data_9CFI # _entry.id 9CFI # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.402 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 9CFI pdb_00009cfi 10.2210/pdb9cfi/pdb WWPDB D_1000285416 ? ? # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2025-03-12 _pdbx_audit_revision_history.part_number ? # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _database_PDB_caveat.id 1 _database_PDB_caveat.text 'ASP A 24 atom O has a B-factor less than 0.0001.' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 9CFI _pdbx_database_status.recvd_initial_deposition_date 2024-06-27 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_database_related.db_name PDB _pdbx_database_related.details . _pdbx_database_related.db_id 9CEI _pdbx_database_related.content_type unspecified # _pdbx_contact_author.id 3 _pdbx_contact_author.email mwilson13@unl.edu _pdbx_contact_author.name_first Mark _pdbx_contact_author.name_last Wilson _pdbx_contact_author.name_mi A. _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0001-6317-900X # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Zielinski, K.A.' 1 ? 'Dolamore, C.' 2 ? 'Dalton, K.' 3 ? 'Meisburger, S.P.' 4 ? 'Smith, N.' 5 ? 'Termini, J.' 6 ? 'Henning, R.' 7 ? 'Srajer, V.' 8 ? 'Hekstra, D.' 9 ? 'Pollack, L.' 10 ? 'Wilson, M.A.' 11 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Biorxiv _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2692-8205 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Resolving DJ-1 Glyoxalase Catalysis Using Mix-and-Inject Serial Crystallography at a Synchrotron.' _citation.year 2024 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1101/2024.07.19.604369 _citation.pdbx_database_id_PubMed 39071394 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Zielinski, K.A.' 1 ? primary 'Dolamore, C.' 2 ? primary 'Dalton, K.M.' 3 ? primary 'Smith, N.' 4 ? primary 'Termini, J.' 5 ? primary 'Henning, R.' 6 ? primary 'Srajer, V.' 7 ? primary 'Hekstra, D.R.' 8 ? primary 'Pollack, L.' 9 0000-0002-9366-4396 primary 'Wilson, M.A.' 10 0000-0001-6317-900X # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Protein deglycase DJ-1' 20199.328 1 3.1.2.-,3.5.1.- ? ? ? 2 non-polymer syn 1-hydroxypropan-2-one 74.079 1 ? ? ? ? 3 water nat water 18.015 107 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'DJ-1,Oncogene DJ1,Parkinson disease protein 7' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSHMASKRALVILAKGAEEMETVIPVDVMRRAGIKVTVAGLAGKDPVQCSRDVVICPDASLEDAKKEGPYDVVVLPGGNL GAQNLSESAAVKEILKEQENRKGLIAAICAGPTALLAHEIGFGSKVTTHPLAKDKMMNGGHYTYSENRVEKDGLILTSRG PGTSFEFALAIVEALNGKEVAAQVKAPLVLKD ; _entity_poly.pdbx_seq_one_letter_code_can ;GSHMASKRALVILAKGAEEMETVIPVDVMRRAGIKVTVAGLAGKDPVQCSRDVVICPDASLEDAKKEGPYDVVVLPGGNL GAQNLSESAAVKEILKEQENRKGLIAAICAGPTALLAHEIGFGSKVTTHPLAKDKMMNGGHYTYSENRVEKDGLILTSRG PGTSFEFALAIVEALNGKEVAAQVKAPLVLKD ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 1-hydroxypropan-2-one 4Y8 3 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 HIS n 1 4 MET n 1 5 ALA n 1 6 SER n 1 7 LYS n 1 8 ARG n 1 9 ALA n 1 10 LEU n 1 11 VAL n 1 12 ILE n 1 13 LEU n 1 14 ALA n 1 15 LYS n 1 16 GLY n 1 17 ALA n 1 18 GLU n 1 19 GLU n 1 20 MET n 1 21 GLU n 1 22 THR n 1 23 VAL n 1 24 ILE n 1 25 PRO n 1 26 VAL n 1 27 ASP n 1 28 VAL n 1 29 MET n 1 30 ARG n 1 31 ARG n 1 32 ALA n 1 33 GLY n 1 34 ILE n 1 35 LYS n 1 36 VAL n 1 37 THR n 1 38 VAL n 1 39 ALA n 1 40 GLY n 1 41 LEU n 1 42 ALA n 1 43 GLY n 1 44 LYS n 1 45 ASP n 1 46 PRO n 1 47 VAL n 1 48 GLN n 1 49 CYS n 1 50 SER n 1 51 ARG n 1 52 ASP n 1 53 VAL n 1 54 VAL n 1 55 ILE n 1 56 CYS n 1 57 PRO n 1 58 ASP n 1 59 ALA n 1 60 SER n 1 61 LEU n 1 62 GLU n 1 63 ASP n 1 64 ALA n 1 65 LYS n 1 66 LYS n 1 67 GLU n 1 68 GLY n 1 69 PRO n 1 70 TYR n 1 71 ASP n 1 72 VAL n 1 73 VAL n 1 74 VAL n 1 75 LEU n 1 76 PRO n 1 77 GLY n 1 78 GLY n 1 79 ASN n 1 80 LEU n 1 81 GLY n 1 82 ALA n 1 83 GLN n 1 84 ASN n 1 85 LEU n 1 86 SER n 1 87 GLU n 1 88 SER n 1 89 ALA n 1 90 ALA n 1 91 VAL n 1 92 LYS n 1 93 GLU n 1 94 ILE n 1 95 LEU n 1 96 LYS n 1 97 GLU n 1 98 GLN n 1 99 GLU n 1 100 ASN n 1 101 ARG n 1 102 LYS n 1 103 GLY n 1 104 LEU n 1 105 ILE n 1 106 ALA n 1 107 ALA n 1 108 ILE n 1 109 CYS n 1 110 ALA n 1 111 GLY n 1 112 PRO n 1 113 THR n 1 114 ALA n 1 115 LEU n 1 116 LEU n 1 117 ALA n 1 118 HIS n 1 119 GLU n 1 120 ILE n 1 121 GLY n 1 122 PHE n 1 123 GLY n 1 124 SER n 1 125 LYS n 1 126 VAL n 1 127 THR n 1 128 THR n 1 129 HIS n 1 130 PRO n 1 131 LEU n 1 132 ALA n 1 133 LYS n 1 134 ASP n 1 135 LYS n 1 136 MET n 1 137 MET n 1 138 ASN n 1 139 GLY n 1 140 GLY n 1 141 HIS n 1 142 TYR n 1 143 THR n 1 144 TYR n 1 145 SER n 1 146 GLU n 1 147 ASN n 1 148 ARG n 1 149 VAL n 1 150 GLU n 1 151 LYS n 1 152 ASP n 1 153 GLY n 1 154 LEU n 1 155 ILE n 1 156 LEU n 1 157 THR n 1 158 SER n 1 159 ARG n 1 160 GLY n 1 161 PRO n 1 162 GLY n 1 163 THR n 1 164 SER n 1 165 PHE n 1 166 GLU n 1 167 PHE n 1 168 ALA n 1 169 LEU n 1 170 ALA n 1 171 ILE n 1 172 VAL n 1 173 GLU n 1 174 ALA n 1 175 LEU n 1 176 ASN n 1 177 GLY n 1 178 LYS n 1 179 GLU n 1 180 VAL n 1 181 ALA n 1 182 ALA n 1 183 GLN n 1 184 VAL n 1 185 LYS n 1 186 ALA n 1 187 PRO n 1 188 LEU n 1 189 VAL n 1 190 LEU n 1 191 LYS n 1 192 ASP n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 192 _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene PARK7 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET15b _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight 4Y8 non-polymer . 1-hydroxypropan-2-one ? 'C3 H6 O2' 74.079 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 -2 ? ? ? A . n A 1 2 SER 2 -1 ? ? ? A . n A 1 3 HIS 3 0 ? ? ? A . n A 1 4 MET 4 1 ? ? ? A . n A 1 5 ALA 5 2 2 ALA ALA A . n A 1 6 SER 6 3 3 SER SER A . n A 1 7 LYS 7 4 4 LYS LYS A . n A 1 8 ARG 8 5 5 ARG ARG A . n A 1 9 ALA 9 6 6 ALA ALA A . n A 1 10 LEU 10 7 7 LEU LEU A . n A 1 11 VAL 11 8 8 VAL VAL A . n A 1 12 ILE 12 9 9 ILE ILE A . n A 1 13 LEU 13 10 10 LEU LEU A . n A 1 14 ALA 14 11 11 ALA ALA A . n A 1 15 LYS 15 12 12 LYS LYS A . n A 1 16 GLY 16 13 13 GLY GLY A . n A 1 17 ALA 17 14 14 ALA ALA A . n A 1 18 GLU 18 15 15 GLU GLU A . n A 1 19 GLU 19 16 16 GLU GLU A . n A 1 20 MET 20 17 17 MET MET A . n A 1 21 GLU 21 18 18 GLU GLU A . n A 1 22 THR 22 19 19 THR THR A . n A 1 23 VAL 23 20 20 VAL VAL A . n A 1 24 ILE 24 21 21 ILE ILE A . n A 1 25 PRO 25 22 22 PRO PRO A . n A 1 26 VAL 26 23 23 VAL VAL A . n A 1 27 ASP 27 24 24 ASP ASP A . n A 1 28 VAL 28 25 25 VAL VAL A . n A 1 29 MET 29 26 26 MET MET A . n A 1 30 ARG 30 27 27 ARG ARG A . n A 1 31 ARG 31 28 28 ARG ARG A . n A 1 32 ALA 32 29 29 ALA ALA A . n A 1 33 GLY 33 30 30 GLY GLY A . n A 1 34 ILE 34 31 31 ILE ILE A . n A 1 35 LYS 35 32 32 LYS LYS A . n A 1 36 VAL 36 33 33 VAL VAL A . n A 1 37 THR 37 34 34 THR THR A . n A 1 38 VAL 38 35 35 VAL VAL A . n A 1 39 ALA 39 36 36 ALA ALA A . n A 1 40 GLY 40 37 37 GLY GLY A . n A 1 41 LEU 41 38 38 LEU LEU A . n A 1 42 ALA 42 39 39 ALA ALA A . n A 1 43 GLY 43 40 40 GLY GLY A . n A 1 44 LYS 44 41 41 LYS LYS A . n A 1 45 ASP 45 42 42 ASP ASP A . n A 1 46 PRO 46 43 43 PRO PRO A . n A 1 47 VAL 47 44 44 VAL VAL A . n A 1 48 GLN 48 45 45 GLN GLN A . n A 1 49 CYS 49 46 46 CYS CYS A . n A 1 50 SER 50 47 47 SER SER A . n A 1 51 ARG 51 48 48 ARG ARG A . n A 1 52 ASP 52 49 49 ASP ASP A . n A 1 53 VAL 53 50 50 VAL VAL A . n A 1 54 VAL 54 51 51 VAL VAL A . n A 1 55 ILE 55 52 52 ILE ILE A . n A 1 56 CYS 56 53 53 CYS CYS A . n A 1 57 PRO 57 54 54 PRO PRO A . n A 1 58 ASP 58 55 55 ASP ASP A . n A 1 59 ALA 59 56 56 ALA ALA A . n A 1 60 SER 60 57 57 SER SER A . n A 1 61 LEU 61 58 58 LEU LEU A . n A 1 62 GLU 62 59 59 GLU GLU A . n A 1 63 ASP 63 60 60 ASP ASP A . n A 1 64 ALA 64 61 61 ALA ALA A . n A 1 65 LYS 65 62 62 LYS LYS A . n A 1 66 LYS 66 63 63 LYS LYS A . n A 1 67 GLU 67 64 64 GLU GLU A . n A 1 68 GLY 68 65 65 GLY GLY A . n A 1 69 PRO 69 66 66 PRO PRO A . n A 1 70 TYR 70 67 67 TYR TYR A . n A 1 71 ASP 71 68 68 ASP ASP A . n A 1 72 VAL 72 69 69 VAL VAL A . n A 1 73 VAL 73 70 70 VAL VAL A . n A 1 74 VAL 74 71 71 VAL VAL A . n A 1 75 LEU 75 72 72 LEU LEU A . n A 1 76 PRO 76 73 73 PRO PRO A . n A 1 77 GLY 77 74 74 GLY GLY A . n A 1 78 GLY 78 75 75 GLY GLY A . n A 1 79 ASN 79 76 76 ASN ASN A . n A 1 80 LEU 80 77 77 LEU LEU A . n A 1 81 GLY 81 78 78 GLY GLY A . n A 1 82 ALA 82 79 79 ALA ALA A . n A 1 83 GLN 83 80 80 GLN GLN A . n A 1 84 ASN 84 81 81 ASN ASN A . n A 1 85 LEU 85 82 82 LEU LEU A . n A 1 86 SER 86 83 83 SER SER A . n A 1 87 GLU 87 84 84 GLU GLU A . n A 1 88 SER 88 85 85 SER SER A . n A 1 89 ALA 89 86 86 ALA ALA A . n A 1 90 ALA 90 87 87 ALA ALA A . n A 1 91 VAL 91 88 88 VAL VAL A . n A 1 92 LYS 92 89 89 LYS LYS A . n A 1 93 GLU 93 90 90 GLU GLU A . n A 1 94 ILE 94 91 91 ILE ILE A . n A 1 95 LEU 95 92 92 LEU LEU A . n A 1 96 LYS 96 93 93 LYS LYS A . n A 1 97 GLU 97 94 94 GLU GLU A . n A 1 98 GLN 98 95 95 GLN GLN A . n A 1 99 GLU 99 96 96 GLU GLU A . n A 1 100 ASN 100 97 97 ASN ASN A . n A 1 101 ARG 101 98 98 ARG ARG A . n A 1 102 LYS 102 99 99 LYS LYS A . n A 1 103 GLY 103 100 100 GLY GLY A . n A 1 104 LEU 104 101 101 LEU LEU A . n A 1 105 ILE 105 102 102 ILE ILE A . n A 1 106 ALA 106 103 103 ALA ALA A . n A 1 107 ALA 107 104 104 ALA ALA A . n A 1 108 ILE 108 105 105 ILE ILE A . n A 1 109 CYS 109 106 106 CYS CYS A . n A 1 110 ALA 110 107 107 ALA ALA A . n A 1 111 GLY 111 108 108 GLY GLY A . n A 1 112 PRO 112 109 109 PRO PRO A . n A 1 113 THR 113 110 110 THR THR A . n A 1 114 ALA 114 111 111 ALA ALA A . n A 1 115 LEU 115 112 112 LEU LEU A . n A 1 116 LEU 116 113 113 LEU LEU A . n A 1 117 ALA 117 114 114 ALA ALA A . n A 1 118 HIS 118 115 115 HIS HIS A . n A 1 119 GLU 119 116 116 GLU GLU A . n A 1 120 ILE 120 117 117 ILE ILE A . n A 1 121 GLY 121 118 118 GLY GLY A . n A 1 122 PHE 122 119 119 PHE PHE A . n A 1 123 GLY 123 120 120 GLY GLY A . n A 1 124 SER 124 121 121 SER SER A . n A 1 125 LYS 125 122 122 LYS LYS A . n A 1 126 VAL 126 123 123 VAL VAL A . n A 1 127 THR 127 124 124 THR THR A . n A 1 128 THR 128 125 125 THR THR A . n A 1 129 HIS 129 126 126 HIS HIS A . n A 1 130 PRO 130 127 127 PRO PRO A . n A 1 131 LEU 131 128 128 LEU LEU A . n A 1 132 ALA 132 129 129 ALA ALA A . n A 1 133 LYS 133 130 130 LYS LYS A . n A 1 134 ASP 134 131 131 ASP ASP A . n A 1 135 LYS 135 132 132 LYS LYS A . n A 1 136 MET 136 133 133 MET MET A . n A 1 137 MET 137 134 134 MET MET A . n A 1 138 ASN 138 135 135 ASN ASN A . n A 1 139 GLY 139 136 136 GLY GLY A . n A 1 140 GLY 140 137 137 GLY GLY A . n A 1 141 HIS 141 138 138 HIS HIS A . n A 1 142 TYR 142 139 139 TYR TYR A . n A 1 143 THR 143 140 140 THR THR A . n A 1 144 TYR 144 141 141 TYR TYR A . n A 1 145 SER 145 142 142 SER SER A . n A 1 146 GLU 146 143 143 GLU GLU A . n A 1 147 ASN 147 144 144 ASN ASN A . n A 1 148 ARG 148 145 145 ARG ARG A . n A 1 149 VAL 149 146 146 VAL VAL A . n A 1 150 GLU 150 147 147 GLU GLU A . n A 1 151 LYS 151 148 148 LYS LYS A . n A 1 152 ASP 152 149 149 ASP ASP A . n A 1 153 GLY 153 150 150 GLY GLY A . n A 1 154 LEU 154 151 151 LEU LEU A . n A 1 155 ILE 155 152 152 ILE ILE A . n A 1 156 LEU 156 153 153 LEU LEU A . n A 1 157 THR 157 154 154 THR THR A . n A 1 158 SER 158 155 155 SER SER A . n A 1 159 ARG 159 156 156 ARG ARG A . n A 1 160 GLY 160 157 157 GLY GLY A . n A 1 161 PRO 161 158 158 PRO PRO A . n A 1 162 GLY 162 159 159 GLY GLY A . n A 1 163 THR 163 160 160 THR THR A . n A 1 164 SER 164 161 161 SER SER A . n A 1 165 PHE 165 162 162 PHE PHE A . n A 1 166 GLU 166 163 163 GLU GLU A . n A 1 167 PHE 167 164 164 PHE PHE A . n A 1 168 ALA 168 165 165 ALA ALA A . n A 1 169 LEU 169 166 166 LEU LEU A . n A 1 170 ALA 170 167 167 ALA ALA A . n A 1 171 ILE 171 168 168 ILE ILE A . n A 1 172 VAL 172 169 169 VAL VAL A . n A 1 173 GLU 173 170 170 GLU GLU A . n A 1 174 ALA 174 171 171 ALA ALA A . n A 1 175 LEU 175 172 172 LEU LEU A . n A 1 176 ASN 176 173 173 ASN ASN A . n A 1 177 GLY 177 174 174 GLY GLY A . n A 1 178 LYS 178 175 175 LYS LYS A . n A 1 179 GLU 179 176 176 GLU GLU A . n A 1 180 VAL 180 177 177 VAL VAL A . n A 1 181 ALA 181 178 178 ALA ALA A . n A 1 182 ALA 182 179 179 ALA ALA A . n A 1 183 GLN 183 180 180 GLN GLN A . n A 1 184 VAL 184 181 181 VAL VAL A . n A 1 185 LYS 185 182 182 LYS LYS A . n A 1 186 ALA 186 183 183 ALA ALA A . n A 1 187 PRO 187 184 184 PRO PRO A . n A 1 188 LEU 188 185 185 LEU LEU A . n A 1 189 VAL 189 186 186 VAL VAL A . n A 1 190 LEU 190 187 187 LEU LEU A . n A 1 191 LYS 191 188 188 LYS LYS A . n A 1 192 ASP 192 189 189 ASP ASP A . n # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id 4Y8 _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id 4Y8 _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 4Y8 1 201 201 4Y8 LIG A . C 3 HOH 1 301 81 HOH HOH A . C 3 HOH 2 302 82 HOH HOH A . C 3 HOH 3 303 106 HOH HOH A . C 3 HOH 4 304 28 HOH HOH A . C 3 HOH 5 305 10 HOH HOH A . C 3 HOH 6 306 26 HOH HOH A . C 3 HOH 7 307 4 HOH HOH A . C 3 HOH 8 308 8 HOH HOH A . C 3 HOH 9 309 23 HOH HOH A . C 3 HOH 10 310 65 HOH HOH A . C 3 HOH 11 311 27 HOH HOH A . C 3 HOH 12 312 9 HOH HOH A . C 3 HOH 13 313 64 HOH HOH A . C 3 HOH 14 314 3 HOH HOH A . C 3 HOH 15 315 14 HOH HOH A . C 3 HOH 16 316 72 HOH HOH A . C 3 HOH 17 317 6 HOH HOH A . C 3 HOH 18 318 54 HOH HOH A . C 3 HOH 19 319 5 HOH HOH A . C 3 HOH 20 320 77 HOH HOH A . C 3 HOH 21 321 91 HOH HOH A . C 3 HOH 22 322 35 HOH HOH A . C 3 HOH 23 323 62 HOH HOH A . C 3 HOH 24 324 29 HOH HOH A . C 3 HOH 25 325 80 HOH HOH A . C 3 HOH 26 326 99 HOH HOH A . C 3 HOH 27 327 18 HOH HOH A . C 3 HOH 28 328 36 HOH HOH A . C 3 HOH 29 329 92 HOH HOH A . C 3 HOH 30 330 13 HOH HOH A . C 3 HOH 31 331 1 HOH HOH A . C 3 HOH 32 332 53 HOH HOH A . C 3 HOH 33 333 20 HOH HOH A . C 3 HOH 34 334 39 HOH HOH A . C 3 HOH 35 335 60 HOH HOH A . C 3 HOH 36 336 44 HOH HOH A . C 3 HOH 37 337 32 HOH HOH A . C 3 HOH 38 338 66 HOH HOH A . C 3 HOH 39 339 30 HOH HOH A . C 3 HOH 40 340 25 HOH HOH A . C 3 HOH 41 341 7 HOH HOH A . C 3 HOH 42 342 2 HOH HOH A . C 3 HOH 43 343 24 HOH HOH A . C 3 HOH 44 344 22 HOH HOH A . C 3 HOH 45 345 34 HOH HOH A . C 3 HOH 46 346 21 HOH HOH A . C 3 HOH 47 347 52 HOH HOH A . C 3 HOH 48 348 103 HOH HOH A . C 3 HOH 49 349 12 HOH HOH A . C 3 HOH 50 350 78 HOH HOH A . C 3 HOH 51 351 83 HOH HOH A . C 3 HOH 52 352 95 HOH HOH A . C 3 HOH 53 353 33 HOH HOH A . C 3 HOH 54 354 96 HOH HOH A . C 3 HOH 55 355 40 HOH HOH A . C 3 HOH 56 356 43 HOH HOH A . C 3 HOH 57 357 41 HOH HOH A . C 3 HOH 58 358 11 HOH HOH A . C 3 HOH 59 359 74 HOH HOH A . C 3 HOH 60 360 67 HOH HOH A . C 3 HOH 61 361 49 HOH HOH A . C 3 HOH 62 362 76 HOH HOH A . C 3 HOH 63 363 102 HOH HOH A . C 3 HOH 64 364 31 HOH HOH A . C 3 HOH 65 365 58 HOH HOH A . C 3 HOH 66 366 73 HOH HOH A . C 3 HOH 67 367 104 HOH HOH A . C 3 HOH 68 368 97 HOH HOH A . C 3 HOH 69 369 57 HOH HOH A . C 3 HOH 70 370 63 HOH HOH A . C 3 HOH 71 371 19 HOH HOH A . C 3 HOH 72 372 86 HOH HOH A . C 3 HOH 73 373 15 HOH HOH A . C 3 HOH 74 374 107 HOH HOH A . C 3 HOH 75 375 75 HOH HOH A . C 3 HOH 76 376 87 HOH HOH A . C 3 HOH 77 377 69 HOH HOH A . C 3 HOH 78 378 37 HOH HOH A . C 3 HOH 79 379 68 HOH HOH A . C 3 HOH 80 380 55 HOH HOH A . C 3 HOH 81 381 50 HOH HOH A . C 3 HOH 82 382 71 HOH HOH A . C 3 HOH 83 383 89 HOH HOH A . C 3 HOH 84 384 48 HOH HOH A . C 3 HOH 85 385 56 HOH HOH A . C 3 HOH 86 386 59 HOH HOH A . C 3 HOH 87 387 85 HOH HOH A . C 3 HOH 88 388 16 HOH HOH A . C 3 HOH 89 389 46 HOH HOH A . C 3 HOH 90 390 84 HOH HOH A . C 3 HOH 91 391 88 HOH HOH A . C 3 HOH 92 392 61 HOH HOH A . C 3 HOH 93 393 17 HOH HOH A . C 3 HOH 94 394 47 HOH HOH A . C 3 HOH 95 395 79 HOH HOH A . C 3 HOH 96 396 38 HOH HOH A . C 3 HOH 97 397 51 HOH HOH A . C 3 HOH 98 398 45 HOH HOH A . C 3 HOH 99 399 90 HOH HOH A . C 3 HOH 100 400 93 HOH HOH A . C 3 HOH 101 401 70 HOH HOH A . C 3 HOH 102 402 101 HOH HOH A . C 3 HOH 103 403 98 HOH HOH A . C 3 HOH 104 404 105 HOH HOH A . C 3 HOH 105 405 94 HOH HOH A . C 3 HOH 106 406 42 HOH HOH A . C 3 HOH 107 407 100 HOH HOH A . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.20.1_4487 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? Precognition ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? careless ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? . 4 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 120.000 _cell.angle_gamma_esd ? _cell.entry_id 9CFI _cell.details ? _cell.formula_units_Z ? _cell.length_a 76.030 _cell.length_a_esd ? _cell.length_b 76.030 _cell.length_b_esd ? _cell.length_c 76.140 _cell.length_c_esd ? _cell.volume 381165.412 _cell.volume_esd ? _cell.Z_PDB 6 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 9CFI _symmetry.cell_setting ? _symmetry.Int_Tables_number 152 _symmetry.space_group_name_Hall ;P 31 2" ; _symmetry.space_group_name_H-M 'P 31 2 1' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 9CFI _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 3.15 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 60.89 _exptl_crystal.description '25 micron micro crystals' _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'BATCH MODE' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 7.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '100 mM HEPES pH=7.5, 200 mM NaCl, and 15% PEG 3350' _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 293 # _diffrn.ambient_environment ? _diffrn.ambient_temp 293 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment Y # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'RAYONIX MX340-HS' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2022-11-13 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l L _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol LAUE _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # loop_ _diffrn_radiation_wavelength.id _diffrn_radiation_wavelength.wavelength _diffrn_radiation_wavelength.wt 1 1.240 1.0 2 1.016 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'APS BEAMLINE 14-ID-B' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.240-1.016 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 14-ID-B _diffrn_source.pdbx_synchrotron_site APS # _reflns.B_iso_Wilson_estimate -0.30 _reflns.entry_id 9CFI _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.77 _reflns.d_resolution_low 65.84 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 25216 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.83 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 35.8 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 13.33 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.98 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 1.77 _reflns_shell.d_res_low 1.83 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 1.69 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 2459 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 12.0 _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.35 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.percent_possible_all 99.84 _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 15.49 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 9CFI _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.77 _refine.ls_d_res_low 32.96 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 25183 _refine.ls_number_reflns_R_free 1145 _refine.ls_number_reflns_R_work 24038 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.86 _refine.ls_percent_reflns_R_free 4.55 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2059 _refine.ls_R_factor_R_free 0.2347 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2045 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.73 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'FOURIER SYNTHESIS' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values 'GeoStd + Monomer Library + CDL v1.2' _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1000 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 21.5645 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.2534 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 1.77 _refine_hist.d_res_low 32.96 _refine_hist.number_atoms_solvent 107 _refine_hist.number_atoms_total 1495 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 1383 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 5 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.0173 ? 1474 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 1.2922 ? 2002 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.0769 ? 234 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.0100 ? 266 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 13.8189 ? 572 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free _refine_ls_shell.R_factor_R_free 'X-RAY DIFFRACTION' 1.77 1.85 . . 155 2944 99.87 . . . . 0.3264 . . . . . . . . . . . 0.3336 'X-RAY DIFFRACTION' 1.85 1.95 . . 133 2969 100.00 . . . . 0.3063 . . . . . . . . . . . 0.3331 'X-RAY DIFFRACTION' 1.95 2.07 . . 157 2949 100.00 . . . . 0.2445 . . . . . . . . . . . 0.2854 'X-RAY DIFFRACTION' 2.07 2.23 . . 149 2968 100.00 . . . . 0.2140 . . . . . . . . . . . 0.2303 'X-RAY DIFFRACTION' 2.23 2.45 . . 127 3042 100.00 . . . . 0.1634 . . . . . . . . . . . 0.1972 'X-RAY DIFFRACTION' 2.45 2.81 . . 139 2990 100.00 . . . . 0.1528 . . . . . . . . . . . 0.2042 'X-RAY DIFFRACTION' 2.81 3.54 . . 153 3019 99.84 . . . . 0.1434 . . . . . . . . . . . 0.1666 'X-RAY DIFFRACTION' 3.54 32.96 . . 132 3157 99.19 . . . . 0.1336 . . . . . . . . . . . 0.1608 # _struct.entry_id 9CFI _struct.title 'Human DJ-1, 3 sec mixing with methylglyoxal, pink beam time-resolved serial crystallography' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 9CFI _struct_keywords.text 'glutathione-independent glyoxalase, mix-and-inject serial crystallgraphy, Laue diffraction, HYDROLASE' _struct_keywords.pdbx_keywords HYDROLASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code PARK7_HUMAN _struct_ref.pdbx_db_accession Q99497 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MASKRALVILAKGAEEMETVIPVDVMRRAGIKVTVAGLAGKDPVQCSRDVVICPDASLEDAKKEGPYDVVVLPGGNLGAQ NLSESAAVKEILKEQENRKGLIAAICAGPTALLAHEIGFGSKVTTHPLAKDKMMNGGHYTYSENRVEKDGLILTSRGPGT SFEFALAIVEALNGKEVAAQVKAPLVLKD ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 9CFI _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 4 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 192 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q99497 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 189 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 189 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 9CFI GLY A 1 ? UNP Q99497 ? ? 'expression tag' -2 1 1 9CFI SER A 2 ? UNP Q99497 ? ? 'expression tag' -1 2 1 9CFI HIS A 3 ? UNP Q99497 ? ? 'expression tag' 0 3 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 2820 ? 1 MORE -17 ? 1 'SSA (A^2)' 15150 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 5_555 x-y,-y,-z+2/3 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 50.7600000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 GLU A 18 ? ALA A 32 ? GLU A 15 ALA A 29 1 ? 15 HELX_P HELX_P2 AA2 LEU A 61 ? LYS A 66 ? LEU A 58 LYS A 63 1 ? 6 HELX_P HELX_P3 AA3 GLY A 78 ? GLU A 87 ? GLY A 75 GLU A 84 1 ? 10 HELX_P HELX_P4 AA4 SER A 88 ? ARG A 101 ? SER A 85 ARG A 98 1 ? 14 HELX_P HELX_P5 AA5 PRO A 112 ? HIS A 118 ? PRO A 109 HIS A 115 1 ? 7 HELX_P HELX_P6 AA6 HIS A 129 ? LEU A 131 ? HIS A 126 LEU A 128 5 ? 3 HELX_P HELX_P7 AA7 ALA A 132 ? MET A 137 ? ALA A 129 MET A 134 1 ? 6 HELX_P HELX_P8 AA8 GLY A 160 ? GLY A 162 ? GLY A 157 GLY A 159 5 ? 3 HELX_P HELX_P9 AA9 THR A 163 ? GLY A 177 ? THR A 160 GLY A 174 1 ? 15 HELX_P HELX_P10 AB1 GLY A 177 ? ALA A 186 ? GLY A 174 ALA A 183 1 ? 10 HELX_P HELX_P11 AB2 PRO A 187 ? VAL A 189 ? PRO A 184 VAL A 186 5 ? 3 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id covale1 _struct_conn.conn_type_id covale _struct_conn.pdbx_leaving_atom_flag one _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id CYS _struct_conn.ptnr1_label_seq_id 109 _struct_conn.ptnr1_label_atom_id SG _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id B _struct_conn.ptnr2_label_comp_id 4Y8 _struct_conn.ptnr2_label_seq_id . _struct_conn.ptnr2_label_atom_id CM1 _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id CYS _struct_conn.ptnr1_auth_seq_id 106 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id 4Y8 _struct_conn.ptnr2_auth_seq_id 201 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 1.760 _struct_conn.pdbx_value_order ? _struct_conn.pdbx_role ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _pdbx_modification_feature.ordinal 1 _pdbx_modification_feature.label_comp_id 4Y8 _pdbx_modification_feature.label_asym_id B _pdbx_modification_feature.label_seq_id . _pdbx_modification_feature.label_alt_id ? _pdbx_modification_feature.modified_residue_label_comp_id CYS _pdbx_modification_feature.modified_residue_label_asym_id A _pdbx_modification_feature.modified_residue_label_seq_id 109 _pdbx_modification_feature.modified_residue_label_alt_id ? _pdbx_modification_feature.auth_comp_id 4Y8 _pdbx_modification_feature.auth_asym_id A _pdbx_modification_feature.auth_seq_id 201 _pdbx_modification_feature.PDB_ins_code ? _pdbx_modification_feature.symmetry 1_555 _pdbx_modification_feature.modified_residue_auth_comp_id CYS _pdbx_modification_feature.modified_residue_auth_asym_id A _pdbx_modification_feature.modified_residue_auth_seq_id 106 _pdbx_modification_feature.modified_residue_PDB_ins_code ? _pdbx_modification_feature.modified_residue_symmetry 1_555 _pdbx_modification_feature.comp_id_linking_atom CM1 _pdbx_modification_feature.modified_residue_id_linking_atom SG _pdbx_modification_feature.modified_residue_id CYS _pdbx_modification_feature.ref_pcm_id 2 _pdbx_modification_feature.ref_comp_id 4Y8 _pdbx_modification_feature.type None _pdbx_modification_feature.category 'Covalent chemical modification' # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id GLY _struct_mon_prot_cis.label_seq_id 68 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id GLY _struct_mon_prot_cis.auth_seq_id 65 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 69 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 66 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle -0.20 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 7 ? AA2 ? 2 ? AA3 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? parallel AA1 2 3 ? parallel AA1 3 4 ? parallel AA1 4 5 ? parallel AA1 5 6 ? parallel AA1 6 7 ? anti-parallel AA2 1 2 ? anti-parallel AA3 1 2 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ALA A 59 ? SER A 60 ? ALA A 56 SER A 57 AA1 2 LYS A 35 ? GLY A 40 ? LYS A 32 GLY A 37 AA1 3 ARG A 8 ? LEU A 13 ? ARG A 5 LEU A 10 AA1 4 VAL A 72 ? LEU A 75 ? VAL A 69 LEU A 72 AA1 5 LEU A 104 ? ILE A 108 ? LEU A 101 ILE A 105 AA1 6 ILE A 155 ? SER A 158 ? ILE A 152 SER A 155 AA1 7 VAL A 149 ? ASP A 152 ? VAL A 146 ASP A 149 AA2 1 VAL A 47 ? GLN A 48 ? VAL A 44 GLN A 45 AA2 2 VAL A 54 ? ILE A 55 ? VAL A 51 ILE A 52 AA3 1 LYS A 125 ? VAL A 126 ? LYS A 122 VAL A 123 AA3 2 THR A 143 ? TYR A 144 ? THR A 140 TYR A 141 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O ALA A 59 ? O ALA A 56 N GLY A 40 ? N GLY A 37 AA1 2 3 O ALA A 39 ? O ALA A 36 N LEU A 13 ? N LEU A 10 AA1 3 4 N LEU A 10 ? N LEU A 7 O VAL A 74 ? O VAL A 71 AA1 4 5 N LEU A 75 ? N LEU A 72 O ALA A 106 ? O ALA A 103 AA1 5 6 N ILE A 105 ? N ILE A 102 O LEU A 156 ? O LEU A 153 AA1 6 7 O THR A 157 ? O THR A 154 N GLU A 150 ? N GLU A 147 AA2 1 2 N VAL A 47 ? N VAL A 44 O ILE A 55 ? O ILE A 52 AA3 1 2 N VAL A 126 ? N VAL A 123 O THR A 143 ? O THR A 140 # _pdbx_entry_details.entry_id 9CFI _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_protein_modification Y # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 HZ2 _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 LYS _pdbx_validate_close_contact.auth_seq_id_1 182 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 O _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 ASP _pdbx_validate_close_contact.auth_seq_id_2 189 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 1.55 # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id CYS _pdbx_validate_torsion.auth_asym_id A _pdbx_validate_torsion.auth_seq_id 106 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi 76.40 _pdbx_validate_torsion.psi -108.68 # loop_ _space_group_symop.id _space_group_symop.operation_xyz 1 x,y,z 2 -y,x-y,z+1/3 3 -x+y,-x,z+2/3 4 x-y,-y,-z+2/3 5 -x,-x+y,-z+1/3 6 y,x,-z # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY -2 ? A GLY 1 2 1 Y 1 A SER -1 ? A SER 2 3 1 Y 1 A HIS 0 ? A HIS 3 4 1 Y 1 A MET 1 ? A MET 4 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal 4Y8 O O N N 1 4Y8 C C N N 2 4Y8 CM2 C N N 3 4Y8 CM1 C N N 4 4Y8 O1 O N N 5 4Y8 H1 H N N 6 4Y8 H2 H N N 7 4Y8 H3 H N N 8 4Y8 H4 H N N 9 4Y8 H5 H N N 10 4Y8 H6 H N N 11 ALA N N N N 12 ALA CA C N S 13 ALA C C N N 14 ALA O O N N 15 ALA CB C N N 16 ALA OXT O N N 17 ALA H H N N 18 ALA H2 H N N 19 ALA HA H N N 20 ALA HB1 H N N 21 ALA HB2 H N N 22 ALA HB3 H N N 23 ALA HXT H N N 24 ARG N N N N 25 ARG CA C N S 26 ARG C C N N 27 ARG O O N N 28 ARG CB C N N 29 ARG CG C N N 30 ARG CD C N N 31 ARG NE N N N 32 ARG CZ C N N 33 ARG NH1 N N N 34 ARG NH2 N N N 35 ARG OXT O N N 36 ARG H H N N 37 ARG H2 H N N 38 ARG HA H N N 39 ARG HB2 H N N 40 ARG HB3 H N N 41 ARG HG2 H N N 42 ARG HG3 H N N 43 ARG HD2 H N N 44 ARG HD3 H N N 45 ARG HE H N N 46 ARG HH11 H N N 47 ARG HH12 H N N 48 ARG HH21 H N N 49 ARG HH22 H N N 50 ARG HXT H N N 51 ASN N N N N 52 ASN CA C N S 53 ASN C C N N 54 ASN O O N N 55 ASN CB C N N 56 ASN CG C N N 57 ASN OD1 O N N 58 ASN ND2 N N N 59 ASN OXT O N N 60 ASN H H N N 61 ASN H2 H N N 62 ASN HA H N N 63 ASN HB2 H N N 64 ASN HB3 H N N 65 ASN HD21 H N N 66 ASN HD22 H N N 67 ASN HXT H N N 68 ASP N N N N 69 ASP CA C N S 70 ASP C C N N 71 ASP O O N N 72 ASP CB C N N 73 ASP CG C N N 74 ASP OD1 O N N 75 ASP OD2 O N N 76 ASP OXT O N N 77 ASP H H N N 78 ASP H2 H N N 79 ASP HA H N N 80 ASP HB2 H N N 81 ASP HB3 H N N 82 ASP HD2 H N N 83 ASP HXT H N N 84 CYS N N N N 85 CYS CA C N R 86 CYS C C N N 87 CYS O O N N 88 CYS CB C N N 89 CYS SG S N N 90 CYS OXT O N N 91 CYS H H N N 92 CYS H2 H N N 93 CYS HA H N N 94 CYS HB2 H N N 95 CYS HB3 H N N 96 CYS HG H N N 97 CYS HXT H N N 98 GLN N N N N 99 GLN CA C N S 100 GLN C C N N 101 GLN O O N N 102 GLN CB C N N 103 GLN CG C N N 104 GLN CD C N N 105 GLN OE1 O N N 106 GLN NE2 N N N 107 GLN OXT O N N 108 GLN H H N N 109 GLN H2 H N N 110 GLN HA H N N 111 GLN HB2 H N N 112 GLN HB3 H N N 113 GLN HG2 H N N 114 GLN HG3 H N N 115 GLN HE21 H N N 116 GLN HE22 H N N 117 GLN HXT H N N 118 GLU N N N N 119 GLU CA C N S 120 GLU C C N N 121 GLU O O N N 122 GLU CB C N N 123 GLU CG C N N 124 GLU CD C N N 125 GLU OE1 O N N 126 GLU OE2 O N N 127 GLU OXT O N N 128 GLU H H N N 129 GLU H2 H N N 130 GLU HA H N N 131 GLU HB2 H N N 132 GLU HB3 H N N 133 GLU HG2 H N N 134 GLU HG3 H N N 135 GLU HE2 H N N 136 GLU HXT H N N 137 GLY N N N N 138 GLY CA C N N 139 GLY C C N N 140 GLY O O N N 141 GLY OXT O N N 142 GLY H H N N 143 GLY H2 H N N 144 GLY HA2 H N N 145 GLY HA3 H N N 146 GLY HXT H N N 147 HIS N N N N 148 HIS CA C N S 149 HIS C C N N 150 HIS O O N N 151 HIS CB C N N 152 HIS CG C Y N 153 HIS ND1 N Y N 154 HIS CD2 C Y N 155 HIS CE1 C Y N 156 HIS NE2 N Y N 157 HIS OXT O N N 158 HIS H H N N 159 HIS H2 H N N 160 HIS HA H N N 161 HIS HB2 H N N 162 HIS HB3 H N N 163 HIS HD1 H N N 164 HIS HD2 H N N 165 HIS HE1 H N N 166 HIS HE2 H N N 167 HIS HXT H N N 168 HOH O O N N 169 HOH H1 H N N 170 HOH H2 H N N 171 ILE N N N N 172 ILE CA C N S 173 ILE C C N N 174 ILE O O N N 175 ILE CB C N S 176 ILE CG1 C N N 177 ILE CG2 C N N 178 ILE CD1 C N N 179 ILE OXT O N N 180 ILE H H N N 181 ILE H2 H N N 182 ILE HA H N N 183 ILE HB H N N 184 ILE HG12 H N N 185 ILE HG13 H N N 186 ILE HG21 H N N 187 ILE HG22 H N N 188 ILE HG23 H N N 189 ILE HD11 H N N 190 ILE HD12 H N N 191 ILE HD13 H N N 192 ILE HXT H N N 193 LEU N N N N 194 LEU CA C N S 195 LEU C C N N 196 LEU O O N N 197 LEU CB C N N 198 LEU CG C N N 199 LEU CD1 C N N 200 LEU CD2 C N N 201 LEU OXT O N N 202 LEU H H N N 203 LEU H2 H N N 204 LEU HA H N N 205 LEU HB2 H N N 206 LEU HB3 H N N 207 LEU HG H N N 208 LEU HD11 H N N 209 LEU HD12 H N N 210 LEU HD13 H N N 211 LEU HD21 H N N 212 LEU HD22 H N N 213 LEU HD23 H N N 214 LEU HXT H N N 215 LYS N N N N 216 LYS CA C N S 217 LYS C C N N 218 LYS O O N N 219 LYS CB C N N 220 LYS CG C N N 221 LYS CD C N N 222 LYS CE C N N 223 LYS NZ N N N 224 LYS OXT O N N 225 LYS H H N N 226 LYS H2 H N N 227 LYS HA H N N 228 LYS HB2 H N N 229 LYS HB3 H N N 230 LYS HG2 H N N 231 LYS HG3 H N N 232 LYS HD2 H N N 233 LYS HD3 H N N 234 LYS HE2 H N N 235 LYS HE3 H N N 236 LYS HZ1 H N N 237 LYS HZ2 H N N 238 LYS HZ3 H N N 239 LYS HXT H N N 240 MET N N N N 241 MET CA C N S 242 MET C C N N 243 MET O O N N 244 MET CB C N N 245 MET CG C N N 246 MET SD S N N 247 MET CE C N N 248 MET OXT O N N 249 MET H H N N 250 MET H2 H N N 251 MET HA H N N 252 MET HB2 H N N 253 MET HB3 H N N 254 MET HG2 H N N 255 MET HG3 H N N 256 MET HE1 H N N 257 MET HE2 H N N 258 MET HE3 H N N 259 MET HXT H N N 260 PHE N N N N 261 PHE CA C N S 262 PHE C C N N 263 PHE O O N N 264 PHE CB C N N 265 PHE CG C Y N 266 PHE CD1 C Y N 267 PHE CD2 C Y N 268 PHE CE1 C Y N 269 PHE CE2 C Y N 270 PHE CZ C Y N 271 PHE OXT O N N 272 PHE H H N N 273 PHE H2 H N N 274 PHE HA H N N 275 PHE HB2 H N N 276 PHE HB3 H N N 277 PHE HD1 H N N 278 PHE HD2 H N N 279 PHE HE1 H N N 280 PHE HE2 H N N 281 PHE HZ H N N 282 PHE HXT H N N 283 PRO N N N N 284 PRO CA C N S 285 PRO C C N N 286 PRO O O N N 287 PRO CB C N N 288 PRO CG C N N 289 PRO CD C N N 290 PRO OXT O N N 291 PRO H H N N 292 PRO HA H N N 293 PRO HB2 H N N 294 PRO HB3 H N N 295 PRO HG2 H N N 296 PRO HG3 H N N 297 PRO HD2 H N N 298 PRO HD3 H N N 299 PRO HXT H N N 300 SER N N N N 301 SER CA C N S 302 SER C C N N 303 SER O O N N 304 SER CB C N N 305 SER OG O N N 306 SER OXT O N N 307 SER H H N N 308 SER H2 H N N 309 SER HA H N N 310 SER HB2 H N N 311 SER HB3 H N N 312 SER HG H N N 313 SER HXT H N N 314 THR N N N N 315 THR CA C N S 316 THR C C N N 317 THR O O N N 318 THR CB C N R 319 THR OG1 O N N 320 THR CG2 C N N 321 THR OXT O N N 322 THR H H N N 323 THR H2 H N N 324 THR HA H N N 325 THR HB H N N 326 THR HG1 H N N 327 THR HG21 H N N 328 THR HG22 H N N 329 THR HG23 H N N 330 THR HXT H N N 331 TYR N N N N 332 TYR CA C N S 333 TYR C C N N 334 TYR O O N N 335 TYR CB C N N 336 TYR CG C Y N 337 TYR CD1 C Y N 338 TYR CD2 C Y N 339 TYR CE1 C Y N 340 TYR CE2 C Y N 341 TYR CZ C Y N 342 TYR OH O N N 343 TYR OXT O N N 344 TYR H H N N 345 TYR H2 H N N 346 TYR HA H N N 347 TYR HB2 H N N 348 TYR HB3 H N N 349 TYR HD1 H N N 350 TYR HD2 H N N 351 TYR HE1 H N N 352 TYR HE2 H N N 353 TYR HH H N N 354 TYR HXT H N N 355 VAL N N N N 356 VAL CA C N S 357 VAL C C N N 358 VAL O O N N 359 VAL CB C N N 360 VAL CG1 C N N 361 VAL CG2 C N N 362 VAL OXT O N N 363 VAL H H N N 364 VAL H2 H N N 365 VAL HA H N N 366 VAL HB H N N 367 VAL HG11 H N N 368 VAL HG12 H N N 369 VAL HG13 H N N 370 VAL HG21 H N N 371 VAL HG22 H N N 372 VAL HG23 H N N 373 VAL HXT H N N 374 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal 4Y8 O C doub N N 1 4Y8 C CM2 sing N N 2 4Y8 C CM1 sing N N 3 4Y8 CM1 O1 sing N N 4 4Y8 CM2 H1 sing N N 5 4Y8 CM2 H2 sing N N 6 4Y8 CM2 H3 sing N N 7 4Y8 CM1 H4 sing N N 8 4Y8 CM1 H5 sing N N 9 4Y8 O1 H6 sing N N 10 ALA N CA sing N N 11 ALA N H sing N N 12 ALA N H2 sing N N 13 ALA CA C sing N N 14 ALA CA CB sing N N 15 ALA CA HA sing N N 16 ALA C O doub N N 17 ALA C OXT sing N N 18 ALA CB HB1 sing N N 19 ALA CB HB2 sing N N 20 ALA CB HB3 sing N N 21 ALA OXT HXT sing N N 22 ARG N CA sing N N 23 ARG N H sing N N 24 ARG N H2 sing N N 25 ARG CA C sing N N 26 ARG CA CB sing N N 27 ARG CA HA sing N N 28 ARG C O doub N N 29 ARG C OXT sing N N 30 ARG CB CG sing N N 31 ARG CB HB2 sing N N 32 ARG CB HB3 sing N N 33 ARG CG CD sing N N 34 ARG CG HG2 sing N N 35 ARG CG HG3 sing N N 36 ARG CD NE sing N N 37 ARG CD HD2 sing N N 38 ARG CD HD3 sing N N 39 ARG NE CZ sing N N 40 ARG NE HE sing N N 41 ARG CZ NH1 sing N N 42 ARG CZ NH2 doub N N 43 ARG NH1 HH11 sing N N 44 ARG NH1 HH12 sing N N 45 ARG NH2 HH21 sing N N 46 ARG NH2 HH22 sing N N 47 ARG OXT HXT sing N N 48 ASN N CA sing N N 49 ASN N H sing N N 50 ASN N H2 sing N N 51 ASN CA C sing N N 52 ASN CA CB sing N N 53 ASN CA HA sing N N 54 ASN C O doub N N 55 ASN C OXT sing N N 56 ASN CB CG sing N N 57 ASN CB HB2 sing N N 58 ASN CB HB3 sing N N 59 ASN CG OD1 doub N N 60 ASN CG ND2 sing N N 61 ASN ND2 HD21 sing N N 62 ASN ND2 HD22 sing N N 63 ASN OXT HXT sing N N 64 ASP N CA sing N N 65 ASP N H sing N N 66 ASP N H2 sing N N 67 ASP CA C sing N N 68 ASP CA CB sing N N 69 ASP CA HA sing N N 70 ASP C O doub N N 71 ASP C OXT sing N N 72 ASP CB CG sing N N 73 ASP CB HB2 sing N N 74 ASP CB HB3 sing N N 75 ASP CG OD1 doub N N 76 ASP CG OD2 sing N N 77 ASP OD2 HD2 sing N N 78 ASP OXT HXT sing N N 79 CYS N CA sing N N 80 CYS N H sing N N 81 CYS N H2 sing N N 82 CYS CA C sing N N 83 CYS CA CB sing N N 84 CYS CA HA sing N N 85 CYS C O doub N N 86 CYS C OXT sing N N 87 CYS CB SG sing N N 88 CYS CB HB2 sing N N 89 CYS CB HB3 sing N N 90 CYS SG HG sing N N 91 CYS OXT HXT sing N N 92 GLN N CA sing N N 93 GLN N H sing N N 94 GLN N H2 sing N N 95 GLN CA C sing N N 96 GLN CA CB sing N N 97 GLN CA HA sing N N 98 GLN C O doub N N 99 GLN C OXT sing N N 100 GLN CB CG sing N N 101 GLN CB HB2 sing N N 102 GLN CB HB3 sing N N 103 GLN CG CD sing N N 104 GLN CG HG2 sing N N 105 GLN CG HG3 sing N N 106 GLN CD OE1 doub N N 107 GLN CD NE2 sing N N 108 GLN NE2 HE21 sing N N 109 GLN NE2 HE22 sing N N 110 GLN OXT HXT sing N N 111 GLU N CA sing N N 112 GLU N H sing N N 113 GLU N H2 sing N N 114 GLU CA C sing N N 115 GLU CA CB sing N N 116 GLU CA HA sing N N 117 GLU C O doub N N 118 GLU C OXT sing N N 119 GLU CB CG sing N N 120 GLU CB HB2 sing N N 121 GLU CB HB3 sing N N 122 GLU CG CD sing N N 123 GLU CG HG2 sing N N 124 GLU CG HG3 sing N N 125 GLU CD OE1 doub N N 126 GLU CD OE2 sing N N 127 GLU OE2 HE2 sing N N 128 GLU OXT HXT sing N N 129 GLY N CA sing N N 130 GLY N H sing N N 131 GLY N H2 sing N N 132 GLY CA C sing N N 133 GLY CA HA2 sing N N 134 GLY CA HA3 sing N N 135 GLY C O doub N N 136 GLY C OXT sing N N 137 GLY OXT HXT sing N N 138 HIS N CA sing N N 139 HIS N H sing N N 140 HIS N H2 sing N N 141 HIS CA C sing N N 142 HIS CA CB sing N N 143 HIS CA HA sing N N 144 HIS C O doub N N 145 HIS C OXT sing N N 146 HIS CB CG sing N N 147 HIS CB HB2 sing N N 148 HIS CB HB3 sing N N 149 HIS CG ND1 sing Y N 150 HIS CG CD2 doub Y N 151 HIS ND1 CE1 doub Y N 152 HIS ND1 HD1 sing N N 153 HIS CD2 NE2 sing Y N 154 HIS CD2 HD2 sing N N 155 HIS CE1 NE2 sing Y N 156 HIS CE1 HE1 sing N N 157 HIS NE2 HE2 sing N N 158 HIS OXT HXT sing N N 159 HOH O H1 sing N N 160 HOH O H2 sing N N 161 ILE N CA sing N N 162 ILE N H sing N N 163 ILE N H2 sing N N 164 ILE CA C sing N N 165 ILE CA CB sing N N 166 ILE CA HA sing N N 167 ILE C O doub N N 168 ILE C OXT sing N N 169 ILE CB CG1 sing N N 170 ILE CB CG2 sing N N 171 ILE CB HB sing N N 172 ILE CG1 CD1 sing N N 173 ILE CG1 HG12 sing N N 174 ILE CG1 HG13 sing N N 175 ILE CG2 HG21 sing N N 176 ILE CG2 HG22 sing N N 177 ILE CG2 HG23 sing N N 178 ILE CD1 HD11 sing N N 179 ILE CD1 HD12 sing N N 180 ILE CD1 HD13 sing N N 181 ILE OXT HXT sing N N 182 LEU N CA sing N N 183 LEU N H sing N N 184 LEU N H2 sing N N 185 LEU CA C sing N N 186 LEU CA CB sing N N 187 LEU CA HA sing N N 188 LEU C O doub N N 189 LEU C OXT sing N N 190 LEU CB CG sing N N 191 LEU CB HB2 sing N N 192 LEU CB HB3 sing N N 193 LEU CG CD1 sing N N 194 LEU CG CD2 sing N N 195 LEU CG HG sing N N 196 LEU CD1 HD11 sing N N 197 LEU CD1 HD12 sing N N 198 LEU CD1 HD13 sing N N 199 LEU CD2 HD21 sing N N 200 LEU CD2 HD22 sing N N 201 LEU CD2 HD23 sing N N 202 LEU OXT HXT sing N N 203 LYS N CA sing N N 204 LYS N H sing N N 205 LYS N H2 sing N N 206 LYS CA C sing N N 207 LYS CA CB sing N N 208 LYS CA HA sing N N 209 LYS C O doub N N 210 LYS C OXT sing N N 211 LYS CB CG sing N N 212 LYS CB HB2 sing N N 213 LYS CB HB3 sing N N 214 LYS CG CD sing N N 215 LYS CG HG2 sing N N 216 LYS CG HG3 sing N N 217 LYS CD CE sing N N 218 LYS CD HD2 sing N N 219 LYS CD HD3 sing N N 220 LYS CE NZ sing N N 221 LYS CE HE2 sing N N 222 LYS CE HE3 sing N N 223 LYS NZ HZ1 sing N N 224 LYS NZ HZ2 sing N N 225 LYS NZ HZ3 sing N N 226 LYS OXT HXT sing N N 227 MET N CA sing N N 228 MET N H sing N N 229 MET N H2 sing N N 230 MET CA C sing N N 231 MET CA CB sing N N 232 MET CA HA sing N N 233 MET C O doub N N 234 MET C OXT sing N N 235 MET CB CG sing N N 236 MET CB HB2 sing N N 237 MET CB HB3 sing N N 238 MET CG SD sing N N 239 MET CG HG2 sing N N 240 MET CG HG3 sing N N 241 MET SD CE sing N N 242 MET CE HE1 sing N N 243 MET CE HE2 sing N N 244 MET CE HE3 sing N N 245 MET OXT HXT sing N N 246 PHE N CA sing N N 247 PHE N H sing N N 248 PHE N H2 sing N N 249 PHE CA C sing N N 250 PHE CA CB sing N N 251 PHE CA HA sing N N 252 PHE C O doub N N 253 PHE C OXT sing N N 254 PHE CB CG sing N N 255 PHE CB HB2 sing N N 256 PHE CB HB3 sing N N 257 PHE CG CD1 doub Y N 258 PHE CG CD2 sing Y N 259 PHE CD1 CE1 sing Y N 260 PHE CD1 HD1 sing N N 261 PHE CD2 CE2 doub Y N 262 PHE CD2 HD2 sing N N 263 PHE CE1 CZ doub Y N 264 PHE CE1 HE1 sing N N 265 PHE CE2 CZ sing Y N 266 PHE CE2 HE2 sing N N 267 PHE CZ HZ sing N N 268 PHE OXT HXT sing N N 269 PRO N CA sing N N 270 PRO N CD sing N N 271 PRO N H sing N N 272 PRO CA C sing N N 273 PRO CA CB sing N N 274 PRO CA HA sing N N 275 PRO C O doub N N 276 PRO C OXT sing N N 277 PRO CB CG sing N N 278 PRO CB HB2 sing N N 279 PRO CB HB3 sing N N 280 PRO CG CD sing N N 281 PRO CG HG2 sing N N 282 PRO CG HG3 sing N N 283 PRO CD HD2 sing N N 284 PRO CD HD3 sing N N 285 PRO OXT HXT sing N N 286 SER N CA sing N N 287 SER N H sing N N 288 SER N H2 sing N N 289 SER CA C sing N N 290 SER CA CB sing N N 291 SER CA HA sing N N 292 SER C O doub N N 293 SER C OXT sing N N 294 SER CB OG sing N N 295 SER CB HB2 sing N N 296 SER CB HB3 sing N N 297 SER OG HG sing N N 298 SER OXT HXT sing N N 299 THR N CA sing N N 300 THR N H sing N N 301 THR N H2 sing N N 302 THR CA C sing N N 303 THR CA CB sing N N 304 THR CA HA sing N N 305 THR C O doub N N 306 THR C OXT sing N N 307 THR CB OG1 sing N N 308 THR CB CG2 sing N N 309 THR CB HB sing N N 310 THR OG1 HG1 sing N N 311 THR CG2 HG21 sing N N 312 THR CG2 HG22 sing N N 313 THR CG2 HG23 sing N N 314 THR OXT HXT sing N N 315 TYR N CA sing N N 316 TYR N H sing N N 317 TYR N H2 sing N N 318 TYR CA C sing N N 319 TYR CA CB sing N N 320 TYR CA HA sing N N 321 TYR C O doub N N 322 TYR C OXT sing N N 323 TYR CB CG sing N N 324 TYR CB HB2 sing N N 325 TYR CB HB3 sing N N 326 TYR CG CD1 doub Y N 327 TYR CG CD2 sing Y N 328 TYR CD1 CE1 sing Y N 329 TYR CD1 HD1 sing N N 330 TYR CD2 CE2 doub Y N 331 TYR CD2 HD2 sing N N 332 TYR CE1 CZ doub Y N 333 TYR CE1 HE1 sing N N 334 TYR CE2 CZ sing Y N 335 TYR CE2 HE2 sing N N 336 TYR CZ OH sing N N 337 TYR OH HH sing N N 338 TYR OXT HXT sing N N 339 VAL N CA sing N N 340 VAL N H sing N N 341 VAL N H2 sing N N 342 VAL CA C sing N N 343 VAL CA CB sing N N 344 VAL CA HA sing N N 345 VAL C O doub N N 346 VAL C OXT sing N N 347 VAL CB CG1 sing N N 348 VAL CB CG2 sing N N 349 VAL CB HB sing N N 350 VAL CG1 HG11 sing N N 351 VAL CG1 HG12 sing N N 352 VAL CG1 HG13 sing N N 353 VAL CG2 HG21 sing N N 354 VAL CG2 HG22 sing N N 355 VAL CG2 HG23 sing N N 356 VAL OXT HXT sing N N 357 # _pdbx_audit_support.funding_organization 'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' _pdbx_audit_support.country 'United States' _pdbx_audit_support.grant_number R35GM153337 _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name Other _pdbx_initial_refinement_model.accession_code ? _pdbx_initial_refinement_model.details 'unpublished room temperature X-ray crystal structure of DJ-1' # _pdbx_serial_crystallography_data_reduction.diffrn_id 1 _pdbx_serial_crystallography_data_reduction.frames_total 25000 _pdbx_serial_crystallography_data_reduction.xfel_pulse_events ? _pdbx_serial_crystallography_data_reduction.frame_hits ? _pdbx_serial_crystallography_data_reduction.crystal_hits 1695 _pdbx_serial_crystallography_data_reduction.droplet_hits ? _pdbx_serial_crystallography_data_reduction.frames_failed_index ? _pdbx_serial_crystallography_data_reduction.frames_indexed 512 _pdbx_serial_crystallography_data_reduction.lattices_indexed ? _pdbx_serial_crystallography_data_reduction.xfel_run_numbers ? _pdbx_serial_crystallography_data_reduction.lattices_merged ? # _pdbx_serial_crystallography_sample_delivery.diffrn_id 1 _pdbx_serial_crystallography_sample_delivery.description 'concentric flow injector' _pdbx_serial_crystallography_sample_delivery.method injection # _pdbx_serial_crystallography_sample_delivery_injection.diffrn_id 1 _pdbx_serial_crystallography_sample_delivery_injection.description 'flow-focused diffusive mixer' _pdbx_serial_crystallography_sample_delivery_injection.injector_diameter ? _pdbx_serial_crystallography_sample_delivery_injection.injector_temperature ? _pdbx_serial_crystallography_sample_delivery_injection.injector_pressure ? _pdbx_serial_crystallography_sample_delivery_injection.flow_rate 1 _pdbx_serial_crystallography_sample_delivery_injection.carrier_solvent ? _pdbx_serial_crystallography_sample_delivery_injection.crystal_concentration ? _pdbx_serial_crystallography_sample_delivery_injection.preparation ? _pdbx_serial_crystallography_sample_delivery_injection.power_by ? _pdbx_serial_crystallography_sample_delivery_injection.injector_nozzle ? _pdbx_serial_crystallography_sample_delivery_injection.jet_diameter ? _pdbx_serial_crystallography_sample_delivery_injection.filter_size ? # _space_group.name_H-M_alt 'P 31 2 1' _space_group.name_Hall ;P 31 2" ; _space_group.IT_number 152 _space_group.crystal_system trigonal _space_group.id 1 # _atom_sites.entry_id 9CFI _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 0.013153 _atom_sites.fract_transf_matrix[1][2] 0.007594 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.015187 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.013134 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.scat_dispersion_real _atom_type.scat_dispersion_imag _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c _atom_type.scat_source _atom_type.scat_dispersion_source C ? ? 3.54356 2.42580 ? ? 25.62398 1.50364 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? H ? ? 0.51345 0.48472 ? ? 24.73122 6.32584 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? N ? ? 4.01032 2.96436 ? ? 19.97189 1.75589 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O ? ? 4.49882 3.47563 ? ? 15.80542 1.70748 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? S ? ? 9.55732 6.39887 ? ? 1.23737 29.19336 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? # loop_ #