data_9CIF # _entry.id 9CIF # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.404 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 9CIF pdb_00009cif 10.2210/pdb9cif/pdb WWPDB D_1000284898 ? ? BMRB 31185 ? 10.13018/BMR31185 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date _pdbx_audit_revision_history.part_number 1 'Structure model' 1 0 2025-05-21 ? 2 'Structure model' 1 1 2025-06-04 ? 3 'Structure model' 1 2 2025-06-18 ? # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' citation 4 3 'Structure model' citation_author # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_volume' 2 2 'Structure model' '_citation.pdbx_database_id_PubMed' 3 2 'Structure model' '_citation.title' 4 2 'Structure model' '_citation_author.identifier_ORCID' 5 3 'Structure model' '_citation.page_first' 6 3 'Structure model' '_citation.page_last' 7 3 'Structure model' '_citation_author.identifier_ORCID' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr . _pdbx_database_status.entry_id 9CIF _pdbx_database_status.recvd_initial_deposition_date 2024-07-03 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs . _pdbx_database_status.status_code_nmr_data REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_database_related.db_name BMRB _pdbx_database_related.details ;Solution NMR structure of a single-state de novo alternative conformation (design 6306) of the N-terminal domain of chicken troponin C (E41A mutant) ; _pdbx_database_related.db_id 31185 _pdbx_database_related.content_type unspecified # _pdbx_contact_author.id 2 _pdbx_contact_author.email tanjakortemme@gmail.com _pdbx_contact_author.name_first Tanja _pdbx_contact_author.name_last Kortemme _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-8494-680X # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Guo, A.B.' 1 0000-0003-4775-9498 'Kelly, M.J.S.' 2 0000-0003-3209-1018 'Kortemme, T.' 3 0000-0002-8494-680X # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Science _citation.journal_id_ASTM SCIEAS _citation.journal_id_CSD 0038 _citation.journal_id_ISSN 1095-9203 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 388 _citation.language ? _citation.page_first eadr7094 _citation.page_last eadr7094 _citation.title 'Deep learning-guided design of dynamic proteins.' _citation.year 2025 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1126/science.adr7094 _citation.pdbx_database_id_PubMed 40403060 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Guo, A.B.' 1 0000-0003-4775-9498 primary 'Akpinaroglu, D.' 2 ? primary 'Stephens, C.A.' 3 0000-0001-9382-003X primary 'Grabe, M.' 4 0000-0003-3509-5997 primary 'Smith, C.A.' 5 0000-0002-4651-167X primary 'Kelly, M.J.S.' 6 0000-0003-3209-1018 primary 'Kortemme, T.' 7 0000-0002-8494-680X # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'De novo designed troponin C 6306' _entity.formula_weight 10298.522 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'N-terminal residues' _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSHMASMSDEQAEARAFLSEEMIAEFKAAFDMFDADGGGEISAKAFGTVARMNNVPVDPRVQEYVKRLTDQDGSGTISFE EFLVLMVKSMKQDA ; _entity_poly.pdbx_seq_one_letter_code_can ;GSHMASMSDEQAEARAFLSEEMIAEFKAAFDMFDADGGGEISAKAFGTVARMNNVPVDPRVQEYVKRLTDQDGSGTISFE EFLVLMVKSMKQDA ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 HIS n 1 4 MET n 1 5 ALA n 1 6 SER n 1 7 MET n 1 8 SER n 1 9 ASP n 1 10 GLU n 1 11 GLN n 1 12 ALA n 1 13 GLU n 1 14 ALA n 1 15 ARG n 1 16 ALA n 1 17 PHE n 1 18 LEU n 1 19 SER n 1 20 GLU n 1 21 GLU n 1 22 MET n 1 23 ILE n 1 24 ALA n 1 25 GLU n 1 26 PHE n 1 27 LYS n 1 28 ALA n 1 29 ALA n 1 30 PHE n 1 31 ASP n 1 32 MET n 1 33 PHE n 1 34 ASP n 1 35 ALA n 1 36 ASP n 1 37 GLY n 1 38 GLY n 1 39 GLY n 1 40 GLU n 1 41 ILE n 1 42 SER n 1 43 ALA n 1 44 LYS n 1 45 ALA n 1 46 PHE n 1 47 GLY n 1 48 THR n 1 49 VAL n 1 50 ALA n 1 51 ARG n 1 52 MET n 1 53 ASN n 1 54 ASN n 1 55 VAL n 1 56 PRO n 1 57 VAL n 1 58 ASP n 1 59 PRO n 1 60 ARG n 1 61 VAL n 1 62 GLN n 1 63 GLU n 1 64 TYR n 1 65 VAL n 1 66 LYS n 1 67 ARG n 1 68 LEU n 1 69 THR n 1 70 ASP n 1 71 GLN n 1 72 ASP n 1 73 GLY n 1 74 SER n 1 75 GLY n 1 76 THR n 1 77 ILE n 1 78 SER n 1 79 PHE n 1 80 GLU n 1 81 GLU n 1 82 PHE n 1 83 LEU n 1 84 VAL n 1 85 LEU n 1 86 MET n 1 87 VAL n 1 88 LYS n 1 89 SER n 1 90 MET n 1 91 LYS n 1 92 GLN n 1 93 ASP n 1 94 ALA n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 94 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'synthetic construct' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 32630 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type Plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name 'pET-28a(+)' _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 ? ? ? A . n A 1 2 SER 2 2 ? ? ? A . n A 1 3 HIS 3 3 ? ? ? A . n A 1 4 MET 4 4 ? ? ? A . n A 1 5 ALA 5 5 5 ALA ALA A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 MET 7 7 7 MET MET A . n A 1 8 SER 8 8 8 SER SER A . n A 1 9 ASP 9 9 9 ASP ASP A . n A 1 10 GLU 10 10 10 GLU GLU A . n A 1 11 GLN 11 11 11 GLN GLN A . n A 1 12 ALA 12 12 12 ALA ALA A . n A 1 13 GLU 13 13 13 GLU GLU A . n A 1 14 ALA 14 14 14 ALA ALA A . n A 1 15 ARG 15 15 15 ARG ARG A . n A 1 16 ALA 16 16 16 ALA ALA A . n A 1 17 PHE 17 17 17 PHE PHE A . n A 1 18 LEU 18 18 18 LEU LEU A . n A 1 19 SER 19 19 19 SER SER A . n A 1 20 GLU 20 20 20 GLU GLU A . n A 1 21 GLU 21 21 21 GLU GLU A . n A 1 22 MET 22 22 22 MET MET A . n A 1 23 ILE 23 23 23 ILE ILE A . n A 1 24 ALA 24 24 24 ALA ALA A . n A 1 25 GLU 25 25 25 GLU GLU A . n A 1 26 PHE 26 26 26 PHE PHE A . n A 1 27 LYS 27 27 27 LYS LYS A . n A 1 28 ALA 28 28 28 ALA ALA A . n A 1 29 ALA 29 29 29 ALA ALA A . n A 1 30 PHE 30 30 30 PHE PHE A . n A 1 31 ASP 31 31 31 ASP ASP A . n A 1 32 MET 32 32 32 MET MET A . n A 1 33 PHE 33 33 33 PHE PHE A . n A 1 34 ASP 34 34 34 ASP ASP A . n A 1 35 ALA 35 35 35 ALA ALA A . n A 1 36 ASP 36 36 36 ASP ASP A . n A 1 37 GLY 37 37 37 GLY GLY A . n A 1 38 GLY 38 38 38 GLY GLY A . n A 1 39 GLY 39 39 39 GLY GLY A . n A 1 40 GLU 40 40 40 GLU GLU A . n A 1 41 ILE 41 41 41 ILE ILE A . n A 1 42 SER 42 42 42 SER SER A . n A 1 43 ALA 43 43 43 ALA ALA A . n A 1 44 LYS 44 44 44 LYS LYS A . n A 1 45 ALA 45 45 45 ALA ALA A . n A 1 46 PHE 46 46 46 PHE PHE A . n A 1 47 GLY 47 47 47 GLY GLY A . n A 1 48 THR 48 48 48 THR THR A . n A 1 49 VAL 49 49 49 VAL VAL A . n A 1 50 ALA 50 50 50 ALA ALA A . n A 1 51 ARG 51 51 51 ARG ARG A . n A 1 52 MET 52 52 52 MET MET A . n A 1 53 ASN 53 53 53 ASN ASN A . n A 1 54 ASN 54 54 54 ASN ASN A . n A 1 55 VAL 55 55 55 VAL VAL A . n A 1 56 PRO 56 56 56 PRO PRO A . n A 1 57 VAL 57 57 57 VAL VAL A . n A 1 58 ASP 58 58 58 ASP ASP A . n A 1 59 PRO 59 59 59 PRO PRO A . n A 1 60 ARG 60 60 60 ARG ARG A . n A 1 61 VAL 61 61 61 VAL VAL A . n A 1 62 GLN 62 62 62 GLN GLN A . n A 1 63 GLU 63 63 63 GLU GLU A . n A 1 64 TYR 64 64 64 TYR TYR A . n A 1 65 VAL 65 65 65 VAL VAL A . n A 1 66 LYS 66 66 66 LYS LYS A . n A 1 67 ARG 67 67 67 ARG ARG A . n A 1 68 LEU 68 68 68 LEU LEU A . n A 1 69 THR 69 69 69 THR THR A . n A 1 70 ASP 70 70 70 ASP ASP A . n A 1 71 GLN 71 71 71 GLN GLN A . n A 1 72 ASP 72 72 72 ASP ASP A . n A 1 73 GLY 73 73 73 GLY GLY A . n A 1 74 SER 74 74 74 SER SER A . n A 1 75 GLY 75 75 75 GLY GLY A . n A 1 76 THR 76 76 76 THR THR A . n A 1 77 ILE 77 77 77 ILE ILE A . n A 1 78 SER 78 78 78 SER SER A . n A 1 79 PHE 79 79 79 PHE PHE A . n A 1 80 GLU 80 80 80 GLU GLU A . n A 1 81 GLU 81 81 81 GLU GLU A . n A 1 82 PHE 82 82 82 PHE PHE A . n A 1 83 LEU 83 83 83 LEU LEU A . n A 1 84 VAL 84 84 84 VAL VAL A . n A 1 85 LEU 85 85 85 LEU LEU A . n A 1 86 MET 86 86 86 MET MET A . n A 1 87 VAL 87 87 87 VAL VAL A . n A 1 88 LYS 88 88 88 LYS LYS A . n A 1 89 SER 89 89 89 SER SER A . n A 1 90 MET 90 90 90 MET MET A . n A 1 91 LYS 91 91 91 LYS LYS A . n A 1 92 GLN 92 92 92 GLN GLN A . n A 1 93 ASP 93 93 93 ASP ASP A . n A 1 94 ALA 94 94 94 ALA ALA A . n # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 9CIF _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 9CIF _struct.title ;Solution NMR structure of a single-state de novo alternative conformation (design 6306) of the N-terminal domain of chicken troponin C (E41A mutant) ; _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 9CIF _struct_keywords.text 'EF Hand, Troponin, De novo design, DE NOVO PROTEIN' _struct_keywords.pdbx_keywords 'DE NOVO PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name PDB _struct_ref.db_code 9CIF _struct_ref.pdbx_db_accession 9CIF _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 9CIF _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 94 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession 9CIF _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 94 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 94 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'NMR Distance Restraints' _pdbx_struct_assembly_auth_evidence.details 'not applicable' # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0 _pdbx_struct_oper_list.matrix[1][2] 0.0 _pdbx_struct_oper_list.matrix[1][3] 0.0 _pdbx_struct_oper_list.vector[1] 0.0 _pdbx_struct_oper_list.matrix[2][1] 0.0 _pdbx_struct_oper_list.matrix[2][2] 1.0 _pdbx_struct_oper_list.matrix[2][3] 0.0 _pdbx_struct_oper_list.vector[2] 0.0 _pdbx_struct_oper_list.matrix[3][1] 0.0 _pdbx_struct_oper_list.matrix[3][2] 0.0 _pdbx_struct_oper_list.matrix[3][3] 1.0 _pdbx_struct_oper_list.vector[3] 0.0 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 MET A 7 ? LEU A 18 ? MET A 7 LEU A 18 1 ? 12 HELX_P HELX_P2 AA2 SER A 19 ? ASP A 34 ? SER A 19 ASP A 34 1 ? 16 HELX_P HELX_P3 AA3 ALA A 43 ? ASN A 53 ? ALA A 43 ASN A 53 1 ? 11 HELX_P HELX_P4 AA4 ASP A 58 ? GLY A 73 ? ASP A 58 GLY A 73 1 ? 16 HELX_P HELX_P5 AA5 PHE A 79 ? ASP A 93 ? PHE A 79 ASP A 93 1 ? 15 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id AA1 _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 GLU A 40 ? SER A 42 ? GLU A 40 SER A 42 AA1 2 THR A 76 ? SER A 78 ? THR A 76 SER A 78 # _pdbx_struct_sheet_hbond.sheet_id AA1 _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id ILE _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 41 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id ILE _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 41 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id ILE _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 77 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id ILE _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 77 # _pdbx_entry_details.entry_id 9CIF _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification N # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 3 OE1 A GLU 10 ? ? HZ2 A LYS 88 ? ? 1.55 2 4 OE2 A GLU 10 ? ? HZ2 A LYS 88 ? ? 1.58 3 17 HZ2 A LYS 27 ? ? OD2 A ASP 31 ? ? 1.60 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 3 ASP A 34 ? ? -100.82 64.45 2 4 ASP A 34 ? ? -114.26 78.65 3 6 SER A 6 ? ? 67.60 -73.11 4 6 MET A 7 ? ? -166.54 -23.85 5 7 ASP A 72 ? ? -121.34 -53.68 6 8 ASP A 34 ? ? -105.12 62.21 7 9 SER A 6 ? ? -174.52 -42.26 8 10 SER A 74 ? ? -132.34 -39.61 9 11 ASP A 34 ? ? -114.37 78.95 10 13 SER A 8 ? ? -86.80 33.16 11 13 PRO A 56 ? ? -54.58 109.93 12 13 ASP A 72 ? ? -90.60 -80.98 13 14 SER A 6 ? ? 68.14 164.95 14 14 ASP A 34 ? ? -112.55 62.63 15 15 SER A 8 ? ? -76.67 21.43 16 15 PRO A 56 ? ? -51.54 107.20 17 15 ASP A 72 ? ? -107.82 -60.69 18 16 SER A 6 ? ? -64.56 98.97 19 16 MET A 7 ? ? -142.39 -57.52 20 16 SER A 8 ? ? -154.14 15.94 21 17 ASP A 34 ? ? -102.96 72.33 22 17 ASP A 72 ? ? -96.72 -110.21 23 18 MET A 7 ? ? 69.48 -83.55 24 18 SER A 74 ? ? -120.08 -50.01 25 19 SER A 74 ? ? 73.45 -55.98 26 20 ASP A 72 ? ? -122.24 -70.84 # _pdbx_nmr_ensemble.entry_id 9CIF _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 9CIF _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria medoid # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '400 uM [U-99% 13C; U-99% 15N] Single-state design 6306, 100 mM potassium chloride, 90% H2O/10% D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' _pdbx_nmr_sample_details.label 13C_15N_sample _pdbx_nmr_sample_details.type solution _pdbx_nmr_sample_details.details ? # loop_ _pdbx_nmr_exptl_sample.solution_id _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling 1 'Single-state design 6306' 400 ? uM '[U-99% 13C; U-99% 15N]' 1 'potassium chloride' 100 ? mM 'natural abundance' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298.1 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 6.7 _pdbx_nmr_exptl_sample_conditions.ionic_strength 100 _pdbx_nmr_exptl_sample_conditions.details ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_err ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units mM _pdbx_nmr_exptl_sample_conditions.label conditions_1 _pdbx_nmr_exptl_sample_conditions.pH_err ? _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 '2D 1H-15N HSQC' 1 isotropic 2 1 1 '2D 1H-13C HSQC aliphatic' 1 isotropic 3 1 1 '3D HCCH-TOCSY' 1 isotropic 4 1 1 '3D 1H-13C NOESY' 1 isotropic 5 1 1 '3D 1H-15N NOESY' 1 isotropic 6 1 1 '3D CBCA(CO)NH' 2 isotropic 7 1 1 '3D HNCACB' 2 isotropic 8 1 1 '3D C(CO)NH' 2 isotropic 11 1 1 '3D H(CCO)NH' 2 isotropic 10 1 1 '2D HBCBCGCDHD' 2 isotropic 9 1 1 '2D HBCBCGCDCEHE' 2 isotropic # _pdbx_nmr_refine.entry_id 9CIF _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details 'simulated annealing and molecular dynamics' _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 refinement 'X-PLOR NIH' 3.7 'Schwieters, Kuszewski, Tjandra and Clore' 2 'structure calculation' ARTINA ? 'Klukowski, P., Riek, R. and Guntert, P.' 3 'chemical shift assignment' ARTINA ? 'Klukowski, P., Riek, R. and Guntert, P.' 4 'peak picking' ARTINA ? 'Klukowski, P., Riek, R. and Guntert, P.' # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 1 ? A GLY 1 2 1 Y 1 A SER 2 ? A SER 2 3 1 Y 1 A HIS 3 ? A HIS 3 4 1 Y 1 A MET 4 ? A MET 4 5 2 Y 1 A GLY 1 ? A GLY 1 6 2 Y 1 A SER 2 ? A SER 2 7 2 Y 1 A HIS 3 ? A HIS 3 8 2 Y 1 A MET 4 ? A MET 4 9 3 Y 1 A GLY 1 ? A GLY 1 10 3 Y 1 A SER 2 ? A SER 2 11 3 Y 1 A HIS 3 ? A HIS 3 12 3 Y 1 A MET 4 ? A MET 4 13 4 Y 1 A GLY 1 ? A GLY 1 14 4 Y 1 A SER 2 ? A SER 2 15 4 Y 1 A HIS 3 ? A HIS 3 16 4 Y 1 A MET 4 ? A MET 4 17 5 Y 1 A GLY 1 ? A GLY 1 18 5 Y 1 A SER 2 ? A SER 2 19 5 Y 1 A HIS 3 ? A HIS 3 20 5 Y 1 A MET 4 ? A MET 4 21 6 Y 1 A GLY 1 ? A GLY 1 22 6 Y 1 A SER 2 ? A SER 2 23 6 Y 1 A HIS 3 ? A HIS 3 24 6 Y 1 A MET 4 ? A MET 4 25 7 Y 1 A GLY 1 ? A GLY 1 26 7 Y 1 A SER 2 ? A SER 2 27 7 Y 1 A HIS 3 ? A HIS 3 28 7 Y 1 A MET 4 ? A MET 4 29 8 Y 1 A GLY 1 ? A GLY 1 30 8 Y 1 A SER 2 ? A SER 2 31 8 Y 1 A HIS 3 ? A HIS 3 32 8 Y 1 A MET 4 ? A MET 4 33 9 Y 1 A GLY 1 ? A GLY 1 34 9 Y 1 A SER 2 ? A SER 2 35 9 Y 1 A HIS 3 ? A HIS 3 36 9 Y 1 A MET 4 ? A MET 4 37 10 Y 1 A GLY 1 ? A GLY 1 38 10 Y 1 A SER 2 ? A SER 2 39 10 Y 1 A HIS 3 ? A HIS 3 40 10 Y 1 A MET 4 ? A MET 4 41 11 Y 1 A GLY 1 ? A GLY 1 42 11 Y 1 A SER 2 ? A SER 2 43 11 Y 1 A HIS 3 ? A HIS 3 44 11 Y 1 A MET 4 ? A MET 4 45 12 Y 1 A GLY 1 ? A GLY 1 46 12 Y 1 A SER 2 ? A SER 2 47 12 Y 1 A HIS 3 ? A HIS 3 48 12 Y 1 A MET 4 ? A MET 4 49 13 Y 1 A GLY 1 ? A GLY 1 50 13 Y 1 A SER 2 ? A SER 2 51 13 Y 1 A HIS 3 ? A HIS 3 52 13 Y 1 A MET 4 ? A MET 4 53 14 Y 1 A GLY 1 ? A GLY 1 54 14 Y 1 A SER 2 ? A SER 2 55 14 Y 1 A HIS 3 ? A HIS 3 56 14 Y 1 A MET 4 ? A MET 4 57 15 Y 1 A GLY 1 ? A GLY 1 58 15 Y 1 A SER 2 ? A SER 2 59 15 Y 1 A HIS 3 ? A HIS 3 60 15 Y 1 A MET 4 ? A MET 4 61 16 Y 1 A GLY 1 ? A GLY 1 62 16 Y 1 A SER 2 ? A SER 2 63 16 Y 1 A HIS 3 ? A HIS 3 64 16 Y 1 A MET 4 ? A MET 4 65 17 Y 1 A GLY 1 ? A GLY 1 66 17 Y 1 A SER 2 ? A SER 2 67 17 Y 1 A HIS 3 ? A HIS 3 68 17 Y 1 A MET 4 ? A MET 4 69 18 Y 1 A GLY 1 ? A GLY 1 70 18 Y 1 A SER 2 ? A SER 2 71 18 Y 1 A HIS 3 ? A HIS 3 72 18 Y 1 A MET 4 ? A MET 4 73 19 Y 1 A GLY 1 ? A GLY 1 74 19 Y 1 A SER 2 ? A SER 2 75 19 Y 1 A HIS 3 ? A HIS 3 76 19 Y 1 A MET 4 ? A MET 4 77 20 Y 1 A GLY 1 ? A GLY 1 78 20 Y 1 A SER 2 ? A SER 2 79 20 Y 1 A HIS 3 ? A HIS 3 80 20 Y 1 A MET 4 ? A MET 4 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 GLU N N N N 94 GLU CA C N S 95 GLU C C N N 96 GLU O O N N 97 GLU CB C N N 98 GLU CG C N N 99 GLU CD C N N 100 GLU OE1 O N N 101 GLU OE2 O N N 102 GLU OXT O N N 103 GLU H H N N 104 GLU H2 H N N 105 GLU HA H N N 106 GLU HB2 H N N 107 GLU HB3 H N N 108 GLU HG2 H N N 109 GLU HG3 H N N 110 GLU HE2 H N N 111 GLU HXT H N N 112 GLY N N N N 113 GLY CA C N N 114 GLY C C N N 115 GLY O O N N 116 GLY OXT O N N 117 GLY H H N N 118 GLY H2 H N N 119 GLY HA2 H N N 120 GLY HA3 H N N 121 GLY HXT H N N 122 HIS N N N N 123 HIS CA C N S 124 HIS C C N N 125 HIS O O N N 126 HIS CB C N N 127 HIS CG C Y N 128 HIS ND1 N Y N 129 HIS CD2 C Y N 130 HIS CE1 C Y N 131 HIS NE2 N Y N 132 HIS OXT O N N 133 HIS H H N N 134 HIS H2 H N N 135 HIS HA H N N 136 HIS HB2 H N N 137 HIS HB3 H N N 138 HIS HD1 H N N 139 HIS HD2 H N N 140 HIS HE1 H N N 141 HIS HE2 H N N 142 HIS HXT H N N 143 ILE N N N N 144 ILE CA C N S 145 ILE C C N N 146 ILE O O N N 147 ILE CB C N S 148 ILE CG1 C N N 149 ILE CG2 C N N 150 ILE CD1 C N N 151 ILE OXT O N N 152 ILE H H N N 153 ILE H2 H N N 154 ILE HA H N N 155 ILE HB H N N 156 ILE HG12 H N N 157 ILE HG13 H N N 158 ILE HG21 H N N 159 ILE HG22 H N N 160 ILE HG23 H N N 161 ILE HD11 H N N 162 ILE HD12 H N N 163 ILE HD13 H N N 164 ILE HXT H N N 165 LEU N N N N 166 LEU CA C N S 167 LEU C C N N 168 LEU O O N N 169 LEU CB C N N 170 LEU CG C N N 171 LEU CD1 C N N 172 LEU CD2 C N N 173 LEU OXT O N N 174 LEU H H N N 175 LEU H2 H N N 176 LEU HA H N N 177 LEU HB2 H N N 178 LEU HB3 H N N 179 LEU HG H N N 180 LEU HD11 H N N 181 LEU HD12 H N N 182 LEU HD13 H N N 183 LEU HD21 H N N 184 LEU HD22 H N N 185 LEU HD23 H N N 186 LEU HXT H N N 187 LYS N N N N 188 LYS CA C N S 189 LYS C C N N 190 LYS O O N N 191 LYS CB C N N 192 LYS CG C N N 193 LYS CD C N N 194 LYS CE C N N 195 LYS NZ N N N 196 LYS OXT O N N 197 LYS H H N N 198 LYS H2 H N N 199 LYS HA H N N 200 LYS HB2 H N N 201 LYS HB3 H N N 202 LYS HG2 H N N 203 LYS HG3 H N N 204 LYS HD2 H N N 205 LYS HD3 H N N 206 LYS HE2 H N N 207 LYS HE3 H N N 208 LYS HZ1 H N N 209 LYS HZ2 H N N 210 LYS HZ3 H N N 211 LYS HXT H N N 212 MET N N N N 213 MET CA C N S 214 MET C C N N 215 MET O O N N 216 MET CB C N N 217 MET CG C N N 218 MET SD S N N 219 MET CE C N N 220 MET OXT O N N 221 MET H H N N 222 MET H2 H N N 223 MET HA H N N 224 MET HB2 H N N 225 MET HB3 H N N 226 MET HG2 H N N 227 MET HG3 H N N 228 MET HE1 H N N 229 MET HE2 H N N 230 MET HE3 H N N 231 MET HXT H N N 232 PHE N N N N 233 PHE CA C N S 234 PHE C C N N 235 PHE O O N N 236 PHE CB C N N 237 PHE CG C Y N 238 PHE CD1 C Y N 239 PHE CD2 C Y N 240 PHE CE1 C Y N 241 PHE CE2 C Y N 242 PHE CZ C Y N 243 PHE OXT O N N 244 PHE H H N N 245 PHE H2 H N N 246 PHE HA H N N 247 PHE HB2 H N N 248 PHE HB3 H N N 249 PHE HD1 H N N 250 PHE HD2 H N N 251 PHE HE1 H N N 252 PHE HE2 H N N 253 PHE HZ H N N 254 PHE HXT H N N 255 PRO N N N N 256 PRO CA C N S 257 PRO C C N N 258 PRO O O N N 259 PRO CB C N N 260 PRO CG C N N 261 PRO CD C N N 262 PRO OXT O N N 263 PRO H H N N 264 PRO HA H N N 265 PRO HB2 H N N 266 PRO HB3 H N N 267 PRO HG2 H N N 268 PRO HG3 H N N 269 PRO HD2 H N N 270 PRO HD3 H N N 271 PRO HXT H N N 272 SER N N N N 273 SER CA C N S 274 SER C C N N 275 SER O O N N 276 SER CB C N N 277 SER OG O N N 278 SER OXT O N N 279 SER H H N N 280 SER H2 H N N 281 SER HA H N N 282 SER HB2 H N N 283 SER HB3 H N N 284 SER HG H N N 285 SER HXT H N N 286 THR N N N N 287 THR CA C N S 288 THR C C N N 289 THR O O N N 290 THR CB C N R 291 THR OG1 O N N 292 THR CG2 C N N 293 THR OXT O N N 294 THR H H N N 295 THR H2 H N N 296 THR HA H N N 297 THR HB H N N 298 THR HG1 H N N 299 THR HG21 H N N 300 THR HG22 H N N 301 THR HG23 H N N 302 THR HXT H N N 303 TYR N N N N 304 TYR CA C N S 305 TYR C C N N 306 TYR O O N N 307 TYR CB C N N 308 TYR CG C Y N 309 TYR CD1 C Y N 310 TYR CD2 C Y N 311 TYR CE1 C Y N 312 TYR CE2 C Y N 313 TYR CZ C Y N 314 TYR OH O N N 315 TYR OXT O N N 316 TYR H H N N 317 TYR H2 H N N 318 TYR HA H N N 319 TYR HB2 H N N 320 TYR HB3 H N N 321 TYR HD1 H N N 322 TYR HD2 H N N 323 TYR HE1 H N N 324 TYR HE2 H N N 325 TYR HH H N N 326 TYR HXT H N N 327 VAL N N N N 328 VAL CA C N S 329 VAL C C N N 330 VAL O O N N 331 VAL CB C N N 332 VAL CG1 C N N 333 VAL CG2 C N N 334 VAL OXT O N N 335 VAL H H N N 336 VAL H2 H N N 337 VAL HA H N N 338 VAL HB H N N 339 VAL HG11 H N N 340 VAL HG12 H N N 341 VAL HG13 H N N 342 VAL HG21 H N N 343 VAL HG22 H N N 344 VAL HG23 H N N 345 VAL HXT H N N 346 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 HIS N CA sing N N 116 HIS N H sing N N 117 HIS N H2 sing N N 118 HIS CA C sing N N 119 HIS CA CB sing N N 120 HIS CA HA sing N N 121 HIS C O doub N N 122 HIS C OXT sing N N 123 HIS CB CG sing N N 124 HIS CB HB2 sing N N 125 HIS CB HB3 sing N N 126 HIS CG ND1 sing Y N 127 HIS CG CD2 doub Y N 128 HIS ND1 CE1 doub Y N 129 HIS ND1 HD1 sing N N 130 HIS CD2 NE2 sing Y N 131 HIS CD2 HD2 sing N N 132 HIS CE1 NE2 sing Y N 133 HIS CE1 HE1 sing N N 134 HIS NE2 HE2 sing N N 135 HIS OXT HXT sing N N 136 ILE N CA sing N N 137 ILE N H sing N N 138 ILE N H2 sing N N 139 ILE CA C sing N N 140 ILE CA CB sing N N 141 ILE CA HA sing N N 142 ILE C O doub N N 143 ILE C OXT sing N N 144 ILE CB CG1 sing N N 145 ILE CB CG2 sing N N 146 ILE CB HB sing N N 147 ILE CG1 CD1 sing N N 148 ILE CG1 HG12 sing N N 149 ILE CG1 HG13 sing N N 150 ILE CG2 HG21 sing N N 151 ILE CG2 HG22 sing N N 152 ILE CG2 HG23 sing N N 153 ILE CD1 HD11 sing N N 154 ILE CD1 HD12 sing N N 155 ILE CD1 HD13 sing N N 156 ILE OXT HXT sing N N 157 LEU N CA sing N N 158 LEU N H sing N N 159 LEU N H2 sing N N 160 LEU CA C sing N N 161 LEU CA CB sing N N 162 LEU CA HA sing N N 163 LEU C O doub N N 164 LEU C OXT sing N N 165 LEU CB CG sing N N 166 LEU CB HB2 sing N N 167 LEU CB HB3 sing N N 168 LEU CG CD1 sing N N 169 LEU CG CD2 sing N N 170 LEU CG HG sing N N 171 LEU CD1 HD11 sing N N 172 LEU CD1 HD12 sing N N 173 LEU CD1 HD13 sing N N 174 LEU CD2 HD21 sing N N 175 LEU CD2 HD22 sing N N 176 LEU CD2 HD23 sing N N 177 LEU OXT HXT sing N N 178 LYS N CA sing N N 179 LYS N H sing N N 180 LYS N H2 sing N N 181 LYS CA C sing N N 182 LYS CA CB sing N N 183 LYS CA HA sing N N 184 LYS C O doub N N 185 LYS C OXT sing N N 186 LYS CB CG sing N N 187 LYS CB HB2 sing N N 188 LYS CB HB3 sing N N 189 LYS CG CD sing N N 190 LYS CG HG2 sing N N 191 LYS CG HG3 sing N N 192 LYS CD CE sing N N 193 LYS CD HD2 sing N N 194 LYS CD HD3 sing N N 195 LYS CE NZ sing N N 196 LYS CE HE2 sing N N 197 LYS CE HE3 sing N N 198 LYS NZ HZ1 sing N N 199 LYS NZ HZ2 sing N N 200 LYS NZ HZ3 sing N N 201 LYS OXT HXT sing N N 202 MET N CA sing N N 203 MET N H sing N N 204 MET N H2 sing N N 205 MET CA C sing N N 206 MET CA CB sing N N 207 MET CA HA sing N N 208 MET C O doub N N 209 MET C OXT sing N N 210 MET CB CG sing N N 211 MET CB HB2 sing N N 212 MET CB HB3 sing N N 213 MET CG SD sing N N 214 MET CG HG2 sing N N 215 MET CG HG3 sing N N 216 MET SD CE sing N N 217 MET CE HE1 sing N N 218 MET CE HE2 sing N N 219 MET CE HE3 sing N N 220 MET OXT HXT sing N N 221 PHE N CA sing N N 222 PHE N H sing N N 223 PHE N H2 sing N N 224 PHE CA C sing N N 225 PHE CA CB sing N N 226 PHE CA HA sing N N 227 PHE C O doub N N 228 PHE C OXT sing N N 229 PHE CB CG sing N N 230 PHE CB HB2 sing N N 231 PHE CB HB3 sing N N 232 PHE CG CD1 doub Y N 233 PHE CG CD2 sing Y N 234 PHE CD1 CE1 sing Y N 235 PHE CD1 HD1 sing N N 236 PHE CD2 CE2 doub Y N 237 PHE CD2 HD2 sing N N 238 PHE CE1 CZ doub Y N 239 PHE CE1 HE1 sing N N 240 PHE CE2 CZ sing Y N 241 PHE CE2 HE2 sing N N 242 PHE CZ HZ sing N N 243 PHE OXT HXT sing N N 244 PRO N CA sing N N 245 PRO N CD sing N N 246 PRO N H sing N N 247 PRO CA C sing N N 248 PRO CA CB sing N N 249 PRO CA HA sing N N 250 PRO C O doub N N 251 PRO C OXT sing N N 252 PRO CB CG sing N N 253 PRO CB HB2 sing N N 254 PRO CB HB3 sing N N 255 PRO CG CD sing N N 256 PRO CG HG2 sing N N 257 PRO CG HG3 sing N N 258 PRO CD HD2 sing N N 259 PRO CD HD3 sing N N 260 PRO OXT HXT sing N N 261 SER N CA sing N N 262 SER N H sing N N 263 SER N H2 sing N N 264 SER CA C sing N N 265 SER CA CB sing N N 266 SER CA HA sing N N 267 SER C O doub N N 268 SER C OXT sing N N 269 SER CB OG sing N N 270 SER CB HB2 sing N N 271 SER CB HB3 sing N N 272 SER OG HG sing N N 273 SER OXT HXT sing N N 274 THR N CA sing N N 275 THR N H sing N N 276 THR N H2 sing N N 277 THR CA C sing N N 278 THR CA CB sing N N 279 THR CA HA sing N N 280 THR C O doub N N 281 THR C OXT sing N N 282 THR CB OG1 sing N N 283 THR CB CG2 sing N N 284 THR CB HB sing N N 285 THR OG1 HG1 sing N N 286 THR CG2 HG21 sing N N 287 THR CG2 HG22 sing N N 288 THR CG2 HG23 sing N N 289 THR OXT HXT sing N N 290 TYR N CA sing N N 291 TYR N H sing N N 292 TYR N H2 sing N N 293 TYR CA C sing N N 294 TYR CA CB sing N N 295 TYR CA HA sing N N 296 TYR C O doub N N 297 TYR C OXT sing N N 298 TYR CB CG sing N N 299 TYR CB HB2 sing N N 300 TYR CB HB3 sing N N 301 TYR CG CD1 doub Y N 302 TYR CG CD2 sing Y N 303 TYR CD1 CE1 sing Y N 304 TYR CD1 HD1 sing N N 305 TYR CD2 CE2 doub Y N 306 TYR CD2 HD2 sing N N 307 TYR CE1 CZ doub Y N 308 TYR CE1 HE1 sing N N 309 TYR CE2 CZ sing Y N 310 TYR CE2 HE2 sing N N 311 TYR CZ OH sing N N 312 TYR OH HH sing N N 313 TYR OXT HXT sing N N 314 VAL N CA sing N N 315 VAL N H sing N N 316 VAL N H2 sing N N 317 VAL CA C sing N N 318 VAL CA CB sing N N 319 VAL CA HA sing N N 320 VAL C O doub N N 321 VAL C OXT sing N N 322 VAL CB CG1 sing N N 323 VAL CB CG2 sing N N 324 VAL CB HB sing N N 325 VAL CG1 HG11 sing N N 326 VAL CG1 HG12 sing N N 327 VAL CG1 HG13 sing N N 328 VAL CG2 HG21 sing N N 329 VAL CG2 HG22 sing N N 330 VAL CG2 HG23 sing N N 331 VAL OXT HXT sing N N 332 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'National Science Foundation (NSF, United States)' 'United States' ? 1 'Chan Zuckerberg Initiative' 'United States' ? 2 'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' 'United States' ? 3 # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.type _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.details 1 AVANCE ? Bruker 800 ? 2 AVANCE ? Bruker 600 ? # _atom_sites.entry_id 9CIF _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C H N O S # loop_ #