data_9CCE # _entry.id 9CCE # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.404 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 9CCE pdb_00009cce 10.2210/pdb9cce/pdb WWPDB D_1000285011 ? ? # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2025-08-13 _pdbx_audit_revision_history.part_number ? # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 9CCE _pdbx_database_status.recvd_initial_deposition_date 2024-06-21 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_contact_author.id 2 _pdbx_contact_author.email dabaker@uw.edu _pdbx_contact_author.name_first David _pdbx_contact_author.name_last Baker _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0001-7896-6217 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Bera, A.K.' 1 ? 'Wu, K.' 2 ? 'Kang, A.' 3 ? 'Baker, D.' 4 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Science _citation.journal_id_ASTM SCIEAS _citation.journal_id_CSD 0038 _citation.journal_id_ISSN 1095-9203 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 389 _citation.language ? _citation.page_first eadr8063 _citation.page_last eadr8063 _citation.title 'Design of intrinsically disordered region binding proteins.' _citation.year 2025 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1126/science.adr8063 _citation.pdbx_database_id_PubMed 40674483 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Wu, K.' 1 0000-0002-4532-4290 primary 'Jiang, H.' 2 0000-0002-4649-1584 primary 'Hicks, D.R.' 3 0000-0003-2950-1848 primary 'Liu, C.' 4 ? primary 'Muratspahic, E.' 5 ? primary 'Ramelot, T.A.' 6 0000-0002-0335-1573 primary 'Liu, Y.' 7 ? primary 'McNally, K.' 8 0000-0003-2376-3003 primary 'Kenny, S.' 9 0000-0003-3541-2577 primary 'Mihut, A.' 10 0000-0003-4241-2567 primary 'Gaur, A.' 11 ? primary 'Coventry, B.' 12 0000-0002-6910-6255 primary 'Chen, W.' 13 0000-0002-5255-4166 primary 'Bera, A.K.' 14 0000-0001-9473-2912 primary 'Kang, A.' 15 0000-0001-5487-0499 primary 'Gerben, S.' 16 0000-0003-0313-6248 primary 'Lamb, M.Y.' 17 0000-0002-7318-1805 primary 'Murray, A.' 18 0000-0003-1560-6673 primary 'Li, X.' 19 0000-0001-5559-7578 primary 'Kennedy, M.A.' 20 0000-0003-3422-9172 primary 'Yang, W.' 21 ? primary 'Song, Z.' 22 ? primary 'Schober, G.' 23 ? primary 'Brierley, S.M.' 24 0000-0002-2527-2905 primary ;O'Neill, J. ; 25 0000-0003-2204-6096 primary 'Gelb, M.H.' 26 0000-0001-7000-5219 primary 'Montelione, G.T.' 27 0000-0002-9440-3059 primary 'Derivery, E.' 28 0000-0003-3927-5944 primary 'Baker, D.' 29 0000-0001-7896-6217 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man DYNA_1b7 25195.525 2 ? ? ? ? 2 polymer syn 'Dynorphin A(1-17)' 2152.524 2 ? ? ? ? # _entity_name_com.entity_id 2 _entity_name_com.name 'Dyn-A17,Dynorphin A' # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no ;MSGKEEEIEKEFEEKKKIIEENLKEAEEEGEEEAAEKLKEALKKLEEAIKLHREGANPVEVELEEVTAIILNNLAVLLRE GEEELAKELEKAIKLLEEKKDAPEEERLKAIAIAIIRSVLVLIKWEGGKDEETIEEIEEILENRENLSLEELREAYVRAE IAYLIESGIDPEAAKKVREKYERGAPLEELLKDIEKIEKEAKKREEEKKGSHHHHHH ; ;MSGKEEEIEKEFEEKKKIIEENLKEAEEEGEEEAAEKLKEALKKLEEAIKLHREGANPVEVELEEVTAIILNNLAVLLRE GEEELAKELEKAIKLLEEKKDAPEEERLKAIAIAIIRSVLVLIKWEGGKDEETIEEIEEILENRENLSLEELREAYVRAE IAYLIESGIDPEAAKKVREKYERGAPLEELLKDIEKIEKEAKKREEEKKGSHHHHHH ; A,B ? 2 'polypeptide(L)' no no YGGFLRRIRPKLKWDNQ YGGFLRRIRPKLKWDNQ C,D ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 SER n 1 3 GLY n 1 4 LYS n 1 5 GLU n 1 6 GLU n 1 7 GLU n 1 8 ILE n 1 9 GLU n 1 10 LYS n 1 11 GLU n 1 12 PHE n 1 13 GLU n 1 14 GLU n 1 15 LYS n 1 16 LYS n 1 17 LYS n 1 18 ILE n 1 19 ILE n 1 20 GLU n 1 21 GLU n 1 22 ASN n 1 23 LEU n 1 24 LYS n 1 25 GLU n 1 26 ALA n 1 27 GLU n 1 28 GLU n 1 29 GLU n 1 30 GLY n 1 31 GLU n 1 32 GLU n 1 33 GLU n 1 34 ALA n 1 35 ALA n 1 36 GLU n 1 37 LYS n 1 38 LEU n 1 39 LYS n 1 40 GLU n 1 41 ALA n 1 42 LEU n 1 43 LYS n 1 44 LYS n 1 45 LEU n 1 46 GLU n 1 47 GLU n 1 48 ALA n 1 49 ILE n 1 50 LYS n 1 51 LEU n 1 52 HIS n 1 53 ARG n 1 54 GLU n 1 55 GLY n 1 56 ALA n 1 57 ASN n 1 58 PRO n 1 59 VAL n 1 60 GLU n 1 61 VAL n 1 62 GLU n 1 63 LEU n 1 64 GLU n 1 65 GLU n 1 66 VAL n 1 67 THR n 1 68 ALA n 1 69 ILE n 1 70 ILE n 1 71 LEU n 1 72 ASN n 1 73 ASN n 1 74 LEU n 1 75 ALA n 1 76 VAL n 1 77 LEU n 1 78 LEU n 1 79 ARG n 1 80 GLU n 1 81 GLY n 1 82 GLU n 1 83 GLU n 1 84 GLU n 1 85 LEU n 1 86 ALA n 1 87 LYS n 1 88 GLU n 1 89 LEU n 1 90 GLU n 1 91 LYS n 1 92 ALA n 1 93 ILE n 1 94 LYS n 1 95 LEU n 1 96 LEU n 1 97 GLU n 1 98 GLU n 1 99 LYS n 1 100 LYS n 1 101 ASP n 1 102 ALA n 1 103 PRO n 1 104 GLU n 1 105 GLU n 1 106 GLU n 1 107 ARG n 1 108 LEU n 1 109 LYS n 1 110 ALA n 1 111 ILE n 1 112 ALA n 1 113 ILE n 1 114 ALA n 1 115 ILE n 1 116 ILE n 1 117 ARG n 1 118 SER n 1 119 VAL n 1 120 LEU n 1 121 VAL n 1 122 LEU n 1 123 ILE n 1 124 LYS n 1 125 TRP n 1 126 GLU n 1 127 GLY n 1 128 GLY n 1 129 LYS n 1 130 ASP n 1 131 GLU n 1 132 GLU n 1 133 THR n 1 134 ILE n 1 135 GLU n 1 136 GLU n 1 137 ILE n 1 138 GLU n 1 139 GLU n 1 140 ILE n 1 141 LEU n 1 142 GLU n 1 143 ASN n 1 144 ARG n 1 145 GLU n 1 146 ASN n 1 147 LEU n 1 148 SER n 1 149 LEU n 1 150 GLU n 1 151 GLU n 1 152 LEU n 1 153 ARG n 1 154 GLU n 1 155 ALA n 1 156 TYR n 1 157 VAL n 1 158 ARG n 1 159 ALA n 1 160 GLU n 1 161 ILE n 1 162 ALA n 1 163 TYR n 1 164 LEU n 1 165 ILE n 1 166 GLU n 1 167 SER n 1 168 GLY n 1 169 ILE n 1 170 ASP n 1 171 PRO n 1 172 GLU n 1 173 ALA n 1 174 ALA n 1 175 LYS n 1 176 LYS n 1 177 VAL n 1 178 ARG n 1 179 GLU n 1 180 LYS n 1 181 TYR n 1 182 GLU n 1 183 ARG n 1 184 GLY n 1 185 ALA n 1 186 PRO n 1 187 LEU n 1 188 GLU n 1 189 GLU n 1 190 LEU n 1 191 LEU n 1 192 LYS n 1 193 ASP n 1 194 ILE n 1 195 GLU n 1 196 LYS n 1 197 ILE n 1 198 GLU n 1 199 LYS n 1 200 GLU n 1 201 ALA n 1 202 LYS n 1 203 LYS n 1 204 ARG n 1 205 GLU n 1 206 GLU n 1 207 GLU n 1 208 LYS n 1 209 LYS n 1 210 GLY n 1 211 SER n 1 212 HIS n 1 213 HIS n 1 214 HIS n 1 215 HIS n 1 216 HIS n 1 217 HIS n 2 1 TYR n 2 2 GLY n 2 3 GLY n 2 4 PHE n 2 5 LEU n 2 6 ARG n 2 7 ARG n 2 8 ILE n 2 9 ARG n 2 10 PRO n 2 11 LYS n 2 12 LEU n 2 13 LYS n 2 14 TRP n 2 15 ASP n 2 16 ASN n 2 17 GLN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 217 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'synthetic construct' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 32630 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _pdbx_entity_src_syn.entity_id 2 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num 1 _pdbx_entity_src_syn.pdbx_end_seq_num 17 _pdbx_entity_src_syn.organism_scientific 'Homo sapiens' _pdbx_entity_src_syn.organism_common_name human _pdbx_entity_src_syn.ncbi_taxonomy_id 9606 _pdbx_entity_src_syn.details ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 -2 ? ? ? A . n A 1 2 SER 2 -1 ? ? ? A . n A 1 3 GLY 3 0 ? ? ? A . n A 1 4 LYS 4 1 ? ? ? A . n A 1 5 GLU 5 2 ? ? ? A . n A 1 6 GLU 6 3 3 GLU GLU A . n A 1 7 GLU 7 4 4 GLU GLU A . n A 1 8 ILE 8 5 5 ILE ILE A . n A 1 9 GLU 9 6 6 GLU GLU A . n A 1 10 LYS 10 7 7 LYS LYS A . n A 1 11 GLU 11 8 8 GLU GLU A . n A 1 12 PHE 12 9 9 PHE PHE A . n A 1 13 GLU 13 10 10 GLU GLU A . n A 1 14 GLU 14 11 11 GLU GLU A . n A 1 15 LYS 15 12 12 LYS LYS A . n A 1 16 LYS 16 13 13 LYS LYS A . n A 1 17 LYS 17 14 14 LYS LYS A . n A 1 18 ILE 18 15 15 ILE ILE A . n A 1 19 ILE 19 16 16 ILE ILE A . n A 1 20 GLU 20 17 17 GLU GLU A . n A 1 21 GLU 21 18 18 GLU GLU A . n A 1 22 ASN 22 19 19 ASN ASN A . n A 1 23 LEU 23 20 20 LEU LEU A . n A 1 24 LYS 24 21 21 LYS LYS A . n A 1 25 GLU 25 22 22 GLU GLU A . n A 1 26 ALA 26 23 23 ALA ALA A . n A 1 27 GLU 27 24 24 GLU GLU A . n A 1 28 GLU 28 25 25 GLU GLU A . n A 1 29 GLU 29 26 26 GLU GLU A . n A 1 30 GLY 30 27 27 GLY GLY A . n A 1 31 GLU 31 28 28 GLU GLU A . n A 1 32 GLU 32 29 29 GLU GLU A . n A 1 33 GLU 33 30 30 GLU GLU A . n A 1 34 ALA 34 31 31 ALA ALA A . n A 1 35 ALA 35 32 32 ALA ALA A . n A 1 36 GLU 36 33 33 GLU GLU A . n A 1 37 LYS 37 34 34 LYS LYS A . n A 1 38 LEU 38 35 35 LEU LEU A . n A 1 39 LYS 39 36 36 LYS LYS A . n A 1 40 GLU 40 37 37 GLU GLU A . n A 1 41 ALA 41 38 38 ALA ALA A . n A 1 42 LEU 42 39 39 LEU LEU A . n A 1 43 LYS 43 40 40 LYS LYS A . n A 1 44 LYS 44 41 41 LYS LYS A . n A 1 45 LEU 45 42 42 LEU LEU A . n A 1 46 GLU 46 43 43 GLU GLU A . n A 1 47 GLU 47 44 44 GLU GLU A . n A 1 48 ALA 48 45 45 ALA ALA A . n A 1 49 ILE 49 46 46 ILE ILE A . n A 1 50 LYS 50 47 47 LYS LYS A . n A 1 51 LEU 51 48 48 LEU LEU A . n A 1 52 HIS 52 49 49 HIS HIS A . n A 1 53 ARG 53 50 50 ARG ARG A . n A 1 54 GLU 54 51 51 GLU GLU A . n A 1 55 GLY 55 52 52 GLY GLY A . n A 1 56 ALA 56 53 53 ALA ALA A . n A 1 57 ASN 57 54 54 ASN ASN A . n A 1 58 PRO 58 55 55 PRO PRO A . n A 1 59 VAL 59 56 56 VAL VAL A . n A 1 60 GLU 60 57 57 GLU GLU A . n A 1 61 VAL 61 58 58 VAL VAL A . n A 1 62 GLU 62 59 59 GLU GLU A . n A 1 63 LEU 63 60 60 LEU LEU A . n A 1 64 GLU 64 61 61 GLU GLU A . n A 1 65 GLU 65 62 62 GLU GLU A . n A 1 66 VAL 66 63 63 VAL VAL A . n A 1 67 THR 67 64 64 THR THR A . n A 1 68 ALA 68 65 65 ALA ALA A . n A 1 69 ILE 69 66 66 ILE ILE A . n A 1 70 ILE 70 67 67 ILE ILE A . n A 1 71 LEU 71 68 68 LEU LEU A . n A 1 72 ASN 72 69 69 ASN ASN A . n A 1 73 ASN 73 70 70 ASN ASN A . n A 1 74 LEU 74 71 71 LEU LEU A . n A 1 75 ALA 75 72 72 ALA ALA A . n A 1 76 VAL 76 73 73 VAL VAL A . n A 1 77 LEU 77 74 74 LEU LEU A . n A 1 78 LEU 78 75 75 LEU LEU A . n A 1 79 ARG 79 76 76 ARG ARG A . n A 1 80 GLU 80 77 77 GLU GLU A . n A 1 81 GLY 81 78 78 GLY GLY A . n A 1 82 GLU 82 79 79 GLU GLU A . n A 1 83 GLU 83 80 80 GLU GLU A . n A 1 84 GLU 84 81 81 GLU GLU A . n A 1 85 LEU 85 82 82 LEU LEU A . n A 1 86 ALA 86 83 83 ALA ALA A . n A 1 87 LYS 87 84 84 LYS LYS A . n A 1 88 GLU 88 85 85 GLU GLU A . n A 1 89 LEU 89 86 86 LEU LEU A . n A 1 90 GLU 90 87 87 GLU GLU A . n A 1 91 LYS 91 88 88 LYS LYS A . n A 1 92 ALA 92 89 89 ALA ALA A . n A 1 93 ILE 93 90 90 ILE ILE A . n A 1 94 LYS 94 91 91 LYS LYS A . n A 1 95 LEU 95 92 92 LEU LEU A . n A 1 96 LEU 96 93 93 LEU LEU A . n A 1 97 GLU 97 94 94 GLU GLU A . n A 1 98 GLU 98 95 95 GLU GLU A . n A 1 99 LYS 99 96 96 LYS LYS A . n A 1 100 LYS 100 97 97 LYS LYS A . n A 1 101 ASP 101 98 98 ASP ASP A . n A 1 102 ALA 102 99 99 ALA ALA A . n A 1 103 PRO 103 100 100 PRO PRO A . n A 1 104 GLU 104 101 101 GLU GLU A . n A 1 105 GLU 105 102 102 GLU GLU A . n A 1 106 GLU 106 103 103 GLU GLU A . n A 1 107 ARG 107 104 104 ARG ARG A . n A 1 108 LEU 108 105 105 LEU LEU A . n A 1 109 LYS 109 106 106 LYS LYS A . n A 1 110 ALA 110 107 107 ALA ALA A . n A 1 111 ILE 111 108 108 ILE ILE A . n A 1 112 ALA 112 109 109 ALA ALA A . n A 1 113 ILE 113 110 110 ILE ILE A . n A 1 114 ALA 114 111 111 ALA ALA A . n A 1 115 ILE 115 112 112 ILE ILE A . n A 1 116 ILE 116 113 113 ILE ILE A . n A 1 117 ARG 117 114 114 ARG ARG A . n A 1 118 SER 118 115 115 SER SER A . n A 1 119 VAL 119 116 116 VAL VAL A . n A 1 120 LEU 120 117 117 LEU LEU A . n A 1 121 VAL 121 118 118 VAL VAL A . n A 1 122 LEU 122 119 119 LEU LEU A . n A 1 123 ILE 123 120 120 ILE ILE A . n A 1 124 LYS 124 121 121 LYS LYS A . n A 1 125 TRP 125 122 122 TRP TRP A . n A 1 126 GLU 126 123 123 GLU GLU A . n A 1 127 GLY 127 124 124 GLY GLY A . n A 1 128 GLY 128 125 125 GLY GLY A . n A 1 129 LYS 129 126 ? ? ? A . n A 1 130 ASP 130 127 127 ASP ASP A . n A 1 131 GLU 131 128 128 GLU GLU A . n A 1 132 GLU 132 129 129 GLU GLU A . n A 1 133 THR 133 130 130 THR THR A . n A 1 134 ILE 134 131 131 ILE ILE A . n A 1 135 GLU 135 132 132 GLU GLU A . n A 1 136 GLU 136 133 133 GLU GLU A . n A 1 137 ILE 137 134 134 ILE ILE A . n A 1 138 GLU 138 135 135 GLU GLU A . n A 1 139 GLU 139 136 136 GLU GLU A . n A 1 140 ILE 140 137 137 ILE ILE A . n A 1 141 LEU 141 138 138 LEU LEU A . n A 1 142 GLU 142 139 139 GLU GLU A . n A 1 143 ASN 143 140 140 ASN ASN A . n A 1 144 ARG 144 141 141 ARG ARG A . n A 1 145 GLU 145 142 142 GLU GLU A . n A 1 146 ASN 146 143 143 ASN ASN A . n A 1 147 LEU 147 144 144 LEU LEU A . n A 1 148 SER 148 145 145 SER SER A . n A 1 149 LEU 149 146 146 LEU LEU A . n A 1 150 GLU 150 147 147 GLU GLU A . n A 1 151 GLU 151 148 148 GLU GLU A . n A 1 152 LEU 152 149 149 LEU LEU A . n A 1 153 ARG 153 150 150 ARG ARG A . n A 1 154 GLU 154 151 151 GLU GLU A . n A 1 155 ALA 155 152 152 ALA ALA A . n A 1 156 TYR 156 153 153 TYR TYR A . n A 1 157 VAL 157 154 154 VAL VAL A . n A 1 158 ARG 158 155 155 ARG ARG A . n A 1 159 ALA 159 156 156 ALA ALA A . n A 1 160 GLU 160 157 157 GLU GLU A . n A 1 161 ILE 161 158 158 ILE ILE A . n A 1 162 ALA 162 159 159 ALA ALA A . n A 1 163 TYR 163 160 160 TYR TYR A . n A 1 164 LEU 164 161 161 LEU LEU A . n A 1 165 ILE 165 162 162 ILE ILE A . n A 1 166 GLU 166 163 163 GLU GLU A . n A 1 167 SER 167 164 164 SER SER A . n A 1 168 GLY 168 165 165 GLY GLY A . n A 1 169 ILE 169 166 166 ILE ILE A . n A 1 170 ASP 170 167 ? ? ? A . n A 1 171 PRO 171 168 168 PRO PRO A . n A 1 172 GLU 172 169 169 GLU GLU A . n A 1 173 ALA 173 170 170 ALA ALA A . n A 1 174 ALA 174 171 171 ALA ALA A . n A 1 175 LYS 175 172 172 LYS LYS A . n A 1 176 LYS 176 173 173 LYS LYS A . n A 1 177 VAL 177 174 174 VAL VAL A . n A 1 178 ARG 178 175 175 ARG ARG A . n A 1 179 GLU 179 176 176 GLU GLU A . n A 1 180 LYS 180 177 177 LYS LYS A . n A 1 181 TYR 181 178 178 TYR TYR A . n A 1 182 GLU 182 179 179 GLU GLU A . n A 1 183 ARG 183 180 180 ARG ARG A . n A 1 184 GLY 184 181 181 GLY GLY A . n A 1 185 ALA 185 182 182 ALA ALA A . n A 1 186 PRO 186 183 183 PRO PRO A . n A 1 187 LEU 187 184 184 LEU LEU A . n A 1 188 GLU 188 185 185 GLU GLU A . n A 1 189 GLU 189 186 186 GLU GLU A . n A 1 190 LEU 190 187 187 LEU LEU A . n A 1 191 LEU 191 188 188 LEU LEU A . n A 1 192 LYS 192 189 189 LYS LYS A . n A 1 193 ASP 193 190 190 ASP ASP A . n A 1 194 ILE 194 191 191 ILE ILE A . n A 1 195 GLU 195 192 192 GLU GLU A . n A 1 196 LYS 196 193 193 LYS LYS A . n A 1 197 ILE 197 194 194 ILE ILE A . n A 1 198 GLU 198 195 195 GLU GLU A . n A 1 199 LYS 199 196 196 LYS LYS A . n A 1 200 GLU 200 197 197 GLU GLU A . n A 1 201 ALA 201 198 198 ALA ALA A . n A 1 202 LYS 202 199 199 LYS LYS A . n A 1 203 LYS 203 200 ? ? ? A . n A 1 204 ARG 204 201 ? ? ? A . n A 1 205 GLU 205 202 ? ? ? A . n A 1 206 GLU 206 203 ? ? ? A . n A 1 207 GLU 207 204 ? ? ? A . n A 1 208 LYS 208 205 ? ? ? A . n A 1 209 LYS 209 206 ? ? ? A . n A 1 210 GLY 210 207 ? ? ? A . n A 1 211 SER 211 208 ? ? ? A . n A 1 212 HIS 212 209 ? ? ? A . n A 1 213 HIS 213 210 ? ? ? A . n A 1 214 HIS 214 211 ? ? ? A . n A 1 215 HIS 215 212 ? ? ? A . n A 1 216 HIS 216 213 ? ? ? A . n A 1 217 HIS 217 214 ? ? ? A . n B 1 1 MET 1 -2 ? ? ? B . n B 1 2 SER 2 -1 ? ? ? B . n B 1 3 GLY 3 0 ? ? ? B . n B 1 4 LYS 4 1 ? ? ? B . n B 1 5 GLU 5 2 ? ? ? B . n B 1 6 GLU 6 3 ? ? ? B . n B 1 7 GLU 7 4 4 GLU GLU B . n B 1 8 ILE 8 5 5 ILE ILE B . n B 1 9 GLU 9 6 6 GLU GLU B . n B 1 10 LYS 10 7 7 LYS LYS B . n B 1 11 GLU 11 8 8 GLU GLU B . n B 1 12 PHE 12 9 9 PHE PHE B . n B 1 13 GLU 13 10 10 GLU GLU B . n B 1 14 GLU 14 11 11 GLU GLU B . n B 1 15 LYS 15 12 12 LYS LYS B . n B 1 16 LYS 16 13 13 LYS LYS B . n B 1 17 LYS 17 14 14 LYS LYS B . n B 1 18 ILE 18 15 15 ILE ILE B . n B 1 19 ILE 19 16 16 ILE ILE B . n B 1 20 GLU 20 17 17 GLU GLU B . n B 1 21 GLU 21 18 18 GLU GLU B . n B 1 22 ASN 22 19 19 ASN ASN B . n B 1 23 LEU 23 20 20 LEU LEU B . n B 1 24 LYS 24 21 21 LYS LYS B . n B 1 25 GLU 25 22 22 GLU GLU B . n B 1 26 ALA 26 23 23 ALA ALA B . n B 1 27 GLU 27 24 24 GLU GLU B . n B 1 28 GLU 28 25 25 GLU GLU B . n B 1 29 GLU 29 26 26 GLU GLU B . n B 1 30 GLY 30 27 27 GLY GLY B . n B 1 31 GLU 31 28 28 GLU GLU B . n B 1 32 GLU 32 29 29 GLU GLU B . n B 1 33 GLU 33 30 30 GLU GLU B . n B 1 34 ALA 34 31 31 ALA ALA B . n B 1 35 ALA 35 32 32 ALA ALA B . n B 1 36 GLU 36 33 33 GLU GLU B . n B 1 37 LYS 37 34 34 LYS LYS B . n B 1 38 LEU 38 35 35 LEU LEU B . n B 1 39 LYS 39 36 36 LYS LYS B . n B 1 40 GLU 40 37 37 GLU GLU B . n B 1 41 ALA 41 38 38 ALA ALA B . n B 1 42 LEU 42 39 39 LEU LEU B . n B 1 43 LYS 43 40 40 LYS LYS B . n B 1 44 LYS 44 41 41 LYS LYS B . n B 1 45 LEU 45 42 42 LEU LEU B . n B 1 46 GLU 46 43 43 GLU GLU B . n B 1 47 GLU 47 44 44 GLU GLU B . n B 1 48 ALA 48 45 45 ALA ALA B . n B 1 49 ILE 49 46 46 ILE ILE B . n B 1 50 LYS 50 47 47 LYS LYS B . n B 1 51 LEU 51 48 48 LEU LEU B . n B 1 52 HIS 52 49 49 HIS HIS B . n B 1 53 ARG 53 50 50 ARG ARG B . n B 1 54 GLU 54 51 51 GLU GLU B . n B 1 55 GLY 55 52 52 GLY GLY B . n B 1 56 ALA 56 53 53 ALA ALA B . n B 1 57 ASN 57 54 54 ASN ASN B . n B 1 58 PRO 58 55 55 PRO PRO B . n B 1 59 VAL 59 56 56 VAL VAL B . n B 1 60 GLU 60 57 57 GLU GLU B . n B 1 61 VAL 61 58 58 VAL VAL B . n B 1 62 GLU 62 59 59 GLU GLU B . n B 1 63 LEU 63 60 60 LEU LEU B . n B 1 64 GLU 64 61 61 GLU GLU B . n B 1 65 GLU 65 62 62 GLU GLU B . n B 1 66 VAL 66 63 63 VAL VAL B . n B 1 67 THR 67 64 64 THR THR B . n B 1 68 ALA 68 65 65 ALA ALA B . n B 1 69 ILE 69 66 66 ILE ILE B . n B 1 70 ILE 70 67 67 ILE ILE B . n B 1 71 LEU 71 68 68 LEU LEU B . n B 1 72 ASN 72 69 69 ASN ASN B . n B 1 73 ASN 73 70 70 ASN ASN B . n B 1 74 LEU 74 71 71 LEU LEU B . n B 1 75 ALA 75 72 72 ALA ALA B . n B 1 76 VAL 76 73 73 VAL VAL B . n B 1 77 LEU 77 74 74 LEU LEU B . n B 1 78 LEU 78 75 75 LEU LEU B . n B 1 79 ARG 79 76 76 ARG ARG B . n B 1 80 GLU 80 77 77 GLU GLU B . n B 1 81 GLY 81 78 78 GLY GLY B . n B 1 82 GLU 82 79 79 GLU GLU B . n B 1 83 GLU 83 80 80 GLU GLU B . n B 1 84 GLU 84 81 81 GLU GLU B . n B 1 85 LEU 85 82 82 LEU LEU B . n B 1 86 ALA 86 83 83 ALA ALA B . n B 1 87 LYS 87 84 84 LYS LYS B . n B 1 88 GLU 88 85 85 GLU GLU B . n B 1 89 LEU 89 86 86 LEU LEU B . n B 1 90 GLU 90 87 87 GLU GLU B . n B 1 91 LYS 91 88 88 LYS LYS B . n B 1 92 ALA 92 89 89 ALA ALA B . n B 1 93 ILE 93 90 90 ILE ILE B . n B 1 94 LYS 94 91 91 LYS LYS B . n B 1 95 LEU 95 92 92 LEU LEU B . n B 1 96 LEU 96 93 93 LEU LEU B . n B 1 97 GLU 97 94 94 GLU GLU B . n B 1 98 GLU 98 95 95 GLU GLU B . n B 1 99 LYS 99 96 96 LYS LYS B . n B 1 100 LYS 100 97 97 LYS LYS B . n B 1 101 ASP 101 98 98 ASP ASP B . n B 1 102 ALA 102 99 99 ALA ALA B . n B 1 103 PRO 103 100 100 PRO PRO B . n B 1 104 GLU 104 101 101 GLU GLU B . n B 1 105 GLU 105 102 102 GLU GLU B . n B 1 106 GLU 106 103 103 GLU GLU B . n B 1 107 ARG 107 104 104 ARG ARG B . n B 1 108 LEU 108 105 105 LEU LEU B . n B 1 109 LYS 109 106 106 LYS LYS B . n B 1 110 ALA 110 107 107 ALA ALA B . n B 1 111 ILE 111 108 108 ILE ILE B . n B 1 112 ALA 112 109 109 ALA ALA B . n B 1 113 ILE 113 110 110 ILE ILE B . n B 1 114 ALA 114 111 111 ALA ALA B . n B 1 115 ILE 115 112 112 ILE ILE B . n B 1 116 ILE 116 113 113 ILE ILE B . n B 1 117 ARG 117 114 114 ARG ARG B . n B 1 118 SER 118 115 115 SER SER B . n B 1 119 VAL 119 116 116 VAL VAL B . n B 1 120 LEU 120 117 117 LEU LEU B . n B 1 121 VAL 121 118 118 VAL VAL B . n B 1 122 LEU 122 119 119 LEU LEU B . n B 1 123 ILE 123 120 120 ILE ILE B . n B 1 124 LYS 124 121 121 LYS LYS B . n B 1 125 TRP 125 122 122 TRP TRP B . n B 1 126 GLU 126 123 123 GLU GLU B . n B 1 127 GLY 127 124 124 GLY GLY B . n B 1 128 GLY 128 125 ? ? ? B . n B 1 129 LYS 129 126 ? ? ? B . n B 1 130 ASP 130 127 127 ASP ASP B . n B 1 131 GLU 131 128 128 GLU GLU B . n B 1 132 GLU 132 129 129 GLU GLU B . n B 1 133 THR 133 130 130 THR THR B . n B 1 134 ILE 134 131 131 ILE ILE B . n B 1 135 GLU 135 132 132 GLU GLU B . n B 1 136 GLU 136 133 133 GLU GLU B . n B 1 137 ILE 137 134 134 ILE ILE B . n B 1 138 GLU 138 135 135 GLU GLU B . n B 1 139 GLU 139 136 136 GLU GLU B . n B 1 140 ILE 140 137 137 ILE ILE B . n B 1 141 LEU 141 138 138 LEU LEU B . n B 1 142 GLU 142 139 139 GLU GLU B . n B 1 143 ASN 143 140 140 ASN ASN B . n B 1 144 ARG 144 141 141 ARG ARG B . n B 1 145 GLU 145 142 142 GLU GLU B . n B 1 146 ASN 146 143 143 ASN ASN B . n B 1 147 LEU 147 144 144 LEU LEU B . n B 1 148 SER 148 145 145 SER SER B . n B 1 149 LEU 149 146 146 LEU LEU B . n B 1 150 GLU 150 147 147 GLU GLU B . n B 1 151 GLU 151 148 148 GLU GLU B . n B 1 152 LEU 152 149 149 LEU LEU B . n B 1 153 ARG 153 150 150 ARG ARG B . n B 1 154 GLU 154 151 151 GLU GLU B . n B 1 155 ALA 155 152 152 ALA ALA B . n B 1 156 TYR 156 153 153 TYR TYR B . n B 1 157 VAL 157 154 154 VAL VAL B . n B 1 158 ARG 158 155 155 ARG ARG B . n B 1 159 ALA 159 156 156 ALA ALA B . n B 1 160 GLU 160 157 157 GLU GLU B . n B 1 161 ILE 161 158 158 ILE ILE B . n B 1 162 ALA 162 159 159 ALA ALA B . n B 1 163 TYR 163 160 160 TYR TYR B . n B 1 164 LEU 164 161 161 LEU LEU B . n B 1 165 ILE 165 162 162 ILE ILE B . n B 1 166 GLU 166 163 163 GLU GLU B . n B 1 167 SER 167 164 164 SER SER B . n B 1 168 GLY 168 165 165 GLY GLY B . n B 1 169 ILE 169 166 166 ILE ILE B . n B 1 170 ASP 170 167 167 ASP ASP B . n B 1 171 PRO 171 168 168 PRO PRO B . n B 1 172 GLU 172 169 169 GLU GLU B . n B 1 173 ALA 173 170 170 ALA ALA B . n B 1 174 ALA 174 171 171 ALA ALA B . n B 1 175 LYS 175 172 172 LYS LYS B . n B 1 176 LYS 176 173 173 LYS LYS B . n B 1 177 VAL 177 174 174 VAL VAL B . n B 1 178 ARG 178 175 175 ARG ARG B . n B 1 179 GLU 179 176 176 GLU GLU B . n B 1 180 LYS 180 177 177 LYS LYS B . n B 1 181 TYR 181 178 178 TYR TYR B . n B 1 182 GLU 182 179 179 GLU GLU B . n B 1 183 ARG 183 180 180 ARG ARG B . n B 1 184 GLY 184 181 181 GLY GLY B . n B 1 185 ALA 185 182 182 ALA ALA B . n B 1 186 PRO 186 183 183 PRO PRO B . n B 1 187 LEU 187 184 184 LEU LEU B . n B 1 188 GLU 188 185 185 GLU GLU B . n B 1 189 GLU 189 186 186 GLU GLU B . n B 1 190 LEU 190 187 187 LEU LEU B . n B 1 191 LEU 191 188 188 LEU LEU B . n B 1 192 LYS 192 189 189 LYS LYS B . n B 1 193 ASP 193 190 190 ASP ASP B . n B 1 194 ILE 194 191 191 ILE ILE B . n B 1 195 GLU 195 192 192 GLU GLU B . n B 1 196 LYS 196 193 193 LYS LYS B . n B 1 197 ILE 197 194 194 ILE ILE B . n B 1 198 GLU 198 195 195 GLU GLU B . n B 1 199 LYS 199 196 196 LYS LYS B . n B 1 200 GLU 200 197 197 GLU GLU B . n B 1 201 ALA 201 198 198 ALA ALA B . n B 1 202 LYS 202 199 199 LYS LYS B . n B 1 203 LYS 203 200 ? ? ? B . n B 1 204 ARG 204 201 ? ? ? B . n B 1 205 GLU 205 202 ? ? ? B . n B 1 206 GLU 206 203 ? ? ? B . n B 1 207 GLU 207 204 ? ? ? B . n B 1 208 LYS 208 205 ? ? ? B . n B 1 209 LYS 209 206 ? ? ? B . n B 1 210 GLY 210 207 ? ? ? B . n B 1 211 SER 211 208 ? ? ? B . n B 1 212 HIS 212 209 ? ? ? B . n B 1 213 HIS 213 210 ? ? ? B . n B 1 214 HIS 214 211 ? ? ? B . n B 1 215 HIS 215 212 ? ? ? B . n B 1 216 HIS 216 213 ? ? ? B . n B 1 217 HIS 217 214 ? ? ? B . n C 2 1 TYR 1 1 ? ? ? C . n C 2 2 GLY 2 2 ? ? ? C . n C 2 3 GLY 3 3 ? ? ? C . n C 2 4 PHE 4 4 4 PHE PHE C . n C 2 5 LEU 5 5 5 LEU LEU C . n C 2 6 ARG 6 6 6 ARG ARG C . n C 2 7 ARG 7 7 7 ARG ARG C . n C 2 8 ILE 8 8 8 ILE ILE C . n C 2 9 ARG 9 9 9 ARG ARG C . n C 2 10 PRO 10 10 10 PRO PRO C . n C 2 11 LYS 11 11 11 LYS LYS C . n C 2 12 LEU 12 12 12 LEU LEU C . n C 2 13 LYS 13 13 13 LYS LYS C . n C 2 14 TRP 14 14 14 TRP TRP C . n C 2 15 ASP 15 15 ? ? ? C . n C 2 16 ASN 16 16 ? ? ? C . n C 2 17 GLN 17 17 ? ? ? C . n D 2 1 TYR 1 1 ? ? ? D . n D 2 2 GLY 2 2 ? ? ? D . n D 2 3 GLY 3 3 ? ? ? D . n D 2 4 PHE 4 4 4 PHE PHE D . n D 2 5 LEU 5 5 5 LEU LEU D . n D 2 6 ARG 6 6 6 ARG ARG D . n D 2 7 ARG 7 7 7 ARG ARG D . n D 2 8 ILE 8 8 8 ILE ILE D . n D 2 9 ARG 9 9 9 ARG ARG D . n D 2 10 PRO 10 10 10 PRO PRO D . n D 2 11 LYS 11 11 11 LYS LYS D . n D 2 12 LEU 12 12 12 LEU LEU D . n D 2 13 LYS 13 13 13 LYS LYS D . n D 2 14 TRP 14 14 ? ? ? D . n D 2 15 ASP 15 15 ? ? ? D . n D 2 16 ASN 16 16 ? ? ? D . n D 2 17 GLN 17 17 ? ? ? D . n # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.21.1_5286 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XSCALE ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 98.029 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 9CCE _cell.details ? _cell.formula_units_Z ? _cell.length_a 44.433 _cell.length_a_esd ? _cell.length_b 67.783 _cell.length_b_esd ? _cell.length_c 68.360 _cell.length_c_esd ? _cell.volume 203868.582 _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 9CCE _symmetry.cell_setting ? _symmetry.Int_Tables_number 4 _symmetry.space_group_name_Hall 'P 2yb' _symmetry.space_group_name_H-M 'P 1 21 1' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 9CCE _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 1.88 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 34.6 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 4.2 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.1 M Phosphate/citrate pH 4.2 and 40 % v/v PEG 300' _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 293 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER X 9M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2023-12-07 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.92009 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'NSLS-II BEAMLINE 17-ID-1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.92009 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 17-ID-1 _diffrn_source.pdbx_synchrotron_site NSLS-II # _reflns.B_iso_Wilson_estimate 84.85 _reflns.entry_id 9CCE _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 3.15 _reflns.d_resolution_low 44.43 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 6972 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 98.3 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 3.1 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 5.6 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all 0.102 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.989 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs 0.138 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 3.15 _reflns_shell.d_res_low 3.23 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 1.3 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 517 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 3.1 _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.790 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.percent_possible_all 96.8 _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.658 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 81.23 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 9CCE _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 3.15 _refine.ls_d_res_low 28.84 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 6951 _refine.ls_number_reflns_R_free 693 _refine.ls_number_reflns_R_work 6258 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 98.15 _refine.ls_percent_reflns_R_free 9.97 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2626 _refine.ls_R_factor_R_free 0.3130 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2571 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.36 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values 'GeoStd + Monomer Library + CDL v1.2' _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1000 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 34.5715 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.4823 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 3.15 _refine_hist.d_res_low 28.84 _refine_hist.number_atoms_solvent 0 _refine_hist.number_atoms_total 3355 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 3355 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.0022 ? 3376 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.4159 ? 4505 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.0331 ? 513 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.0030 ? 583 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 15.7598 ? 1392 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free _refine_ls_shell.R_factor_R_free 'X-RAY DIFFRACTION' 3.15 3.39 . . 138 1247 98.02 . . . . 0.3187 . . . . . . . . . . . 0.3800 'X-RAY DIFFRACTION' 3.39 3.73 . . 138 1246 98.37 . . . . 0.2849 . . . . . . . . . . . 0.3400 'X-RAY DIFFRACTION' 3.73 4.27 . . 138 1237 98.00 . . . . 0.2543 . . . . . . . . . . . 0.3164 'X-RAY DIFFRACTION' 4.27 5.37 . . 139 1256 98.17 . . . . 0.2419 . . . . . . . . . . . 0.3174 'X-RAY DIFFRACTION' 5.37 28.84 . . 140 1272 98.19 . . . . 0.2429 . . . . . . . . . . . 0.2786 # _struct.entry_id 9CCE _struct.title 'structure of DYNA_1b7' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 9CCE _struct_keywords.text 'de novo design, deep learning, disorder peptide, protein-peptide complex, DE NOVO PROTEIN' _struct_keywords.pdbx_keywords 'DE NOVO PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? C N N 2 ? D N N 2 ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 PDB 9CCE 9CCE ? 1 ? 1 2 UNP PDYN_HUMAN P01213 ? 2 YGGFLRRIRPKLKWDNQ 207 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 9CCE A 1 ? 217 ? 9CCE -2 ? 214 ? -2 214 2 1 9CCE B 1 ? 217 ? 9CCE -2 ? 214 ? -2 214 3 2 9CCE C 1 ? 17 ? P01213 207 ? 223 ? 1 17 4 2 9CCE D 1 ? 17 ? P01213 207 ? 223 ? 1 17 # loop_ _pdbx_struct_assembly.id _pdbx_struct_assembly.details _pdbx_struct_assembly.method_details _pdbx_struct_assembly.oligomeric_details _pdbx_struct_assembly.oligomeric_count 1 author_and_software_defined_assembly PISA dimeric 2 2 author_and_software_defined_assembly PISA dimeric 2 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 2130 ? 1 MORE -6 ? 1 'SSA (A^2)' 11080 ? 2 'ABSA (A^2)' 2180 ? 2 MORE -10 ? 2 'SSA (A^2)' 10790 ? # loop_ _pdbx_struct_assembly_gen.assembly_id _pdbx_struct_assembly_gen.oper_expression _pdbx_struct_assembly_gen.asym_id_list 1 1 A,D 2 1 B,C # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 GLU A 6 ? GLU A 29 ? GLU A 3 GLU A 26 1 ? 24 HELX_P HELX_P2 AA2 GLU A 31 ? GLY A 55 ? GLU A 28 GLY A 52 1 ? 25 HELX_P HELX_P3 AA3 ASN A 57 ? GLU A 80 ? ASN A 54 GLU A 77 1 ? 24 HELX_P HELX_P4 AA4 GLU A 82 ? GLU A 98 ? GLU A 79 GLU A 95 1 ? 17 HELX_P HELX_P5 AA5 PRO A 103 ? GLU A 126 ? PRO A 100 GLU A 123 1 ? 24 HELX_P HELX_P6 AA6 GLU A 131 ? ASN A 143 ? GLU A 128 ASN A 140 1 ? 13 HELX_P HELX_P7 AA7 SER A 148 ? SER A 167 ? SER A 145 SER A 164 1 ? 20 HELX_P HELX_P8 AA8 GLU A 172 ? ARG A 183 ? GLU A 169 ARG A 180 1 ? 12 HELX_P HELX_P9 AA9 PRO A 186 ? GLU A 200 ? PRO A 183 GLU A 197 1 ? 15 HELX_P HELX_P10 AB1 GLU B 9 ? GLY B 30 ? GLU B 6 GLY B 27 1 ? 22 HELX_P HELX_P11 AB2 GLU B 32 ? GLY B 55 ? GLU B 29 GLY B 52 1 ? 24 HELX_P HELX_P12 AB3 ASN B 57 ? ARG B 79 ? ASN B 54 ARG B 76 1 ? 23 HELX_P HELX_P13 AB4 GLU B 82 ? LYS B 99 ? GLU B 79 LYS B 96 1 ? 18 HELX_P HELX_P14 AB5 PRO B 103 ? GLU B 126 ? PRO B 100 GLU B 123 1 ? 24 HELX_P HELX_P15 AB6 GLU B 131 ? ASN B 143 ? GLU B 128 ASN B 140 1 ? 13 HELX_P HELX_P16 AB7 SER B 148 ? SER B 167 ? SER B 145 SER B 164 1 ? 20 HELX_P HELX_P17 AB8 ASP B 170 ? ARG B 183 ? ASP B 167 ARG B 180 1 ? 14 HELX_P HELX_P18 AB9 GLU B 188 ? LYS B 202 ? GLU B 185 LYS B 199 1 ? 15 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _pdbx_entry_details.entry_id 9CCE _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 TRP A 122 ? ? -95.14 -76.15 2 1 ASN A 140 ? ? -107.18 48.28 3 1 SER A 164 ? ? -120.33 -74.72 4 1 ARG B 141 ? ? -87.00 -71.74 5 1 PRO D 10 ? ? -35.89 114.20 # loop_ _space_group_symop.id _space_group_symop.operation_xyz 1 x,y,z 2 -x,y+1/2,-z # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET -2 ? A MET 1 2 1 Y 1 A SER -1 ? A SER 2 3 1 Y 1 A GLY 0 ? A GLY 3 4 1 Y 1 A LYS 1 ? A LYS 4 5 1 Y 1 A GLU 2 ? A GLU 5 6 1 Y 1 A LYS 126 ? A LYS 129 7 1 Y 1 A ASP 167 ? A ASP 170 8 1 Y 1 A LYS 200 ? A LYS 203 9 1 Y 1 A ARG 201 ? A ARG 204 10 1 Y 1 A GLU 202 ? A GLU 205 11 1 Y 1 A GLU 203 ? A GLU 206 12 1 Y 1 A GLU 204 ? A GLU 207 13 1 Y 1 A LYS 205 ? A LYS 208 14 1 Y 1 A LYS 206 ? A LYS 209 15 1 Y 1 A GLY 207 ? A GLY 210 16 1 Y 1 A SER 208 ? A SER 211 17 1 Y 1 A HIS 209 ? A HIS 212 18 1 Y 1 A HIS 210 ? A HIS 213 19 1 Y 1 A HIS 211 ? A HIS 214 20 1 Y 1 A HIS 212 ? A HIS 215 21 1 Y 1 A HIS 213 ? A HIS 216 22 1 Y 1 A HIS 214 ? A HIS 217 23 1 Y 1 B MET -2 ? B MET 1 24 1 Y 1 B SER -1 ? B SER 2 25 1 Y 1 B GLY 0 ? B GLY 3 26 1 Y 1 B LYS 1 ? B LYS 4 27 1 Y 1 B GLU 2 ? B GLU 5 28 1 Y 1 B GLU 3 ? B GLU 6 29 1 Y 1 B GLY 125 ? B GLY 128 30 1 Y 1 B LYS 126 ? B LYS 129 31 1 Y 1 B LYS 200 ? B LYS 203 32 1 Y 1 B ARG 201 ? B ARG 204 33 1 Y 1 B GLU 202 ? B GLU 205 34 1 Y 1 B GLU 203 ? B GLU 206 35 1 Y 1 B GLU 204 ? B GLU 207 36 1 Y 1 B LYS 205 ? B LYS 208 37 1 Y 1 B LYS 206 ? B LYS 209 38 1 Y 1 B GLY 207 ? B GLY 210 39 1 Y 1 B SER 208 ? B SER 211 40 1 Y 1 B HIS 209 ? B HIS 212 41 1 Y 1 B HIS 210 ? B HIS 213 42 1 Y 1 B HIS 211 ? B HIS 214 43 1 Y 1 B HIS 212 ? B HIS 215 44 1 Y 1 B HIS 213 ? B HIS 216 45 1 Y 1 B HIS 214 ? B HIS 217 46 1 Y 1 C TYR 1 ? C TYR 1 47 1 Y 1 C GLY 2 ? C GLY 2 48 1 Y 1 C GLY 3 ? C GLY 3 49 1 Y 1 C ASP 15 ? C ASP 15 50 1 Y 1 C ASN 16 ? C ASN 16 51 1 Y 1 C GLN 17 ? C GLN 17 52 1 Y 1 D TYR 1 ? D TYR 1 53 1 Y 1 D GLY 2 ? D GLY 2 54 1 Y 1 D GLY 3 ? D GLY 3 55 1 Y 1 D TRP 14 ? D TRP 14 56 1 Y 1 D ASP 15 ? D ASP 15 57 1 Y 1 D ASN 16 ? D ASN 16 58 1 Y 1 D GLN 17 ? D GLN 17 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 GLU N N N N 94 GLU CA C N S 95 GLU C C N N 96 GLU O O N N 97 GLU CB C N N 98 GLU CG C N N 99 GLU CD C N N 100 GLU OE1 O N N 101 GLU OE2 O N N 102 GLU OXT O N N 103 GLU H H N N 104 GLU H2 H N N 105 GLU HA H N N 106 GLU HB2 H N N 107 GLU HB3 H N N 108 GLU HG2 H N N 109 GLU HG3 H N N 110 GLU HE2 H N N 111 GLU HXT H N N 112 GLY N N N N 113 GLY CA C N N 114 GLY C C N N 115 GLY O O N N 116 GLY OXT O N N 117 GLY H H N N 118 GLY H2 H N N 119 GLY HA2 H N N 120 GLY HA3 H N N 121 GLY HXT H N N 122 HIS N N N N 123 HIS CA C N S 124 HIS C C N N 125 HIS O O N N 126 HIS CB C N N 127 HIS CG C Y N 128 HIS ND1 N Y N 129 HIS CD2 C Y N 130 HIS CE1 C Y N 131 HIS NE2 N Y N 132 HIS OXT O N N 133 HIS H H N N 134 HIS H2 H N N 135 HIS HA H N N 136 HIS HB2 H N N 137 HIS HB3 H N N 138 HIS HD1 H N N 139 HIS HD2 H N N 140 HIS HE1 H N N 141 HIS HE2 H N N 142 HIS HXT H N N 143 ILE N N N N 144 ILE CA C N S 145 ILE C C N N 146 ILE O O N N 147 ILE CB C N S 148 ILE CG1 C N N 149 ILE CG2 C N N 150 ILE CD1 C N N 151 ILE OXT O N N 152 ILE H H N N 153 ILE H2 H N N 154 ILE HA H N N 155 ILE HB H N N 156 ILE HG12 H N N 157 ILE HG13 H N N 158 ILE HG21 H N N 159 ILE HG22 H N N 160 ILE HG23 H N N 161 ILE HD11 H N N 162 ILE HD12 H N N 163 ILE HD13 H N N 164 ILE HXT H N N 165 LEU N N N N 166 LEU CA C N S 167 LEU C C N N 168 LEU O O N N 169 LEU CB C N N 170 LEU CG C N N 171 LEU CD1 C N N 172 LEU CD2 C N N 173 LEU OXT O N N 174 LEU H H N N 175 LEU H2 H N N 176 LEU HA H N N 177 LEU HB2 H N N 178 LEU HB3 H N N 179 LEU HG H N N 180 LEU HD11 H N N 181 LEU HD12 H N N 182 LEU HD13 H N N 183 LEU HD21 H N N 184 LEU HD22 H N N 185 LEU HD23 H N N 186 LEU HXT H N N 187 LYS N N N N 188 LYS CA C N S 189 LYS C C N N 190 LYS O O N N 191 LYS CB C N N 192 LYS CG C N N 193 LYS CD C N N 194 LYS CE C N N 195 LYS NZ N N N 196 LYS OXT O N N 197 LYS H H N N 198 LYS H2 H N N 199 LYS HA H N N 200 LYS HB2 H N N 201 LYS HB3 H N N 202 LYS HG2 H N N 203 LYS HG3 H N N 204 LYS HD2 H N N 205 LYS HD3 H N N 206 LYS HE2 H N N 207 LYS HE3 H N N 208 LYS HZ1 H N N 209 LYS HZ2 H N N 210 LYS HZ3 H N N 211 LYS HXT H N N 212 MET N N N N 213 MET CA C N S 214 MET C C N N 215 MET O O N N 216 MET CB C N N 217 MET CG C N N 218 MET SD S N N 219 MET CE C N N 220 MET OXT O N N 221 MET H H N N 222 MET H2 H N N 223 MET HA H N N 224 MET HB2 H N N 225 MET HB3 H N N 226 MET HG2 H N N 227 MET HG3 H N N 228 MET HE1 H N N 229 MET HE2 H N N 230 MET HE3 H N N 231 MET HXT H N N 232 PHE N N N N 233 PHE CA C N S 234 PHE C C N N 235 PHE O O N N 236 PHE CB C N N 237 PHE CG C Y N 238 PHE CD1 C Y N 239 PHE CD2 C Y N 240 PHE CE1 C Y N 241 PHE CE2 C Y N 242 PHE CZ C Y N 243 PHE OXT O N N 244 PHE H H N N 245 PHE H2 H N N 246 PHE HA H N N 247 PHE HB2 H N N 248 PHE HB3 H N N 249 PHE HD1 H N N 250 PHE HD2 H N N 251 PHE HE1 H N N 252 PHE HE2 H N N 253 PHE HZ H N N 254 PHE HXT H N N 255 PRO N N N N 256 PRO CA C N S 257 PRO C C N N 258 PRO O O N N 259 PRO CB C N N 260 PRO CG C N N 261 PRO CD C N N 262 PRO OXT O N N 263 PRO H H N N 264 PRO HA H N N 265 PRO HB2 H N N 266 PRO HB3 H N N 267 PRO HG2 H N N 268 PRO HG3 H N N 269 PRO HD2 H N N 270 PRO HD3 H N N 271 PRO HXT H N N 272 SER N N N N 273 SER CA C N S 274 SER C C N N 275 SER O O N N 276 SER CB C N N 277 SER OG O N N 278 SER OXT O N N 279 SER H H N N 280 SER H2 H N N 281 SER HA H N N 282 SER HB2 H N N 283 SER HB3 H N N 284 SER HG H N N 285 SER HXT H N N 286 THR N N N N 287 THR CA C N S 288 THR C C N N 289 THR O O N N 290 THR CB C N R 291 THR OG1 O N N 292 THR CG2 C N N 293 THR OXT O N N 294 THR H H N N 295 THR H2 H N N 296 THR HA H N N 297 THR HB H N N 298 THR HG1 H N N 299 THR HG21 H N N 300 THR HG22 H N N 301 THR HG23 H N N 302 THR HXT H N N 303 TRP N N N N 304 TRP CA C N S 305 TRP C C N N 306 TRP O O N N 307 TRP CB C N N 308 TRP CG C Y N 309 TRP CD1 C Y N 310 TRP CD2 C Y N 311 TRP NE1 N Y N 312 TRP CE2 C Y N 313 TRP CE3 C Y N 314 TRP CZ2 C Y N 315 TRP CZ3 C Y N 316 TRP CH2 C Y N 317 TRP OXT O N N 318 TRP H H N N 319 TRP H2 H N N 320 TRP HA H N N 321 TRP HB2 H N N 322 TRP HB3 H N N 323 TRP HD1 H N N 324 TRP HE1 H N N 325 TRP HE3 H N N 326 TRP HZ2 H N N 327 TRP HZ3 H N N 328 TRP HH2 H N N 329 TRP HXT H N N 330 TYR N N N N 331 TYR CA C N S 332 TYR C C N N 333 TYR O O N N 334 TYR CB C N N 335 TYR CG C Y N 336 TYR CD1 C Y N 337 TYR CD2 C Y N 338 TYR CE1 C Y N 339 TYR CE2 C Y N 340 TYR CZ C Y N 341 TYR OH O N N 342 TYR OXT O N N 343 TYR H H N N 344 TYR H2 H N N 345 TYR HA H N N 346 TYR HB2 H N N 347 TYR HB3 H N N 348 TYR HD1 H N N 349 TYR HD2 H N N 350 TYR HE1 H N N 351 TYR HE2 H N N 352 TYR HH H N N 353 TYR HXT H N N 354 VAL N N N N 355 VAL CA C N S 356 VAL C C N N 357 VAL O O N N 358 VAL CB C N N 359 VAL CG1 C N N 360 VAL CG2 C N N 361 VAL OXT O N N 362 VAL H H N N 363 VAL H2 H N N 364 VAL HA H N N 365 VAL HB H N N 366 VAL HG11 H N N 367 VAL HG12 H N N 368 VAL HG13 H N N 369 VAL HG21 H N N 370 VAL HG22 H N N 371 VAL HG23 H N N 372 VAL HXT H N N 373 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 HIS N CA sing N N 116 HIS N H sing N N 117 HIS N H2 sing N N 118 HIS CA C sing N N 119 HIS CA CB sing N N 120 HIS CA HA sing N N 121 HIS C O doub N N 122 HIS C OXT sing N N 123 HIS CB CG sing N N 124 HIS CB HB2 sing N N 125 HIS CB HB3 sing N N 126 HIS CG ND1 sing Y N 127 HIS CG CD2 doub Y N 128 HIS ND1 CE1 doub Y N 129 HIS ND1 HD1 sing N N 130 HIS CD2 NE2 sing Y N 131 HIS CD2 HD2 sing N N 132 HIS CE1 NE2 sing Y N 133 HIS CE1 HE1 sing N N 134 HIS NE2 HE2 sing N N 135 HIS OXT HXT sing N N 136 ILE N CA sing N N 137 ILE N H sing N N 138 ILE N H2 sing N N 139 ILE CA C sing N N 140 ILE CA CB sing N N 141 ILE CA HA sing N N 142 ILE C O doub N N 143 ILE C OXT sing N N 144 ILE CB CG1 sing N N 145 ILE CB CG2 sing N N 146 ILE CB HB sing N N 147 ILE CG1 CD1 sing N N 148 ILE CG1 HG12 sing N N 149 ILE CG1 HG13 sing N N 150 ILE CG2 HG21 sing N N 151 ILE CG2 HG22 sing N N 152 ILE CG2 HG23 sing N N 153 ILE CD1 HD11 sing N N 154 ILE CD1 HD12 sing N N 155 ILE CD1 HD13 sing N N 156 ILE OXT HXT sing N N 157 LEU N CA sing N N 158 LEU N H sing N N 159 LEU N H2 sing N N 160 LEU CA C sing N N 161 LEU CA CB sing N N 162 LEU CA HA sing N N 163 LEU C O doub N N 164 LEU C OXT sing N N 165 LEU CB CG sing N N 166 LEU CB HB2 sing N N 167 LEU CB HB3 sing N N 168 LEU CG CD1 sing N N 169 LEU CG CD2 sing N N 170 LEU CG HG sing N N 171 LEU CD1 HD11 sing N N 172 LEU CD1 HD12 sing N N 173 LEU CD1 HD13 sing N N 174 LEU CD2 HD21 sing N N 175 LEU CD2 HD22 sing N N 176 LEU CD2 HD23 sing N N 177 LEU OXT HXT sing N N 178 LYS N CA sing N N 179 LYS N H sing N N 180 LYS N H2 sing N N 181 LYS CA C sing N N 182 LYS CA CB sing N N 183 LYS CA HA sing N N 184 LYS C O doub N N 185 LYS C OXT sing N N 186 LYS CB CG sing N N 187 LYS CB HB2 sing N N 188 LYS CB HB3 sing N N 189 LYS CG CD sing N N 190 LYS CG HG2 sing N N 191 LYS CG HG3 sing N N 192 LYS CD CE sing N N 193 LYS CD HD2 sing N N 194 LYS CD HD3 sing N N 195 LYS CE NZ sing N N 196 LYS CE HE2 sing N N 197 LYS CE HE3 sing N N 198 LYS NZ HZ1 sing N N 199 LYS NZ HZ2 sing N N 200 LYS NZ HZ3 sing N N 201 LYS OXT HXT sing N N 202 MET N CA sing N N 203 MET N H sing N N 204 MET N H2 sing N N 205 MET CA C sing N N 206 MET CA CB sing N N 207 MET CA HA sing N N 208 MET C O doub N N 209 MET C OXT sing N N 210 MET CB CG sing N N 211 MET CB HB2 sing N N 212 MET CB HB3 sing N N 213 MET CG SD sing N N 214 MET CG HG2 sing N N 215 MET CG HG3 sing N N 216 MET SD CE sing N N 217 MET CE HE1 sing N N 218 MET CE HE2 sing N N 219 MET CE HE3 sing N N 220 MET OXT HXT sing N N 221 PHE N CA sing N N 222 PHE N H sing N N 223 PHE N H2 sing N N 224 PHE CA C sing N N 225 PHE CA CB sing N N 226 PHE CA HA sing N N 227 PHE C O doub N N 228 PHE C OXT sing N N 229 PHE CB CG sing N N 230 PHE CB HB2 sing N N 231 PHE CB HB3 sing N N 232 PHE CG CD1 doub Y N 233 PHE CG CD2 sing Y N 234 PHE CD1 CE1 sing Y N 235 PHE CD1 HD1 sing N N 236 PHE CD2 CE2 doub Y N 237 PHE CD2 HD2 sing N N 238 PHE CE1 CZ doub Y N 239 PHE CE1 HE1 sing N N 240 PHE CE2 CZ sing Y N 241 PHE CE2 HE2 sing N N 242 PHE CZ HZ sing N N 243 PHE OXT HXT sing N N 244 PRO N CA sing N N 245 PRO N CD sing N N 246 PRO N H sing N N 247 PRO CA C sing N N 248 PRO CA CB sing N N 249 PRO CA HA sing N N 250 PRO C O doub N N 251 PRO C OXT sing N N 252 PRO CB CG sing N N 253 PRO CB HB2 sing N N 254 PRO CB HB3 sing N N 255 PRO CG CD sing N N 256 PRO CG HG2 sing N N 257 PRO CG HG3 sing N N 258 PRO CD HD2 sing N N 259 PRO CD HD3 sing N N 260 PRO OXT HXT sing N N 261 SER N CA sing N N 262 SER N H sing N N 263 SER N H2 sing N N 264 SER CA C sing N N 265 SER CA CB sing N N 266 SER CA HA sing N N 267 SER C O doub N N 268 SER C OXT sing N N 269 SER CB OG sing N N 270 SER CB HB2 sing N N 271 SER CB HB3 sing N N 272 SER OG HG sing N N 273 SER OXT HXT sing N N 274 THR N CA sing N N 275 THR N H sing N N 276 THR N H2 sing N N 277 THR CA C sing N N 278 THR CA CB sing N N 279 THR CA HA sing N N 280 THR C O doub N N 281 THR C OXT sing N N 282 THR CB OG1 sing N N 283 THR CB CG2 sing N N 284 THR CB HB sing N N 285 THR OG1 HG1 sing N N 286 THR CG2 HG21 sing N N 287 THR CG2 HG22 sing N N 288 THR CG2 HG23 sing N N 289 THR OXT HXT sing N N 290 TRP N CA sing N N 291 TRP N H sing N N 292 TRP N H2 sing N N 293 TRP CA C sing N N 294 TRP CA CB sing N N 295 TRP CA HA sing N N 296 TRP C O doub N N 297 TRP C OXT sing N N 298 TRP CB CG sing N N 299 TRP CB HB2 sing N N 300 TRP CB HB3 sing N N 301 TRP CG CD1 doub Y N 302 TRP CG CD2 sing Y N 303 TRP CD1 NE1 sing Y N 304 TRP CD1 HD1 sing N N 305 TRP CD2 CE2 doub Y N 306 TRP CD2 CE3 sing Y N 307 TRP NE1 CE2 sing Y N 308 TRP NE1 HE1 sing N N 309 TRP CE2 CZ2 sing Y N 310 TRP CE3 CZ3 doub Y N 311 TRP CE3 HE3 sing N N 312 TRP CZ2 CH2 doub Y N 313 TRP CZ2 HZ2 sing N N 314 TRP CZ3 CH2 sing Y N 315 TRP CZ3 HZ3 sing N N 316 TRP CH2 HH2 sing N N 317 TRP OXT HXT sing N N 318 TYR N CA sing N N 319 TYR N H sing N N 320 TYR N H2 sing N N 321 TYR CA C sing N N 322 TYR CA CB sing N N 323 TYR CA HA sing N N 324 TYR C O doub N N 325 TYR C OXT sing N N 326 TYR CB CG sing N N 327 TYR CB HB2 sing N N 328 TYR CB HB3 sing N N 329 TYR CG CD1 doub Y N 330 TYR CG CD2 sing Y N 331 TYR CD1 CE1 sing Y N 332 TYR CD1 HD1 sing N N 333 TYR CD2 CE2 doub Y N 334 TYR CD2 HD2 sing N N 335 TYR CE1 CZ doub Y N 336 TYR CE1 HE1 sing N N 337 TYR CE2 CZ sing Y N 338 TYR CE2 HE2 sing N N 339 TYR CZ OH sing N N 340 TYR OH HH sing N N 341 TYR OXT HXT sing N N 342 VAL N CA sing N N 343 VAL N H sing N N 344 VAL N H2 sing N N 345 VAL CA C sing N N 346 VAL CA CB sing N N 347 VAL CA HA sing N N 348 VAL C O doub N N 349 VAL C OXT sing N N 350 VAL CB CG1 sing N N 351 VAL CB CG2 sing N N 352 VAL CB HB sing N N 353 VAL CG1 HG11 sing N N 354 VAL CG1 HG12 sing N N 355 VAL CG1 HG13 sing N N 356 VAL CG2 HG21 sing N N 357 VAL CG2 HG22 sing N N 358 VAL CG2 HG23 sing N N 359 VAL OXT HXT sing N N 360 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'National Science Foundation (NSF, United States)' 'United States' ? 1 'Howard Hughes Medical Institute (HHMI)' 'United States' ? 2 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'in silico model' _pdbx_initial_refinement_model.source_name Other _pdbx_initial_refinement_model.accession_code ? _pdbx_initial_refinement_model.details 'De novo designed model' # _space_group.name_H-M_alt 'P 1 21 1' _space_group.name_Hall 'P 2yb' _space_group.IT_number 4 _space_group.crystal_system monoclinic _space_group.id 1 # _atom_sites.entry_id 9CCE _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 0.022506 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.003175 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.014753 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.014773 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.scat_dispersion_real _atom_type.scat_dispersion_imag _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c _atom_type.scat_source _atom_type.scat_dispersion_source C ? ? 3.54356 2.42580 ? ? 25.62398 1.50364 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? N ? ? 6.96715 ? ? ? 11.43723 ? ? ? 0.0 ;1-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O ? ? 7.96527 ? ? ? 9.05267 ? ? ? 0.0 ;1-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? # loop_ #