 ? A GLU 60 ? 1_555 42.4 ? 16 OD1 ? A ASP 66 ? A ASP 52 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 OE1 ? A GLU 77 ? A GLU 63 ? 1_555 106.1 ? 17 OD1 ? A ASP 68 ? A ASP 54 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 OE1 ? A GLU 77 ? A GLU 63 ? 1_555 119.5 ? 18 OG ? A SER 70 ? A SER 56 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 OE1 ? A GLU 77 ? A GLU 63 ? 1_555 165.4 ? 19 O ? A PHE 72 ? A PHE 58 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 OE1 ? A GLU 77 ? A GLU 63 ? 1_555 98.3 ? 20 OE1 ? A GLU 74 ? A GLU 60 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 OE1 ? A GLU 77 ? A GLU 63 ? 1_555 85.0 ? 21 OE2 ? A GLU 74 ? A GLU 60 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 OE1 ? A GLU 77 ? A GLU 63 ? 1_555 107.7 ? 22 OD1 ? A ASP 66 ? A ASP 52 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 OE2 ? A GLU 77 ? A GLU 63 ? 1_555 93.0 ? 23 OD1 ? A ASP 68 ? A ASP 54 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 OE2 ? A GLU 77 ? A GLU 63 ? 1_555 72.9 ? 24 OG ? A SER 70 ? A SER 56 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 OE2 ? A GLU 77 ? A GLU 63 ? 1_555 141.1 ? 25 O ? A PHE 72 ? A PHE 58 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 OE2 ? A GLU 77 ? A GLU 63 ? 1_555 140.2 ? 26 OE1 ? A GLU 74 ? A GLU 60 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 OE2 ? A GLU 77 ? A GLU 63 ? 1_555 88.1 ? 27 OE2 ? A GLU 74 ? A GLU 60 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 OE2 ? A GLU 77 ? A GLU 63 ? 1_555 129.7 ? 28 OE1 ? A GLU 77 ? A GLU 63 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 OE2 ? A GLU 77 ? A GLU 63 ? 1_555 46.8 ? 29 OD1 ? A ASP 105 ? A ASP 91 ? 1_555 CA ? C CA . ? A CA 202 ? 1_555 OD1 ? A ASP 107 ? A ASP 93 ? 1_555 75.6 ? 30 OD1 ? A ASP 105 ? A ASP 91 ? 1_555 CA ? C CA . ? A CA 202 ? 1_555 OD1 ? A ASP 109 ? A ASP 95 ? 1_555 71.3 ? 31 OD1 ? A ASP 107 ? A ASP 93 ? 1_555 CA ? C CA . ? A CA 202 ? 1_555 OD1 ? A ASP 109 ? A ASP 95 ? 1_555 91.7 ? 32 OD1 ? A ASP 105 ? A ASP 91 ? 1_555 CA ? C CA . ? A CA 202 ? 1_555 OD2 ? A ASP 109 ? A ASP 95 ? 1_555 118.6 ? 33 OD1 ? A ASP 107 ? A ASP 93 ? 1_555 CA ? C CA . ? A CA 202 ? 1_555 OD2 ? A ASP 109 ? A ASP 95 ? 1_555 85.5 ? 34 OD1 ? A ASP 109 ? A ASP 95 ? 1_555 CA ? C CA . ? A CA 202 ? 1_555 OD2 ? A ASP 109 ? A ASP 95 ? 1_555 51.2 ? 35 OD1 ? A ASP 105 ? A ASP 91 ? 1_555 CA ? C CA . ? A CA 202 ? 1_555 O ? A LYS 111 ? A LYS 97 ? 1_555 98.4 ? 36 OD1 ? A ASP 107 ? A ASP 93 ? 1_555 CA ? C CA . ? A CA 202 ? 1_555 O ? A LYS 111 ? A LYS 97 ? 1_555 164.1 ? 37 OD1 ? A ASP 109 ? A ASP 95 ? 1_555 CA ? C CA . ? A CA 202 ? 1_555 O ? A LYS 111 ? A LYS 97 ? 1_555 72.4 ? 38 OD2 ? A ASP 109 ? A ASP 95 ? 1_555 CA ? C CA . ? A CA 202 ? 1_555 O ? A LYS 111 ? A LYS 97 ? 1_555 84.5 ? 39 OD1 ? A ASP 105 ? A ASP 91 ? 1_555 CA ? C CA . ? A CA 202 ? 1_555 OE1 ? A GLU 116 ? A GLU 102 ? 1_555 135.3 ? 40 OD1 ? A ASP 107 ? A ASP 93 ? 1_555 CA ? C CA . ? A CA 202 ? 1_555 OE1 ? A GLU 116 ? A GLU 102 ? 1_555 96.9 ? 41 OD1 ? A ASP 109 ? A ASP 95 ? 1_555 CA ? C CA . ? A CA 202 ? 1_555 OE1 ? A GLU 116 ? A GLU 102 ? 1_555 153.4 ? 42 OD2 ? A ASP 109 ? A ASP 95 ? 1_555 CA ? C CA . ? A CA 202 ? 1_555 OE1 ? A GLU 116 ? A GLU 102 ? 1_555 104.3 ? 43 O ? A LYS 111 ? A LYS 97 ? 1_555 CA ? C CA . ? A CA 202 ? 1_555 OE1 ? A GLU 116 ? A GLU 102 ? 1_555 97.6 ? 44 OD1 ? A ASP 105 ? A ASP 91 ? 1_555 CA ? C CA . ? A CA 202 ? 1_555 OE2 ? A GLU 116 ? A GLU 102 ? 1_555 85.1 ? 45 OD1 ? A ASP 107 ? A ASP 93 ? 1_555 CA ? C CA . ? A CA 202 ? 1_555 OE2 ? A GLU 116 ? A GLU 102 ? 1_555 74.0 ? 46 OD1 ? A ASP 109 ? A ASP 95 ? 1_555 CA ? C CA . ? A CA 202 ? 1_555 OE2 ? A GLU 116 ? A GLU 102 ? 1_555 155.0 ? 47 OD2 ? A ASP 109 ? A ASP 95 ? 1_555 CA ? C CA . ? A CA 202 ? 1_555 OE2 ? A GLU 116 ? A GLU 102 ? 1_555 143.9 ? 48 O ? A LYS 111 ? A LYS 97 ? 1_555 CA ? C CA . ? A CA 202 ? 1_555 OE2 ? A GLU 116 ? A GLU 102 ? 1_555 120.7 ? 49 OE1 ? A GLU 116 ? A GLU 102 ? 1_555 CA ? C CA . ? A CA 202 ? 1_555 OE2 ? A GLU 116 ? A GLU 102 ? 1_555 51.0 ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id AA1 _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 PHE A 72 ? ILE A 73 ? PHE A 58 ILE A 59 AA1 2 ILE A 112 ? GLY A 113 ? ILE A 98 GLY A 99 # _pdbx_struct_sheet_hbond.sheet_id AA1 _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id ILE _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 73 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id ILE _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 59 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id ILE _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 112 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id ILE _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 98 # _pdbx_entry_details.entry_id 9BB8 _pdbx_entry_details.has_ligand_of_interest N _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_protein_modification N # _pdbx_refine_tls.id 1 _pdbx_refine_tls.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls.details ? _pdbx_refine_tls.method refined _pdbx_refine_tls.origin_x 3.9580 _pdbx_refine_tls.origin_y 21.7810 _pdbx_refine_tls.origin_z 5.0200 _pdbx_refine_tls.T[1][1] 0.0596 _pdbx_refine_tls.T[1][1]_esd ? _pdbx_refine_tls.T[1][2] 0.0580 _pdbx_refine_tls.T[1][2]_esd ? _pdbx_refine_tls.T[1][3] 0.0032 _pdbx_refine_tls.T[1][3]_esd ? _pdbx_refine_tls.T[2][2] 0.1110 _pdbx_refine_tls.T[2][2]_esd ? _pdbx_refine_tls.T[2][3] 0.0073 _pdbx_refine_tls.T[2][3]_esd ? _pdbx_refine_tls.T[3][3] 0.0179 _pdbx_refine_tls.T[3][3]_esd ? _pdbx_refine_tls.L[1][1] 2.7791 _pdbx_refine_tls.L[1][1]_esd ? _pdbx_refine_tls.L[1][2] -0.0371 _pdbx_refine_tls.L[1][2]_esd ? _pdbx_refine_tls.L[1][3] -1.1441 _pdbx_refine_tls.L[1][3]_esd ? _pdbx_refine_tls.L[2][2] 3.6616 _pdbx_refine_tls.L[2][2]_esd ? _pdbx_refine_tls.L[2][3] -0.1107 _pdbx_refine_tls.L[2][3]_esd ? _pdbx_refine_tls.L[3][3] 3.4958 _pdbx_refine_tls.L[3][3]_esd ? _pdbx_refine_tls.S[1][1] -0.0631 _pdbx_refine_tls.S[1][1]_esd ? _pdbx_refine_tls.S[1][2] 0.1240 _pdbx_refine_tls.S[1][2]_esd ? _pdbx_refine_tls.S[1][3] -0.0840 _pdbx_refine_tls.S[1][3]_esd ? _pdbx_refine_tls.S[2][1] 0.0638 _pdbx_refine_tls.S[2][1]_esd ? _pdbx_refine_tls.S[2][2] -0.0079 _pdbx_refine_tls.S[2][2]_esd ? _pdbx_refine_tls.S[2][3] -0.0600 _pdbx_refine_tls.S[2][3]_esd ? _pdbx_refine_tls.S[3][1] 0.1248 _pdbx_refine_tls.S[3][1]_esd ? _pdbx_refine_tls.S[3][2] -0.0105 _pdbx_refine_tls.S[3][2]_esd ? _pdbx_refine_tls.S[3][3] 0.0711 _pdbx_refine_tls.S[3][3]_esd ? # _pdbx_refine_tls_group.id 1 _pdbx_refine_tls_group.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls_group.refine_tls_id 1 _pdbx_refine_tls_group.beg_label_asym_id ? _pdbx_refine_tls_group.beg_label_seq_id ? _pdbx_refine_tls_group.beg_auth_asym_id A _pdbx_refine_tls_group.beg_auth_seq_id 1 _pdbx_refine_tls_group.beg_PDB_ins_code ? _pdbx_refine_tls_group.end_label_asym_id ? _pdbx_refine_tls_group.end_label_seq_id ? _pdbx_refine_tls_group.end_auth_asym_id A _pdbx_refine_tls_group.end_auth_seq_id 110 _pdbx_refine_tls_group.end_PDB_ins_code ? _pdbx_refine_tls_group.selection ALL _pdbx_refine_tls_group.selection_details ? # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET -13 ? A MET 1 2 1 Y 1 A GLY -12 ? A GLY 2 3 1 Y 1 A HIS -11 ? A HIS 3 4 1 Y 1 A HIS -10 ? A HIS 4 5 1 Y 1 A HIS -9 ? A HIS 5 6 1 Y 1 A HIS -8 ? A HIS 6 7 1 Y 1 A HIS -7 ? A HIS 7 8 1 Y 1 A HIS -6 ? A HIS 8 9 1 Y 1 A GLU -5 ? A GLU 9 10 1 Y 1 A ASN -4 ? A ASN 10 11 1 Y 1 A LEU -3 ? A LEU 11 12 1 Y 1 A TYR -2 ? A TYR 12 13 1 Y 1 A PHE -1 ? A PHE 13 14 1 Y 1 A GLN 0 ? A GLN 14 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CA CA CA N N 74 GLN N N N N 75 GLN CA C N S 76 GLN C C N N 77 GLN O O N N 78 GLN CB C N N 79 GLN CG C N N 80 GLN CD C N N 81 GLN OE1 O N N 82 GLN NE2 N N N 83 GLN OXT O N N 84 GLN H H N N 85 GLN H2 H N N 86 GLN HA H N N 87 GLN HB2 H N N 88 GLN HB3 H N N 89 GLN HG2 H N N 90 GLN HG3 H N N 91 GLN HE21 H N N 92 GLN HE22 H N N 93 GLN HXT H N N 94 GLU N N N N 95 GLU CA C N S 96 GLU C C N N 97 GLU O O N N 98 GLU CB C N N 99 GLU CG C N N 100 GLU CD C N N 101 GLU OE1 O N N 102 GLU OE2 O N N 103 GLU OXT O N N 104 GLU H H N N 105 GLU H2 H N N 106 GLU HA H N N 107 GLU HB2 H N N 108 GLU HB3 H N N 109 GLU HG2 H N N 110 GLU HG3 H N N 111 GLU HE2 H N N 112 GLU HXT H N N 113 GLY N N N N 114 GLY CA C N N 115 GLY C C N N 116 GLY O O N N 117 GLY OXT O N N 118 GLY H H N N 119 GLY H2 H N N 120 GLY HA2 H N N 121 GLY HA3 H N N 122 GLY HXT H N N 123 HIS N N N N 124 HIS CA C N S 125 HIS C C N N 126 HIS O O N N 127 HIS CB C N N 128 HIS CG C Y N 129 HIS ND1 N Y N 130 HIS CD2 C Y N 131 HIS CE1 C Y N 132 HIS NE2 N Y N 133 HIS OXT O N N 134 HIS H H N N 135 HIS H2 H N N 136 HIS HA H N N 137 HIS HB2 H N N 138 HIS HB3 H N N 139 HIS HD1 H N N 140 HIS HD2 H N N 141 HIS HE1 H N N 142 HIS HE2 H N N 143 HIS HXT H N N 144 HOH O O N N 145 HOH H1 H N N 146 HOH H2 H N N 147 ILE N N N N 148 ILE CA C N S 149 ILE C C N N 150 ILE O O N N 151 ILE CB C N S 152 ILE CG1 C N N 153 ILE CG2 C N N 154 ILE CD1 C N N 155 ILE OXT O N N 156 ILE H H N N 157 ILE H2 H N N 158 ILE HA H N N 159 ILE HB H N N 160 ILE HG12 H N N 161 ILE HG13 H N N 162 ILE HG21 H N N 163 ILE HG22 H N N 164 ILE HG23 H N N 165 ILE HD11 H N N 166 ILE HD12 H N N 167 ILE HD13 H N N 168 ILE HXT H N N 169 LEU N N N N 170 LEU CA C N S 171 LEU C C N N 172 LEU O O N N 173 LEU CB C N N 174 LEU CG C N N 175 LEU CD1 C N N 176 LEU CD2 C N N 177 LEU OXT O N N 178 LEU H H N N 179 LEU H2 H N N 180 LEU HA H N N 181 LEU HB2 H N N 182 LEU HB3 H N N 183 LEU HG H N N 184 LEU HD11 H N N 185 LEU HD12 H N N 186 LEU HD13 H N N 187 LEU HD21 H N N 188 LEU HD22 H N N 189 LEU HD23 H N N 190 LEU HXT H N N 191 LYS N N N N 192 LYS CA C N S 193 LYS C C N N 194 LYS O O N N 195 LYS CB C N N 196 LYS CG C N N 197 LYS CD C N N 198 LYS CE C N N 199 LYS NZ N N N 200 LYS OXT O N N 201 LYS H H N N 202 LYS H2 H N N 203 LYS HA H N N 204 LYS HB2 H N N 205 LYS HB3 H N N 206 LYS HG2 H N N 207 LYS HG3 H N N 208 LYS HD2 H N N 209 LYS HD3 H N N 210 LYS HE2 H N N 211 LYS HE3 H N N 212 LYS HZ1 H N N 213 LYS HZ2 H N N 214 LYS HZ3 H N N 215 LYS HXT H N N 216 MET N N N N 217 MET CA C N S 218 MET C C N N 219 MET O O N N 220 MET CB C N N 221 MET CG C N N 222 MET SD S N N 223 MET CE C N N 224 MET OXT O N N 225 MET H H N N 226 MET H2 H N N 227 MET HA H N N 228 MET HB2 H N N 229 MET HB3 H N N 230 MET HG2 H N N 231 MET HG3 H N N 232 MET HE1 H N N 233 MET HE2 H N N 234 MET HE3 H N N 235 MET HXT H N N 236 PHE N N N N 237 PHE CA C N S 238 PHE C C N N 239 PHE O O N N 240 PHE CB C N N 241 PHE CG C Y N 242 PHE CD1 C Y N 243 PHE CD2 C Y N 244 PHE CE1 C Y N 245 PHE CE2 C Y N 246 PHE CZ C Y N 247 PHE OXT O N N 248 PHE H H N N 249 PHE H2 H N N 250 PHE HA H N N 251 PHE HB2 H N N 252 PHE HB3 H N N 253 PHE HD1 H N N 254 PHE HD2 H N N 255 PHE HE1 H N N 256 PHE HE2 H N N 257 PHE HZ H N N 258 PHE HXT H N N 259 PRO N N N N 260 PRO CA C N S 261 PRO C C N N 262 PRO O O N N 263 PRO CB C N N 264 PRO CG C N N 265 PRO CD C N N 266 PRO OXT O N N 267 PRO H H N N 268 PRO HA H N N 269 PRO HB2 H N N 270 PRO HB3 H N N 271 PRO HG2 H N N 272 PRO HG3 H N N 273 PRO HD2 H N N 274 PRO HD3 H N N 275 PRO HXT H N N 276 SER N N N N 277 SER CA C N S 278 SER C C N N 279 SER O O N N 280 SER CB C N N 281 SER OG O N N 282 SER OXT O N N 283 SER H H N N 284 SER H2 H N N 285 SER HA H N N 286 SER HB2 H N N 287 SER HB3 H N N 288 SER HG H N N 289 SER HXT H N N 290 THR N N N N 291 THR CA C N S 292 THR C C N N 293 THR O O N N 294 THR CB C N R 295 THR OG1 O N N 296 THR CG2 C N N 297 THR OXT O N N 298 THR H H N N 299 THR H2 H N N 300 THR HA H N N 301 THR HB H N N 302 THR HG1 H N N 303 THR HG21 H N N 304 THR HG22 H N N 305 THR HG23 H N N 306 THR HXT H N N 307 TYR N N N N 308 TYR CA C N S 309 TYR C C N N 310 TYR O O N N 311 TYR CB C N N 312 TYR CG C Y N 313 TYR CD1 C Y N 314 TYR CD2 C Y N 315 TYR CE1 C Y N 316 TYR CE2 C Y N 317 TYR CZ C Y N 318 TYR OH O N N 319 TYR OXT O N N 320 TYR H H N N 321 TYR H2 H N N 322 TYR HA H N N 323 TYR HB2 H N N 324 TYR HB3 H N N 325 TYR HD1 H N N 326 TYR HD2 H N N 327 TYR HE1 H N N 328 TYR HE2 H N N 329 TYR HH H N N 330 TYR HXT H N N 331 VAL N N N N 332 VAL CA C N S 333 VAL C C N N 334 VAL O O N N 335 VAL CB C N N 336 VAL CG1 C N N 337 VAL CG2 C N N 338 VAL OXT O N N 339 VAL H H N N 340 VAL H2 H N N 341 VAL HA H N N 342 VAL HB H N N 343 VAL HG11 H N N 344 VAL HG12 H N N 345 VAL HG13 H N N 346 VAL HG21 H N N 347 VAL HG22 H N N 348 VAL HG23 H N N 349 VAL HXT H N N 350 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 HIS N CA sing N N 116 HIS N H sing N N 117 HIS N H2 sing N N 118 HIS CA C sing N N 119 HIS CA CB sing N N 120 HIS CA HA sing N N 121 HIS C O doub N N 122 HIS C OXT sing N N 123 HIS CB CG sing N N 124 HIS CB HB2 sing N N 125 HIS CB HB3 sing N N 126 HIS CG ND1 sing Y N 127 HIS CG CD2 doub Y N 128 HIS ND1 CE1 doub Y N 129 HIS ND1 HD1 sing N N 130 HIS CD2 NE2 sing Y N 131 HIS CD2 HD2 sing N N 132 HIS CE1 NE2 sing Y N 133 HIS CE1 HE1 sing N N 134 HIS NE2 HE2 sing N N 135 HIS OXT HXT sing N N 136 HOH O H1 sing N N 137 HOH O H2 sing N N 138 ILE N CA sing N N 139 ILE N H sing N N 140 ILE N H2 sing N N 141 ILE CA C sing N N 142 ILE CA CB sing N N 143 ILE CA HA sing N N 144 ILE C O doub N N 145 ILE C OXT sing N N 146 ILE CB CG1 sing N N 147 ILE CB CG2 sing N N 148 ILE CB HB sing N N 149 ILE CG1 CD1 sing N N 150 ILE CG1 HG12 sing N N 151 ILE CG1 HG13 sing N N 152 ILE CG2 HG21 sing N N 153 ILE CG2 HG22 sing N N 154 ILE CG2 HG23 sing N N 155 ILE CD1 HD11 sing N N 156 ILE CD1 HD12 sing N N 157 ILE CD1 HD13 sing N N 158 ILE OXT HXT sing N N 159 LEU N CA sing N N 160 LEU N H sing N N 161 LEU N H2 sing N N 162 LEU CA C sing N N 163 LEU CA CB sing N N 164 LEU CA HA sing N N 165 LEU C O doub N N 166 LEU C OXT sing N N 167 LEU CB CG sing N N 168 LEU CB HB2 sing N N 169 LEU CB HB3 sing N N 170 LEU CG CD1 sing N N 171 LEU CG CD2 sing N N 172 LEU CG HG sing N N 173 LEU CD1 HD11 sing N N 174 LEU CD1 HD12 sing N N 175 LEU CD1 HD13 sing N N 176 LEU CD2 HD21 sing N N 177 LEU CD2 HD22 sing N N 178 LEU CD2 HD23 sing N N 179 LEU OXT HXT sing N N 180 LYS N CA sing N N 181 LYS N H sing N N 182 LYS N H2 sing N N 183 LYS CA C sing N N 184 LYS CA CB sing N N 185 LYS CA HA sing N N 186 LYS C O doub N N 187 LYS C OXT sing N N 188 LYS CB CG sing N N 189 LYS CB HB2 sing N N 190 LYS CB HB3 sing N N 191 LYS CG CD sing N N 192 LYS CG HG2 sing N N 193 LYS CG HG3 sing N N 194 LYS CD CE sing N N 195 LYS CD HD2 sing N N 196 LYS CD HD3 sing N N 197 LYS CE NZ sing N N 198 LYS CE HE2 sing N N 199 LYS CE HE3 sing N N 200 LYS NZ HZ1 sing N N 201 LYS NZ HZ2 sing N N 202 LYS NZ HZ3 sing N N 203 LYS OXT HXT sing N N 204 MET N CA sing N N 205 MET N H sing N N 206 MET N H2 sing N N 207 MET CA C sing N N 208 MET CA CB sing N N 209 MET CA HA sing N N 210 MET C O doub N N 211 MET C OXT sing N N 212 MET CB CG sing N N 213 MET CB HB2 sing N N 214 MET CB HB3 sing N N 215 MET CG SD sing N N 216 MET CG HG2 sing N N 217 MET CG HG3 sing N N 218 MET SD CE sing N N 219 MET CE HE1 sing N N 220 MET CE HE2 sing N N 221 MET CE HE3 sing N N 222 MET OXT HXT sing N N 223 PHE N CA sing N N 224 PHE N H sing N N 225 PHE N H2 sing N N 226 PHE CA C sing N N 227 PHE CA CB sing N N 228 PHE CA HA sing N N 229 PHE C O doub N N 230 PHE C OXT sing N N 231 PHE CB CG sing N N 232 PHE CB HB2 sing N N 233 PHE CB HB3 sing N N 234 PHE CG CD1 doub Y N 235 PHE CG CD2 sing Y N 236 PHE CD1 CE1 sing Y N 237 PHE CD1 HD1 sing N N 238 PHE CD2 CE2 doub Y N 239 PHE CD2 HD2 sing N N 240 PHE CE1 CZ doub Y N 241 PHE CE1 HE1 sing N N 242 PHE CE2 CZ sing Y N 243 PHE CE2 HE2 sing N N 244 PHE CZ HZ sing N N 245 PHE OXT HXT sing N N 246 PRO N CA sing N N 247 PRO N CD sing N N 248 PRO N H sing N N 249 PRO CA C sing N N 250 PRO CA CB sing N N 251 PRO CA HA sing N N 252 PRO C O doub N N 253 PRO C OXT sing N N 254 PRO CB CG sing N N 255 PRO CB HB2 sing N N 256 PRO CB HB3 sing N N 257 PRO CG CD sing N N 258 PRO CG HG2 sing N N 259 PRO CG HG3 sing N N 260 PRO CD HD2 sing N N 261 PRO CD HD3 sing N N 262 PRO OXT HXT sing N N 263 SER N CA sing N N 264 SER N H sing N N 265 SER N H2 sing N N 266 SER CA C sing N N 267 SER CA CB sing N N 268 SER CA HA sing N N 269 SER C O doub N N 270 SER C OXT sing N N 271 SER CB OG sing N N 272 SER CB HB2 sing N N 273 SER CB HB3 sing N N 274 SER OG HG sing N N 275 SER OXT HXT sing N N 276 THR N CA sing N N 277 THR N H sing N N 278 THR N H2 sing N N 279 THR CA C sing N N 280 THR CA CB sing N N 281 THR CA HA sing N N 282 THR C O doub N N 283 THR C OXT sing N N 284 THR CB OG1 sing N N 285 THR CB CG2 sing N N 286 THR CB HB sing N N 287 THR OG1 HG1 sing N N 288 THR CG2 HG21 sing N N 289 THR CG2 HG22 sing N N 290 THR CG2 HG23 sing N N 291 THR OXT HXT sing N N 292 TYR N CA sing N N 293 TYR N H sing N N 294 TYR N H2 sing N N 295 TYR CA C sing N N 296 TYR CA CB sing N N 297 TYR CA HA sing N N 298 TYR C O doub N N 299 TYR C OXT sing N N 300 TYR CB CG sing N N 301 TYR CB HB2 sing N N 302 TYR CB HB3 sing N N 303 TYR CG CD1 doub Y N 304 TYR CG CD2 sing Y N 305 TYR CD1 CE1 sing Y N 306 TYR CD1 HD1 sing N N 307 TYR CD2 CE2 doub Y N 308 TYR CD2 HD2 sing N N 309 TYR CE1 CZ doub Y N 310 TYR CE1 HE1 sing N N 311 TYR CE2 CZ sing Y N 312 TYR CE2 HE2 sing N N 313 TYR CZ OH sing N N 314 TYR OH HH sing N N 315 TYR OXT HXT sing N N 316 VAL N CA sing N N 317 VAL N H sing N N 318 VAL N H2 sing N N 319 VAL CA C sing N N 320 VAL CA CB sing N N 321 VAL CA HA sing N N 322 VAL C O doub N N 323 VAL C OXT sing N N 324 VAL CB CG1 sing N N 325 VAL CB CG2 sing N N 326 VAL CB HB sing N N 327 VAL CG1 HG11 sing N N 328 VAL CG1 HG12 sing N N 329 VAL CG1 HG13 sing N N 330 VAL CG2 HG21 sing N N 331 VAL CG2 HG22 sing N N 332 VAL CG2 HG23 sing N N 333 VAL OXT HXT sing N N 334 # _pdbx_audit_support.funding_organization 'Not funded' _pdbx_audit_support.country ? _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 1RTP _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 9BB8 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 0.012032 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.012032 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.032060 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.pdbx_scat_Z _atom_type.pdbx_N_electrons _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c C 6 6 2.3103 20.8439 1.0201 10.2075 1.5888 0.5687 0.8651 51.6512 0.2156 CA 20 20 8.6266 10.4421 7.3873 0.6599 1.5899 85.7484 1.0211 178.4370 1.3751 H 1 1 0.4930 10.5109 0.3229 26.1257 0.1402 3.1424 0.0408 57.7997 0.0030 N 7 7 12.2220 0.0057 3.1346 9.8933 2.0141 28.9975 1.1672 0.5826 -11.5379 O 8 8 3.0487 13.2771 2.2870 5.7011 1.5464 0.3239 0.8671 32.9089 0.2508 S 16 16 6.9054 1.4679 5.2035 22.2151 1.4379 0.2536 1.5863 56.1720 0.8669 # loop_ # loop_ #