data_9BF4 # _entry.id 9BF4 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.403 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 9BF4 pdb_00009bf4 10.2210/pdb9bf4/pdb WWPDB D_1000282557 ? ? BMRB 31168 ? 10.13018/BMR31168 # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2025-05-07 _pdbx_audit_revision_history.part_number ? # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr . _pdbx_database_status.entry_id 9BF4 _pdbx_database_status.recvd_initial_deposition_date 2024-04-16 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs . _pdbx_database_status.status_code_nmr_data REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_database_related.db_name BMRB _pdbx_database_related.details 'NMR solution structure of Paws Derived Peptide-25 (PDP-25)' _pdbx_database_related.db_id 31168 _pdbx_database_related.content_type unspecified # _pdbx_contact_author.id 2 _pdbx_contact_author.email j.rosengren@uq.edu.au _pdbx_contact_author.name_first 'K. Johan' _pdbx_contact_author.name_last Rosengren _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-5007-8434 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Hajiaghaalipour, F.' 1 0000-0001-5396-1401 'Wong, W.' 2 ? 'Payne, C.D.' 3 0000-0002-9316-1465 'Fisher, M.F.' 4 0000-0002-6971-4285 'Clark, R.J.' 5 0000-0002-6807-5426 'Mylne, J.S.' 6 0000-0003-4957-6388 'Rosengren, K.J.' 7 0000-0002-5007-8434 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Paws Derived Peptides with two difulfides adopt different structural folds.' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Hajiaghaalipour, F.' 1 0000-0001-5396-1401 primary 'Wong, W.' 2 ? primary 'Payne, C.D.' 3 0000-0002-9316-1465 primary 'Fischer, M.F.' 4 0000-0002-6971-4285 primary 'Clark, R.J.' 5 0000-0002-6807-5426 primary 'Mylne, J.S.' 6 0000-0003-4957-6388 primary 'Rosengren, K.J.' 7 0000-0002-5007-8434 # _entity.id 1 _entity.type polymer _entity.src_method syn _entity.pdbx_description 'Paws Derived Peptide-25' _entity.formula_weight 3382.841 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation 0 _entity.pdbx_fragment ? _entity.details 'Peptide is head-to-tail backbone cyclic with a peptide bond between Asp31 and Gly1' # _entity_name_com.entity_id 1 _entity_name_com.name PDP-25 # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GFCWGDLCVPYGTCSQLPPWLQDMCAAASFD _entity_poly.pdbx_seq_one_letter_code_can GFCWGDLCVPYGTCSQLPPWLQDMCAAASFD _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 PHE n 1 3 CYS n 1 4 TRP n 1 5 GLY n 1 6 ASP n 1 7 LEU n 1 8 CYS n 1 9 VAL n 1 10 PRO n 1 11 TYR n 1 12 GLY n 1 13 THR n 1 14 CYS n 1 15 SER n 1 16 GLN n 1 17 LEU n 1 18 PRO n 1 19 PRO n 1 20 TRP n 1 21 LEU n 1 22 GLN n 1 23 ASP n 1 24 MET n 1 25 CYS n 1 26 ALA n 1 27 ALA n 1 28 ALA n 1 29 SER n 1 30 PHE n 1 31 ASP n # _pdbx_entity_src_syn.entity_id 1 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num 1 _pdbx_entity_src_syn.pdbx_end_seq_num 31 _pdbx_entity_src_syn.organism_scientific 'Zinnia haageana' _pdbx_entity_src_syn.organism_common_name ? _pdbx_entity_src_syn.ncbi_taxonomy_id 1525732 _pdbx_entity_src_syn.details ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 PHE 2 2 2 PHE PHE A . n A 1 3 CYS 3 3 3 CYS CYS A . n A 1 4 TRP 4 4 4 TRP TRP A . n A 1 5 GLY 5 5 5 GLY GLY A . n A 1 6 ASP 6 6 6 ASP ASP A . n A 1 7 LEU 7 7 7 LEU LEU A . n A 1 8 CYS 8 8 8 CYS CYS A . n A 1 9 VAL 9 9 9 VAL VAL A . n A 1 10 PRO 10 10 10 PRO PRO A . n A 1 11 TYR 11 11 11 TYR TYR A . n A 1 12 GLY 12 12 12 GLY GLY A . n A 1 13 THR 13 13 13 THR THR A . n A 1 14 CYS 14 14 14 CYS CYS A . n A 1 15 SER 15 15 15 SER SER A . n A 1 16 GLN 16 16 16 GLN GLN A . n A 1 17 LEU 17 17 17 LEU LEU A . n A 1 18 PRO 18 18 18 PRO PRO A . n A 1 19 PRO 19 19 19 PRO PRO A . n A 1 20 TRP 20 20 20 TRP TRP A . n A 1 21 LEU 21 21 21 LEU LEU A . n A 1 22 GLN 22 22 22 GLN GLN A . n A 1 23 ASP 23 23 23 ASP ASP A . n A 1 24 MET 24 24 24 MET MET A . n A 1 25 CYS 25 25 25 CYS CYS A . n A 1 26 ALA 26 26 26 ALA ALA A . n A 1 27 ALA 27 27 27 ALA ALA A . n A 1 28 ALA 28 28 28 ALA ALA A . n A 1 29 SER 29 29 29 SER SER A . n A 1 30 PHE 30 30 30 PHE PHE A . n A 1 31 ASP 31 31 31 ASP ASP A . n # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 9BF4 _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 9BF4 _struct.title 'NMR solution structure of Paws Derived Peptide-25 (PDP-25)' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 9BF4 _struct_keywords.text 'Plant peptide, cyclic peptide, PawS-Derived Peptide, PDP, PLANT PROTEIN' _struct_keywords.pdbx_keywords 'PLANT PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name PDB _struct_ref.db_code 9BF4 _struct_ref.pdbx_db_accession 9BF4 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 9BF4 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 31 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession 9BF4 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 31 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 31 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'NMR Distance Restraints' _pdbx_struct_assembly_auth_evidence.details 'NOE data fully consistent with monomeric structure.' # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0 _pdbx_struct_oper_list.matrix[1][2] 0.0 _pdbx_struct_oper_list.matrix[1][3] 0.0 _pdbx_struct_oper_list.vector[1] 0.0 _pdbx_struct_oper_list.matrix[2][1] 0.0 _pdbx_struct_oper_list.matrix[2][2] 1.0 _pdbx_struct_oper_list.matrix[2][3] 0.0 _pdbx_struct_oper_list.vector[2] 0.0 _pdbx_struct_oper_list.matrix[3][1] 0.0 _pdbx_struct_oper_list.matrix[3][2] 0.0 _pdbx_struct_oper_list.matrix[3][3] 1.0 _pdbx_struct_oper_list.vector[3] 0.0 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 THR A 13 ? LEU A 17 ? THR A 13 LEU A 17 5 ? 5 HELX_P HELX_P2 AA2 PRO A 18 ? ASP A 31 ? PRO A 18 ASP A 31 1 ? 14 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 3 SG ? ? ? 1_555 A CYS 8 SG ? ? A CYS 3 A CYS 8 1_555 ? ? ? ? ? ? ? 2.028 ? ? disulf2 disulf ? ? A CYS 14 SG ? ? ? 1_555 A CYS 25 SG ? ? A CYS 14 A CYS 25 1_555 ? ? ? ? ? ? ? 2.044 ? ? covale1 covale both ? A GLY 1 N ? ? ? 1_555 A ASP 31 C ? ? A GLY 1 A ASP 31 1_555 ? ? ? ? ? ? ? 1.282 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference disulf ? ? covale ? ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 CYS A 3 ? CYS A 8 ? CYS A 3 ? 1_555 CYS A 8 ? 1_555 SG SG . . . None 'Disulfide bridge' 2 CYS A 14 ? CYS A 25 ? CYS A 14 ? 1_555 CYS A 25 ? 1_555 SG SG . . . None 'Disulfide bridge' 3 GLY A 1 ? ASP A 31 ? GLY A 1 ? 1_555 ASP A 31 ? 1_555 N C . . . None 'Non-standard linkage' # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id AA1 _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 CYS A 3 ? TRP A 4 ? CYS A 3 TRP A 4 AA1 2 LEU A 7 ? CYS A 8 ? LEU A 7 CYS A 8 # _pdbx_struct_sheet_hbond.sheet_id AA1 _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id TRP _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 4 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id TRP _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 4 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id LEU _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 7 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id LEU _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 7 # _pdbx_entry_details.entry_id 9BF4 _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 12 _pdbx_validate_close_contact.auth_atom_id_1 N _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 GLY _pdbx_validate_close_contact.auth_seq_id_1 1 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 O _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 ASP _pdbx_validate_close_contact.auth_seq_id_2 31 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 2.19 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 12 TRP A 4 ? ? -113.78 79.46 2 16 TRP A 4 ? ? -109.09 76.48 # _pdbx_nmr_ensemble.entry_id 9BF4 _pdbx_nmr_ensemble.conformers_calculated_total_number 50 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with acceptable covalent geometry' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 9BF4 _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '2 mg/mL PDP-25, 40% H2O/10% D2O/50% CD3CN' _pdbx_nmr_sample_details.solvent_system '40% H2O/10% D2O/50% CD3CN' _pdbx_nmr_sample_details.label 'Sample 1' _pdbx_nmr_sample_details.type solution _pdbx_nmr_sample_details.details ? # _pdbx_nmr_exptl_sample.solution_id 1 _pdbx_nmr_exptl_sample.component PDP-25 _pdbx_nmr_exptl_sample.concentration 2 _pdbx_nmr_exptl_sample.concentration_range ? _pdbx_nmr_exptl_sample.concentration_units mg/mL _pdbx_nmr_exptl_sample.isotopic_labeling 'natural abundance' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 3.5 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0 _pdbx_nmr_exptl_sample_conditions.details ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_err ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units mM _pdbx_nmr_exptl_sample_conditions.label 'Conditions 1' _pdbx_nmr_exptl_sample_conditions.pH_err ? _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 '2D 1H-1H NOESY' 1 isotropic 2 1 1 '2D 1H-1H TOCSY' 1 isotropic 3 1 1 '2D 1H-13C HSQC' 1 isotropic 4 1 1 '2D 1H-15N HSQC' 1 isotropic # _pdbx_nmr_refine.entry_id 9BF4 _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details 'Structures were calculated in CNS and energy minimised in explicit solvent.' _pdbx_nmr_refine.software_ordinal 5 # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 collection TopSpin ? 'Bruker Biospin' 2 processing TopSpin ? 'Bruker Biospin' 3 'chemical shift assignment' CARA ? 'Keller and Wuthrich' 4 'structure calculation' CYANA ? 'Guntert, Mumenthaler and Wuthrich' 5 refinement CNS 1.21 'Brunger, Adams, Clore, Gros, Nilges and Read' # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ASP N N N N 14 ASP CA C N S 15 ASP C C N N 16 ASP O O N N 17 ASP CB C N N 18 ASP CG C N N 19 ASP OD1 O N N 20 ASP OD2 O N N 21 ASP OXT O N N 22 ASP H H N N 23 ASP H2 H N N 24 ASP HA H N N 25 ASP HB2 H N N 26 ASP HB3 H N N 27 ASP HD2 H N N 28 ASP HXT H N N 29 CYS N N N N 30 CYS CA C N R 31 CYS C C N N 32 CYS O O N N 33 CYS CB C N N 34 CYS SG S N N 35 CYS OXT O N N 36 CYS H H N N 37 CYS H2 H N N 38 CYS HA H N N 39 CYS HB2 H N N 40 CYS HB3 H N N 41 CYS HG H N N 42 CYS HXT H N N 43 GLN N N N N 44 GLN CA C N S 45 GLN C C N N 46 GLN O O N N 47 GLN CB C N N 48 GLN CG C N N 49 GLN CD C N N 50 GLN OE1 O N N 51 GLN NE2 N N N 52 GLN OXT O N N 53 GLN H H N N 54 GLN H2 H N N 55 GLN HA H N N 56 GLN HB2 H N N 57 GLN HB3 H N N 58 GLN HG2 H N N 59 GLN HG3 H N N 60 GLN HE21 H N N 61 GLN HE22 H N N 62 GLN HXT H N N 63 GLY N N N N 64 GLY CA C N N 65 GLY C C N N 66 GLY O O N N 67 GLY OXT O N N 68 GLY H H N N 69 GLY H2 H N N 70 GLY HA2 H N N 71 GLY HA3 H N N 72 GLY HXT H N N 73 LEU N N N N 74 LEU CA C N S 75 LEU C C N N 76 LEU O O N N 77 LEU CB C N N 78 LEU CG C N N 79 LEU CD1 C N N 80 LEU CD2 C N N 81 LEU OXT O N N 82 LEU H H N N 83 LEU H2 H N N 84 LEU HA H N N 85 LEU HB2 H N N 86 LEU HB3 H N N 87 LEU HG H N N 88 LEU HD11 H N N 89 LEU HD12 H N N 90 LEU HD13 H N N 91 LEU HD21 H N N 92 LEU HD22 H N N 93 LEU HD23 H N N 94 LEU HXT H N N 95 MET N N N N 96 MET CA C N S 97 MET C C N N 98 MET O O N N 99 MET CB C N N 100 MET CG C N N 101 MET SD S N N 102 MET CE C N N 103 MET OXT O N N 104 MET H H N N 105 MET H2 H N N 106 MET HA H N N 107 MET HB2 H N N 108 MET HB3 H N N 109 MET HG2 H N N 110 MET HG3 H N N 111 MET HE1 H N N 112 MET HE2 H N N 113 MET HE3 H N N 114 MET HXT H N N 115 PHE N N N N 116 PHE CA C N S 117 PHE C C N N 118 PHE O O N N 119 PHE CB C N N 120 PHE CG C Y N 121 PHE CD1 C Y N 122 PHE CD2 C Y N 123 PHE CE1 C Y N 124 PHE CE2 C Y N 125 PHE CZ C Y N 126 PHE OXT O N N 127 PHE H H N N 128 PHE H2 H N N 129 PHE HA H N N 130 PHE HB2 H N N 131 PHE HB3 H N N 132 PHE HD1 H N N 133 PHE HD2 H N N 134 PHE HE1 H N N 135 PHE HE2 H N N 136 PHE HZ H N N 137 PHE HXT H N N 138 PRO N N N N 139 PRO CA C N S 140 PRO C C N N 141 PRO O O N N 142 PRO CB C N N 143 PRO CG C N N 144 PRO CD C N N 145 PRO OXT O N N 146 PRO H H N N 147 PRO HA H N N 148 PRO HB2 H N N 149 PRO HB3 H N N 150 PRO HG2 H N N 151 PRO HG3 H N N 152 PRO HD2 H N N 153 PRO HD3 H N N 154 PRO HXT H N N 155 SER N N N N 156 SER CA C N S 157 SER C C N N 158 SER O O N N 159 SER CB C N N 160 SER OG O N N 161 SER OXT O N N 162 SER H H N N 163 SER H2 H N N 164 SER HA H N N 165 SER HB2 H N N 166 SER HB3 H N N 167 SER HG H N N 168 SER HXT H N N 169 THR N N N N 170 THR CA C N S 171 THR C C N N 172 THR O O N N 173 THR CB C N R 174 THR OG1 O N N 175 THR CG2 C N N 176 THR OXT O N N 177 THR H H N N 178 THR H2 H N N 179 THR HA H N N 180 THR HB H N N 181 THR HG1 H N N 182 THR HG21 H N N 183 THR HG22 H N N 184 THR HG23 H N N 185 THR HXT H N N 186 TRP N N N N 187 TRP CA C N S 188 TRP C C N N 189 TRP O O N N 190 TRP CB C N N 191 TRP CG C Y N 192 TRP CD1 C Y N 193 TRP CD2 C Y N 194 TRP NE1 N Y N 195 TRP CE2 C Y N 196 TRP CE3 C Y N 197 TRP CZ2 C Y N 198 TRP CZ3 C Y N 199 TRP CH2 C Y N 200 TRP OXT O N N 201 TRP H H N N 202 TRP H2 H N N 203 TRP HA H N N 204 TRP HB2 H N N 205 TRP HB3 H N N 206 TRP HD1 H N N 207 TRP HE1 H N N 208 TRP HE3 H N N 209 TRP HZ2 H N N 210 TRP HZ3 H N N 211 TRP HH2 H N N 212 TRP HXT H N N 213 TYR N N N N 214 TYR CA C N S 215 TYR C C N N 216 TYR O O N N 217 TYR CB C N N 218 TYR CG C Y N 219 TYR CD1 C Y N 220 TYR CD2 C Y N 221 TYR CE1 C Y N 222 TYR CE2 C Y N 223 TYR CZ C Y N 224 TYR OH O N N 225 TYR OXT O N N 226 TYR H H N N 227 TYR H2 H N N 228 TYR HA H N N 229 TYR HB2 H N N 230 TYR HB3 H N N 231 TYR HD1 H N N 232 TYR HD2 H N N 233 TYR HE1 H N N 234 TYR HE2 H N N 235 TYR HH H N N 236 TYR HXT H N N 237 VAL N N N N 238 VAL CA C N S 239 VAL C C N N 240 VAL O O N N 241 VAL CB C N N 242 VAL CG1 C N N 243 VAL CG2 C N N 244 VAL OXT O N N 245 VAL H H N N 246 VAL H2 H N N 247 VAL HA H N N 248 VAL HB H N N 249 VAL HG11 H N N 250 VAL HG12 H N N 251 VAL HG13 H N N 252 VAL HG21 H N N 253 VAL HG22 H N N 254 VAL HG23 H N N 255 VAL HXT H N N 256 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ASP N CA sing N N 13 ASP N H sing N N 14 ASP N H2 sing N N 15 ASP CA C sing N N 16 ASP CA CB sing N N 17 ASP CA HA sing N N 18 ASP C O doub N N 19 ASP C OXT sing N N 20 ASP CB CG sing N N 21 ASP CB HB2 sing N N 22 ASP CB HB3 sing N N 23 ASP CG OD1 doub N N 24 ASP CG OD2 sing N N 25 ASP OD2 HD2 sing N N 26 ASP OXT HXT sing N N 27 CYS N CA sing N N 28 CYS N H sing N N 29 CYS N H2 sing N N 30 CYS CA C sing N N 31 CYS CA CB sing N N 32 CYS CA HA sing N N 33 CYS C O doub N N 34 CYS C OXT sing N N 35 CYS CB SG sing N N 36 CYS CB HB2 sing N N 37 CYS CB HB3 sing N N 38 CYS SG HG sing N N 39 CYS OXT HXT sing N N 40 GLN N CA sing N N 41 GLN N H sing N N 42 GLN N H2 sing N N 43 GLN CA C sing N N 44 GLN CA CB sing N N 45 GLN CA HA sing N N 46 GLN C O doub N N 47 GLN C OXT sing N N 48 GLN CB CG sing N N 49 GLN CB HB2 sing N N 50 GLN CB HB3 sing N N 51 GLN CG CD sing N N 52 GLN CG HG2 sing N N 53 GLN CG HG3 sing N N 54 GLN CD OE1 doub N N 55 GLN CD NE2 sing N N 56 GLN NE2 HE21 sing N N 57 GLN NE2 HE22 sing N N 58 GLN OXT HXT sing N N 59 GLY N CA sing N N 60 GLY N H sing N N 61 GLY N H2 sing N N 62 GLY CA C sing N N 63 GLY CA HA2 sing N N 64 GLY CA HA3 sing N N 65 GLY C O doub N N 66 GLY C OXT sing N N 67 GLY OXT HXT sing N N 68 LEU N CA sing N N 69 LEU N H sing N N 70 LEU N H2 sing N N 71 LEU CA C sing N N 72 LEU CA CB sing N N 73 LEU CA HA sing N N 74 LEU C O doub N N 75 LEU C OXT sing N N 76 LEU CB CG sing N N 77 LEU CB HB2 sing N N 78 LEU CB HB3 sing N N 79 LEU CG CD1 sing N N 80 LEU CG CD2 sing N N 81 LEU CG HG sing N N 82 LEU CD1 HD11 sing N N 83 LEU CD1 HD12 sing N N 84 LEU CD1 HD13 sing N N 85 LEU CD2 HD21 sing N N 86 LEU CD2 HD22 sing N N 87 LEU CD2 HD23 sing N N 88 LEU OXT HXT sing N N 89 MET N CA sing N N 90 MET N H sing N N 91 MET N H2 sing N N 92 MET CA C sing N N 93 MET CA CB sing N N 94 MET CA HA sing N N 95 MET C O doub N N 96 MET C OXT sing N N 97 MET CB CG sing N N 98 MET CB HB2 sing N N 99 MET CB HB3 sing N N 100 MET CG SD sing N N 101 MET CG HG2 sing N N 102 MET CG HG3 sing N N 103 MET SD CE sing N N 104 MET CE HE1 sing N N 105 MET CE HE2 sing N N 106 MET CE HE3 sing N N 107 MET OXT HXT sing N N 108 PHE N CA sing N N 109 PHE N H sing N N 110 PHE N H2 sing N N 111 PHE CA C sing N N 112 PHE CA CB sing N N 113 PHE CA HA sing N N 114 PHE C O doub N N 115 PHE C OXT sing N N 116 PHE CB CG sing N N 117 PHE CB HB2 sing N N 118 PHE CB HB3 sing N N 119 PHE CG CD1 doub Y N 120 PHE CG CD2 sing Y N 121 PHE CD1 CE1 sing Y N 122 PHE CD1 HD1 sing N N 123 PHE CD2 CE2 doub Y N 124 PHE CD2 HD2 sing N N 125 PHE CE1 CZ doub Y N 126 PHE CE1 HE1 sing N N 127 PHE CE2 CZ sing Y N 128 PHE CE2 HE2 sing N N 129 PHE CZ HZ sing N N 130 PHE OXT HXT sing N N 131 PRO N CA sing N N 132 PRO N CD sing N N 133 PRO N H sing N N 134 PRO CA C sing N N 135 PRO CA CB sing N N 136 PRO CA HA sing N N 137 PRO C O doub N N 138 PRO C OXT sing N N 139 PRO CB CG sing N N 140 PRO CB HB2 sing N N 141 PRO CB HB3 sing N N 142 PRO CG CD sing N N 143 PRO CG HG2 sing N N 144 PRO CG HG3 sing N N 145 PRO CD HD2 sing N N 146 PRO CD HD3 sing N N 147 PRO OXT HXT sing N N 148 SER N CA sing N N 149 SER N H sing N N 150 SER N H2 sing N N 151 SER CA C sing N N 152 SER CA CB sing N N 153 SER CA HA sing N N 154 SER C O doub N N 155 SER C OXT sing N N 156 SER CB OG sing N N 157 SER CB HB2 sing N N 158 SER CB HB3 sing N N 159 SER OG HG sing N N 160 SER OXT HXT sing N N 161 THR N CA sing N N 162 THR N H sing N N 163 THR N H2 sing N N 164 THR CA C sing N N 165 THR CA CB sing N N 166 THR CA HA sing N N 167 THR C O doub N N 168 THR C OXT sing N N 169 THR CB OG1 sing N N 170 THR CB CG2 sing N N 171 THR CB HB sing N N 172 THR OG1 HG1 sing N N 173 THR CG2 HG21 sing N N 174 THR CG2 HG22 sing N N 175 THR CG2 HG23 sing N N 176 THR OXT HXT sing N N 177 TRP N CA sing N N 178 TRP N H sing N N 179 TRP N H2 sing N N 180 TRP CA C sing N N 181 TRP CA CB sing N N 182 TRP CA HA sing N N 183 TRP C O doub N N 184 TRP C OXT sing N N 185 TRP CB CG sing N N 186 TRP CB HB2 sing N N 187 TRP CB HB3 sing N N 188 TRP CG CD1 doub Y N 189 TRP CG CD2 sing Y N 190 TRP CD1 NE1 sing Y N 191 TRP CD1 HD1 sing N N 192 TRP CD2 CE2 doub Y N 193 TRP CD2 CE3 sing Y N 194 TRP NE1 CE2 sing Y N 195 TRP NE1 HE1 sing N N 196 TRP CE2 CZ2 sing Y N 197 TRP CE3 CZ3 doub Y N 198 TRP CE3 HE3 sing N N 199 TRP CZ2 CH2 doub Y N 200 TRP CZ2 HZ2 sing N N 201 TRP CZ3 CH2 sing Y N 202 TRP CZ3 HZ3 sing N N 203 TRP CH2 HH2 sing N N 204 TRP OXT HXT sing N N 205 TYR N CA sing N N 206 TYR N H sing N N 207 TYR N H2 sing N N 208 TYR CA C sing N N 209 TYR CA CB sing N N 210 TYR CA HA sing N N 211 TYR C O doub N N 212 TYR C OXT sing N N 213 TYR CB CG sing N N 214 TYR CB HB2 sing N N 215 TYR CB HB3 sing N N 216 TYR CG CD1 doub Y N 217 TYR CG CD2 sing Y N 218 TYR CD1 CE1 sing Y N 219 TYR CD1 HD1 sing N N 220 TYR CD2 CE2 doub Y N 221 TYR CD2 HD2 sing N N 222 TYR CE1 CZ doub Y N 223 TYR CE1 HE1 sing N N 224 TYR CE2 CZ sing Y N 225 TYR CE2 HE2 sing N N 226 TYR CZ OH sing N N 227 TYR OH HH sing N N 228 TYR OXT HXT sing N N 229 VAL N CA sing N N 230 VAL N H sing N N 231 VAL N H2 sing N N 232 VAL CA C sing N N 233 VAL CA CB sing N N 234 VAL CA HA sing N N 235 VAL C O doub N N 236 VAL C OXT sing N N 237 VAL CB CG1 sing N N 238 VAL CB CG2 sing N N 239 VAL CB HB sing N N 240 VAL CG1 HG11 sing N N 241 VAL CG1 HG12 sing N N 242 VAL CG1 HG13 sing N N 243 VAL CG2 HG21 sing N N 244 VAL CG2 HG22 sing N N 245 VAL CG2 HG23 sing N N 246 VAL OXT HXT sing N N 247 # _pdbx_audit_support.funding_organization 'Australian Research Council (ARC)' _pdbx_audit_support.country Australia _pdbx_audit_support.grant_number DP190102058 _pdbx_audit_support.ordinal 1 # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model 'AVANCE III HD' _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 700 _pdbx_nmr_spectrometer.details 'equipped with cryoprobe' # _atom_sites.entry_id 9BF4 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C H N O S # loop_ #